Symbol:
Ucp1
Name:
uncoupling protein 1
RGD ID:
3931
Description:
Enables GDP binding activity; GTP binding activity; and oxidative phosphorylation uncoupler activity. Involved in several processes, including cellular response to dehydroepiandrosterone; cellular response to fatty acid; and proton transmembrane transport. Located in mitochondrion. Biomarker of prediabetes syndrome. Human ortholog(s) of this gene implicated in hypertension and type 2 diabetes mellitus. Orthologous to human UCP1 (uncoupling protein 1); PARTICIPATES IN eicosanoid signaling pathway via peroxisome proliferator-activated receptor gamma; Huntington's disease pathway; INTERACTS WITH (+)-taxifolin; (R)-noradrenaline; (S)-naringenin.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC100909612; MGC108736; mitochondrial brown fat uncoupling protein 1; mitochondrial brown fat uncoupling protein 1-like; solute carrier family 25 member 7; thermogenin; Ucp; UCP 1; Ucpa; Uncoupling protein; uncoupling protein 1 (mitochondrial, proton carrier); uncoupling protein 1 mitochondrial; uncoupling protein 1, mitochondrial; Uncp
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
UCP1 (uncoupling protein 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Ucp1 (uncoupling protein 1 (mitochondrial, proton carrier)) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Ucp1 (uncoupling protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
UCP1 (uncoupling protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
UCP1 (uncoupling protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Ucp1 (uncoupling protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
UCP1 (uncoupling protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
UCP1 (uncoupling protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Ucp1 (uncoupling protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
UCP1 (uncoupling protein 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Ucp1 (uncoupling protein 1 (mitochondrial, proton carrier))
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
ucp1 (uncoupling protein 1)
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
ucp1
Alliance
DIOPT (Ensembl Compara|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 19 41,713,350 - 41,721,421 (-) NCBI GRCr8 mRatBN7.2 19 24,808,782 - 24,816,853 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 19 24,808,783 - 24,816,852 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 19 31,627,843 - 31,635,958 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 19 32,282,249 - 32,290,366 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 19 34,500,303 - 34,508,418 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 19 24,456,976 - 24,464,808 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 19 24,456,976 - 24,464,807 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 19 35,434,980 - 35,442,812 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 19 26,527,548 - 26,535,621 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 19 26,532,373 - 26,540,447 (-) NCBI Celera 19 24,348,444 - 24,356,517 (-) NCBI Celera Cytogenetic Map 19 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ucp1 Rat (+)-taxifolin multiple interactions EXP 6480464 taxifolin analog inhibits the reaction [Dietary Fats results in decreased expression of UCP1 mRNA] CTD PMID:30372826 Ucp1 Rat (R)-noradrenaline multiple interactions ISO Ucp1 (Mus musculus) 6480464 [Rosiglitazone results in increased susceptibility to Norepinephrine] which results in increased expression of UCP1 mRNA more ... CTD PMID:10788502 and PMID:29910772 Ucp1 Rat (R)-noradrenaline multiple interactions EXP 6480464 [AVP protein co-treated with Norepinephrine] inhibits the reaction [Triiodothyronine inhibits the reaction [EGF protein results in decreased expression of UCP1 mRNA]] more ... CTD PMID:11742803 Ucp1 Rat (R)-noradrenaline increases expression ISO Ucp1 (Mus musculus) 6480464 Norepinephrine results in increased expression of UCP1 mRNA CTD PMID:10465291 more ... Ucp1 Rat (S)-naringenin multiple interactions EXP 6480464 naringenin inhibits the reaction [Dietary Fats results in decreased expression of UCP1 mRNA] CTD PMID:30372826 Ucp1 Rat (S)-nicotine decreases expression EXP 6480464 Nicotine results in decreased expression of UCP1 mRNA and Nicotine results in decreased expression of UCP1 protein CTD PMID:33091441 Ucp1 Rat (S)-nicotine multiple interactions ISO Ucp1 (Mus musculus) 6480464 [BMP7 protein co-treated with INS1 protein co-treated with Triiodothyronine co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with Indomethacin co-treated with Nicotine] affects the expression of UCP1 mRNA and [BMP7 protein co-treated with INS1 protein co-treated with Triiodothyronine co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with Indomethacin co-treated with Nicotine] affects the expression of UCP1 protein CTD PMID:33091441 Ucp1 Rat 15-acetyldeoxynivalenol increases expression ISO UCP1 (Homo sapiens) 6480464 15-acetyldeoxynivalenol results in increased expression of UCP1 mRNA CTD PMID:23792671 Ucp1 Rat 17beta-estradiol increases expression ISO Ucp1 (Mus musculus) 6480464 Estradiol results in increased expression of UCP1 mRNA CTD PMID:21683088 Ucp1 Rat 17beta-estradiol decreases expression ISO Ucp1 (Mus musculus) 6480464 Estradiol results in decreased expression of UCP1 mRNA CTD PMID:19484750 Ucp1 Rat 2,2',5,5'-tetrachlorobiphenyl increases expression EXP 6480464 2 more ... CTD PMID:23829299 Ucp1 Rat 2,4-dinitrophenol multiple interactions ISO Ucp1 (Mus musculus) 6480464 [2 and 4-Dinitrophenol co-treated with Dietary Fats] affects the expression of UCP1 mRNA CTD PMID:24872412 Ucp1 Rat 3,3',5-triiodo-L-thyronine increases expression EXP 6480464 Triiodothyronine results in increased expression of UCP1 mRNA CTD PMID:11742803 Ucp1 Rat 3,3',5-triiodo-L-thyronine increases expression ISO Ucp1 (Mus musculus) 6480464 Triiodothyronine results in increased expression of UCP1 mRNA and Triiodothyronine results in increased expression of UCP1 protein CTD PMID:30209975 Ucp1 Rat 3,3',5-triiodo-L-thyronine multiple interactions ISO UCP1 (Homo sapiens) 6480464 [Rosiglitazone co-treated with TF protein co-treated with INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Hydrocortisone co-treated with Triiodothyronine] results in increased expression of UCP1 mRNA more ... CTD PMID:33476690 Ucp1 Rat 3,3',5-triiodo-L-thyronine multiple interactions EXP 6480464 [AVP protein co-treated with Norepinephrine] inhibits the reaction [Triiodothyronine inhibits the reaction [EGF protein results in decreased expression of UCP1 mRNA]] more ... CTD PMID:11742803 Ucp1 Rat 3,3',5-triiodo-L-thyronine multiple interactions ISO Ucp1 (Mus musculus) 6480464 (+)-JQ1 compound inhibits the reaction [[Triiodothyronine co-treated with Rosiglitazone co-treated with INS1 protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine] results in increased expression of UCP1 mRNA] more ... CTD PMID:26972250 and PMID:33091441 Ucp1 Rat 3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione multiple interactions EXP 6480464 bisindolylmaleimide I inhibits the reaction [EGF protein results in decreased expression of UCP1 mRNA] more ... CTD PMID:11742803 Ucp1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO Ucp1 (Mus musculus) 6480464 (+)-JQ1 compound inhibits the reaction [[Triiodothyronine co-treated with Rosiglitazone co-treated with INS1 protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine] results in increased expression of UCP1 mRNA] more ... CTD PMID:26972250 more ... Ucp1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO UCP1 (Homo sapiens) 6480464 [INS protein co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with Rosiglitazone co-treated with bisphenol AF] results in increased expression of UCP1 mRNA more ... CTD PMID:31596606 and PMID:33476690 Ucp1 Rat 9-cis-retinoic acid increases expression EXP 6480464 Alitretinoin results in increased expression of UCP1 mRNA CTD PMID:12414803 Ucp1 Rat 9-cis-retinoic acid multiple interactions EXP 6480464 2-(4-nitrophenyl)-4-(4-fluorophenyl)-5-(4-pyridinyl)-1H-imidazole inhibits the reaction [Alitretinoin results in increased expression of UCP1 mRNA] and Glutathione inhibits the reaction [Alitretinoin results in increased expression of UCP1 mRNA] CTD PMID:12414803 Ucp1 Rat 9-cis-retinoic acid increases expression ISO Ucp1 (Mus musculus) 6480464 Alitretinoin results in increased expression of UCP1 mRNA CTD PMID:10600643 Ucp1 Rat abacavir increases expression ISO UCP1 (Homo sapiens) 6480464 abacavir results in increased expression of UCP1 mRNA CTD PMID:14518702 Ucp1 Rat albuterol increases expression ISO Ucp1 (Mus musculus) 6480464 Albuterol results in increased expression of UCP1 protein CTD PMID:10465291 Ucp1 Rat aldehydo-D-glucose multiple interactions EXP 6480464 UCP1 protein inhibits the reaction [[Glucose results in increased chemical synthesis of Superoxides] which results in decreased activity of GAPDH protein] more ... CTD PMID:11050244 more ... Ucp1 Rat aldehydo-D-glucose multiple interactions ISO UCP1 (Homo sapiens) 6480464 UCP1 inhibits the reaction [Glucose results in decreased expression of GLO1 protein] more ... CTD PMID:19833897 Ucp1 Rat aldehydo-D-glucose decreases response to substance EXP 6480464 UCP1 protein results in decreased susceptibility to Glucose CTD PMID:11050244 Ucp1 Rat all-trans-retinoic acid increases expression ISO Ucp1 (Mus musculus) 6480464 Tretinoin results in increased expression of UCP1 mRNA and Tretinoin results in increased expression of UCP1 protein CTD PMID:10600643 more ... Ucp1 Rat all-trans-retinol multiple interactions EXP 6480464 LEP gene mutant form promotes the reaction [Vitamin A results in increased expression of UCP1 mRNA] CTD PMID:16493122 Ucp1 Rat Amibegron multiple interactions EXP 6480464 3-(2-ethylphenoxy)-1-(1 more ... CTD PMID:9718277 Ucp1 Rat Amibegron increases expression EXP 6480464 amibegron results in increased expression of UCP1 mRNA CTD PMID:9718277 Ucp1 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of UCP1 mRNA CTD PMID:30047161 Ucp1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of UCP1 mRNA CTD PMID:16483693 Ucp1 Rat arotinoid acid increases expression ISO Ucp1 (Mus musculus) 6480464 4-(2-(5 more ... CTD PMID:10600643 Ucp1 Rat arsane increases expression ISO Ucp1 (Mus musculus) 6480464 Arsenic results in increased expression of UCP1 mRNA CTD PMID:19654921 Ucp1 Rat arsane multiple interactions ISO Ucp1 (Mus musculus) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of UCP1 mRNA CTD PMID:32045263 Ucp1 Rat arsenic atom increases expression ISO Ucp1 (Mus musculus) 6480464 Arsenic results in increased expression of UCP1 mRNA CTD PMID:19654921 Ucp1 Rat arsenic atom multiple interactions ISO Ucp1 (Mus musculus) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of UCP1 mRNA CTD PMID:32045263 Ucp1 Rat arsenous acid increases expression ISO UCP1 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of UCP1 mRNA CTD PMID:24356939 Ucp1 Rat ATP multiple interactions EXP 6480464 Adenosine Triphosphate inhibits the reaction [UCP1 protein results in increased transport of Protons] CTD PMID:12734183 Ucp1 Rat ATP decreases abundance ISO Ucp1 (Mus musculus) 6480464 UCP1 results in decreased abundance of Adenosine Triphosphate CTD PMID:26670611 Ucp1 Rat ATP multiple interactions ISO UCP1 (Homo sapiens) 6480464 UCP1 protein promotes the reaction [PPARG protein mutant form results in decreased abundance of Adenosine Triphosphate] and UCP1 protein promotes the reaction [rosiglitazone promotes the reaction [PPARG protein results in decreased abundance of Adenosine Triphosphate]] CTD PMID:26670611 Ucp1 Rat benzene decreases expression ISO UCP1 (Homo sapiens) 6480464 Benzene results in decreased expression of UCP1 mRNA CTD PMID:15929907 Ucp1 Rat benzo[a]pyrene increases expression ISO UCP1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of UCP1 mRNA CTD PMID:17879257 Ucp1 Rat benzo[a]pyrene decreases methylation ISO UCP1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of UCP1 exon CTD PMID:27901495 Ucp1 Rat benzo[a]pyrene affects methylation ISO UCP1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of UCP1 promoter CTD PMID:27901495 Ucp1 Rat benzo[a]pyrene multiple interactions ISO Ucp1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of UCP1 mRNA CTD PMID:27858113 Ucp1 Rat benzo[a]pyrene decreases expression ISO UCP1 (Homo sapiens) 6480464 Benzo(a)pyrene metabolite results in decreased expression of UCP1 mRNA CTD PMID:24356939 Ucp1 Rat benzo[b]fluoranthene decreases expression ISO Ucp1 (Mus musculus) 6480464 benzo(b)fluoranthene results in decreased expression of UCP1 mRNA CTD PMID:26377693 Ucp1 Rat benzo[b]fluoranthene multiple interactions ISO Ucp1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of UCP1 mRNA CTD PMID:27858113 Ucp1 Rat bis(2-ethylhexyl) phthalate increases expression ISO Ucp1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of UCP1 mRNA CTD PMID:32522588 Ucp1 Rat bis(2-ethylhexyl) phthalate decreases expression ISO UCP1 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in decreased expression of UCP1 mRNA CTD PMID:33846374 Ucp1 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Ucp1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of UCP1 mRNA CTD PMID:31706747 Ucp1 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Ucp1 (Mus musculus) 6480464 [diethyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with Diethylhexyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisononyl phthalate] results in decreased expression of UCP1 mRNA CTD PMID:37021957 Ucp1 Rat bisphenol A increases expression ISO Ucp1 (Mus musculus) 6480464 bisphenol A results in increased expression of UCP1 and bisphenol A results in increased expression of UCP1 mRNA CTD PMID:24726836 and PMID:25594700 Ucp1 Rat bisphenol A decreases methylation ISO UCP1 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of UCP1 gene CTD PMID:31601247 Ucp1 Rat bisphenol A multiple interactions EXP 6480464 lithospermate B inhibits the reaction [bisphenol A results in decreased expression of UCP1 protein] CTD PMID:34165232 Ucp1 Rat bisphenol A multiple interactions ISO Ucp1 (Mus musculus) 6480464 [NR1H4 gene mutant form affects the susceptibility to bisphenol A] which results in increased expression of UCP1 mRNA CTD PMID:30245210 Ucp1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of UCP1 mRNA and bisphenol A results in decreased expression of UCP1 protein CTD PMID:25181051 and PMID:34165232 Ucp1 Rat bisphenol AF multiple interactions ISO UCP1 (Homo sapiens) 6480464 [INS protein co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with Rosiglitazone co-treated with bisphenol AF] results in increased expression of UCP1 mRNA and IFNG protein inhibits the reaction [[INS protein co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with Rosiglitazone co-treated with bisphenol AF] results in increased expression of UCP1 mRNA] CTD PMID:31596606 Ucp1 Rat bucladesine increases expression EXP 6480464 Bucladesine results in increased expression of UCP1 mRNA CTD PMID:12414803 Ucp1 Rat bucladesine multiple interactions EXP 6480464 N-(2-(4-bromocinnamylamino)ethyl)-5-isoquinolinesulfonamide inhibits the reaction [Bucladesine results in increased expression of UCP1 mRNA] CTD PMID:12414803 Ucp1 Rat Butylbenzyl phthalate multiple interactions ISO Ucp1 (Mus musculus) 6480464 [diethyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with Diethylhexyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisononyl phthalate] results in decreased expression of UCP1 mRNA CTD PMID:37021957 Ucp1 Rat cannabidiol increases expression ISO Ucp1 (Mus musculus) 6480464 Cannabidiol analog results in increased expression of UCP1 protein CTD PMID:30382123 Ucp1 Rat cannabidiol multiple interactions ISO Ucp1 (Mus musculus) 6480464 Dietary Fats inhibits the reaction [Cannabidiol analog results in increased expression of UCP1 protein] CTD PMID:30382123 Ucp1 Rat capsaicin decreases expression EXP 6480464 Capsaicin results in decreased expression of UCP1 mRNA and Capsaicin results in decreased expression of UCP1 protein CTD PMID:18079164 Ucp1 Rat capsaicin multiple interactions EXP 6480464 Capsaicin promotes the reaction [Dietary Fats results in increased expression of UCP1 mRNA] CTD PMID:20359164 Ucp1 Rat carbon nanotube decreases expression ISO Ucp1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Ucp1 Rat CGP 52608 multiple interactions ISO UCP1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to UCP1 gene] CTD PMID:28238834 Ucp1 Rat chlordecone multiple interactions ISO Ucp1 (Mus musculus) 6480464 Chlordecone promotes the reaction [Biomarkers metabolite binds to UCP1 gene] CTD PMID:31084621 Ucp1 Rat chromium atom multiple interactions ISO Ucp1 (Mus musculus) 6480464 LEPR gene mutant form promotes the reaction [[Niacin binds to Chromium] which results in decreased expression of UCP1 mRNA] CTD PMID:16940432 Ucp1 Rat chrysene multiple interactions ISO Ucp1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of UCP1 mRNA CTD PMID:27858113 Ucp1 Rat CL316243 increases expression ISO Ucp1 (Mus musculus) 6480464 disodium (R more ... CTD PMID:29910772 Ucp1 Rat CL316243 multiple interactions ISO Ucp1 (Mus musculus) 6480464 [Rosiglitazone results in increased susceptibility to disodium (R more ... CTD PMID:29910772 Ucp1 Rat CL316243 increases expression EXP 6480464 disodium (R more ... CTD PMID:20184727 Ucp1 Rat clenbuterol increases expression ISO Ucp1 (Mus musculus) 6480464 Clenbuterol results in increased expression of UCP1 protein CTD PMID:10465291 Ucp1 Rat clofibrate multiple interactions ISO Ucp1 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of UCP1 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of UCP1 mRNA] CTD PMID:17585979 Ucp1 Rat cobalt dichloride increases expression ISO Ucp1 (Mus musculus) 6480464 cobaltous chloride results in increased expression of UCP1 mRNA CTD PMID:21139344 Ucp1 Rat colforsin daropate hydrochloride multiple interactions ISO Ucp1 (Mus musculus) 6480464 Colforsin inhibits the reaction [geniposide results in decreased expression of UCP1 mRNA] and Colforsin inhibits the reaction [geniposide results in decreased expression of UCP1 protein] CTD PMID:34718029 Ucp1 Rat cortisol multiple interactions ISO UCP1 (Homo sapiens) 6480464 [Rosiglitazone co-treated with TF protein co-treated with INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Hydrocortisone co-treated with Triiodothyronine] results in increased expression of UCP1 mRNA more ... CTD PMID:33476690 Ucp1 Rat curcumin affects expression ISO Ucp1 (Mus musculus) 6480464 Curcumin affects the expression of UCP1 mRNA CTD PMID:27208389 Ucp1 Rat Cyclopamine multiple interactions ISO UCP1 (Homo sapiens) 6480464 cyclopamine inhibits the reaction [N4-(2 more ... CTD PMID:25487280 Ucp1 Rat cyclophosphamide decreases expression ISO UCP1 (Homo sapiens) 6480464 Cyclophosphamide metabolite results in decreased expression of UCP1 mRNA CTD PMID:24356939 Ucp1 Rat D-glucose decreases response to substance EXP 6480464 UCP1 protein results in decreased susceptibility to Glucose CTD PMID:11050244 Ucp1 Rat D-glucose multiple interactions ISO UCP1 (Homo sapiens) 6480464 UCP1 inhibits the reaction [Glucose results in decreased expression of GLO1 protein] more ... CTD PMID:19833897 Ucp1 Rat D-glucose multiple interactions EXP 6480464 UCP1 protein inhibits the reaction [[Glucose results in increased chemical synthesis of Superoxides] which results in decreased activity of GAPDH protein] more ... CTD PMID:11050244 more ... Ucp1 Rat dehydroepiandrosterone decreases expression EXP 6480464 Dehydroepiandrosterone results in decreased expression of UCP1 mRNA CTD PMID:12659879 Ucp1 Rat dehydroepiandrosterone increases expression EXP 6480464 Dehydroepiandrosterone results in increased expression of UCP1 mRNA and Dehydroepiandrosterone results in increased expression of UCP1 protein CTD PMID:12659879 Ucp1 Rat dexamethasone increases expression ISO UCP1 (Homo sapiens) 6480464 Dexamethasone results in increased expression of UCP1 mRNA CTD PMID:19853017 Ucp1 Rat dexamethasone multiple interactions ISO UCP1 (Homo sapiens) 6480464 [INS protein co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with Rosiglitazone co-treated with bisphenol AF] results in increased expression of UCP1 mRNA more ... CTD PMID:31596606 and PMID:33476690 Ucp1 Rat dexamethasone multiple interactions ISO Ucp1 (Mus musculus) 6480464 (+)-JQ1 compound inhibits the reaction [[Triiodothyronine co-treated with Rosiglitazone co-treated with INS1 protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine] results in increased expression of UCP1 mRNA] more ... CTD PMID:26972250 more ... Ucp1 Rat diarsenic trioxide increases expression ISO UCP1 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of UCP1 mRNA CTD PMID:24356939 Ucp1 Rat dibutyl phthalate multiple interactions ISO Ucp1 (Mus musculus) 6480464 [diethyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with Diethylhexyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisononyl phthalate] results in decreased expression of UCP1 mRNA CTD PMID:37021957 Ucp1 Rat diethyl phthalate multiple interactions ISO Ucp1 (Mus musculus) 6480464 [diethyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with Diethylhexyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisononyl phthalate] results in decreased expression of UCP1 mRNA CTD PMID:37021957 Ucp1 Rat diisobutyl phthalate multiple interactions ISO Ucp1 (Mus musculus) 6480464 [diethyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with Diethylhexyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisononyl phthalate] results in decreased expression of UCP1 mRNA CTD PMID:37021957 Ucp1 Rat diisononyl phthalate multiple interactions ISO Ucp1 (Mus musculus) 6480464 [diethyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with Diethylhexyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisononyl phthalate] results in decreased expression of UCP1 mRNA CTD PMID:37021957 Ucp1 Rat dioxygen increases expression ISO Ucp1 (Mus musculus) 6480464 Oxygen deficiency results in increased expression of UCP1 mRNA CTD PMID:23539316 Ucp1 Rat divanadium pentaoxide decreases expression ISO Ucp1 (Mus musculus) 6480464 vanadium pentoxide results in decreased expression of UCP1 mRNA CTD PMID:26210822 Ucp1 Rat dorsomorphin multiple interactions ISO Ucp1 (Mus musculus) 6480464 dorsomorphin inhibits the reaction [Resveratrol results in increased expression of UCP1 protein] CTD PMID:25761413 Ucp1 Rat enniatin increases expression ISO UCP1 (Homo sapiens) 6480464 enniatins results in increased expression of UCP1 mRNA CTD PMID:30227181 and PMID:36016515 Ucp1 Rat ethylparaben increases expression ISO UCP1 (Homo sapiens) 6480464 ethyl-p-hydroxybenzoate results in increased expression of UCP1 mRNA CTD PMID:37690743 Ucp1 Rat flavonoids decreases expression EXP 6480464 Flavonoids results in decreased expression of UCP1 mRNA CTD PMID:18035473 Ucp1 Rat fonofos increases methylation ISO UCP1 (Homo sapiens) 6480464 Fonofos results in increased methylation of UCP1 promoter CTD PMID:22847954 Ucp1 Rat fructose decreases expression EXP 6480464 Fructose results in decreased expression of UCP1 mRNA CTD PMID:23968387 Ucp1 Rat fructose multiple interactions EXP 6480464 Fructose promotes the reaction [[Ozone co-treated with Particulate Matter] results in decreased expression of UCP1 mRNA] more ... CTD PMID:23968387 Ucp1 Rat Ganoderic acid A multiple interactions ISO Ucp1 (Mus musculus) 6480464 [Dietary Fats co-treated with ganoderic acid A] affects the expression of UCP1 mRNA CTD PMID:29852127 Ucp1 Rat Geniposide multiple interactions ISO Ucp1 (Mus musculus) 6480464 Colforsin inhibits the reaction [geniposide results in decreased expression of UCP1 mRNA] and Colforsin inhibits the reaction [geniposide results in decreased expression of UCP1 protein] CTD PMID:34718029 Ucp1 Rat Geniposide decreases expression ISO Ucp1 (Mus musculus) 6480464 geniposide results in decreased expression of UCP1 mRNA and geniposide results in decreased expression of UCP1 protein CTD PMID:34718029 Ucp1 Rat Geniposide decreases stability ISO Ucp1 (Mus musculus) 6480464 geniposide results in decreased stability of UCP1 protein CTD PMID:34718029 Ucp1 Rat glucose decreases response to substance EXP 6480464 UCP1 protein results in decreased susceptibility to Glucose CTD PMID:11050244 Ucp1 Rat glucose multiple interactions ISO UCP1 (Homo sapiens) 6480464 UCP1 inhibits the reaction [Glucose results in decreased expression of GLO1 protein] more ... CTD PMID:19833897 Ucp1 Rat glucose multiple interactions EXP 6480464 UCP1 protein inhibits the reaction [[Glucose results in increased chemical synthesis of Superoxides] which results in decreased activity of GAPDH protein] more ... CTD PMID:11050244 more ... Ucp1 Rat glutathione multiple interactions EXP 6480464 Glutathione inhibits the reaction [alitretinoin results in increased expression of UCP1 mRNA] and Glutathione inhibits the reaction [rosiglitazone results in increased expression of UCP1 mRNA] CTD PMID:12414803 Ucp1 Rat harmine multiple interactions ISO Ucp1 (Mus musculus) 6480464 2-chloro-5-nitrobenzanilide inhibits the reaction [Harmine results in increased expression of UCP1 mRNA] more ... CTD PMID:27805061 Ucp1 Rat harmine increases expression ISO Ucp1 (Mus musculus) 6480464 Harmine results in increased expression of UCP1 mRNA and Harmine results in increased expression of UCP1 protein CTD PMID:27805061 Ucp1 Rat hexadecanoic acid increases expression EXP 6480464 Palmitic Acid results in increased expression of UCP1 mRNA CTD PMID:28027979 Ucp1 Rat Indeno[1,2,3-cd]pyrene decreases expression ISO Ucp1 (Mus musculus) 6480464 indeno(1 more ... CTD PMID:26377693 Ucp1 Rat indinavir decreases expression ISO Ucp1 (Mus musculus) 6480464 Indinavir results in decreased expression of UCP1 mRNA CTD PMID:17926646 Ucp1 Rat indometacin multiple interactions ISO Ucp1 (Mus musculus) 6480464 [BMP7 protein co-treated with INS1 protein co-treated with Triiodothyronine co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with Indomethacin co-treated with Nicotine] affects the expression of UCP1 mRNA and [BMP7 protein co-treated with INS1 protein co-treated with Triiodothyronine co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with Indomethacin co-treated with Nicotine] affects the expression of UCP1 protein CTD PMID:33091441 Ucp1 Rat Iopanoic acid decreases expression EXP 6480464 Iopanoic Acid results in decreased expression of UCP1 protein CTD PMID:11521740 Ucp1 Rat isoprenaline increases expression EXP 6480464 Isoproterenol results in increased expression of UCP1 protein CTD PMID:17250927 Ucp1 Rat kaempferol multiple interactions EXP 6480464 kaempferol inhibits the reaction [Dietary Fats results in decreased expression of UCP1 mRNA] CTD PMID:30372826 Ucp1 Rat Licarin A multiple interactions ISO Ucp1 (Mus musculus) 6480464 [licarin A affects the susceptibility to [INS protein co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone]] which results in increased expression of UCP1 mRNA more ... CTD PMID:29288687 Ucp1 Rat Liensinine increases expression ISO Ucp1 (Mus musculus) 6480464 liensinine results in increased expression of UCP1 protein CTD PMID:31323747 Ucp1 Rat LY294002 multiple interactions EXP 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [EGF protein results in decreased expression of UCP1 mRNA] more ... CTD PMID:11742803 Ucp1 Rat mangiferin multiple interactions ISO Ucp1 (Mus musculus) 6480464 [mangiferin co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS1 protein] results in increased expression of UCP1 protein CTD PMID:32417366 Ucp1 Rat mercury dichloride decreases expression EXP 6480464 Mercuric Chloride results in decreased expression of UCP1 mRNA CTD PMID:32599119 Ucp1 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of UCP1 mRNA and Methimazole results in decreased expression of UCP1 protein CTD PMID:11521740 and PMID:30047161 Ucp1 Rat methoprene increases expression ISO Ucp1 (Mus musculus) 6480464 Methoprene results in increased expression of UCP1 mRNA CTD PMID:10600643 Ucp1 Rat methotrexate increases expression ISO UCP1 (Homo sapiens) 6480464 Methotrexate results in increased expression of UCP1 mRNA CTD PMID:24449571 Ucp1 Rat methylmercury chloride increases expression ISO UCP1 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of UCP1 mRNA CTD PMID:28001369 Ucp1 Rat mono(2-ethylhexyl) phthalate increases expression ISO Ucp1 (Mus musculus) 6480464 mono-(2-ethylhexyl)phthalate results in increased expression of UCP1 mRNA CTD PMID:32522588 Ucp1 Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in increased methylation of UCP1 gene and [Pyridostigmine Bromide co-treated with DEET co-treated with Permethrin] results in increased expression of UCP1 mRNA CTD PMID:28659758 and PMID:33148267 Ucp1 Rat N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide multiple interactions EXP 6480464 N-(2-(4-bromocinnamylamino)ethyl)-5-isoquinolinesulfonamide inhibits the reaction [Bucladesine results in increased expression of UCP1 mRNA] CTD PMID:12414803 Ucp1 Rat N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide multiple interactions ISO Ucp1 (Mus musculus) 6480464 N-(2-(4-bromocinnamylamino)ethyl)-5-isoquinolinesulfonamide inhibits the reaction [[licarin A affects the susceptibility to [INS protein co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone]] which results in increased expression of UCP1 protein] CTD PMID:29288687 Ucp1 Rat nevirapine increases expression ISO UCP1 (Homo sapiens) 6480464 Nevirapine results in increased expression of UCP1 CTD PMID:16038477 Ucp1 Rat nickel sulfate multiple interactions ISO Ucp1 (Mus musculus) 6480464 [nickel sulfate co-treated with Particulate Matter] results in decreased expression of UCP1 mRNA and [nickel sulfate co-treated with Particulate Matter] results in decreased expression of UCP1 protein CTD PMID:23126276 Ucp1 Rat nicotine decreases expression EXP 6480464 Nicotine results in decreased expression of UCP1 mRNA and Nicotine results in decreased expression of UCP1 protein CTD PMID:33091441 Ucp1 Rat nicotine multiple interactions ISO Ucp1 (Mus musculus) 6480464 [BMP7 protein co-treated with INS1 protein co-treated with Triiodothyronine co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with Indomethacin co-treated with Nicotine] affects the expression of UCP1 mRNA and [BMP7 protein co-treated with INS1 protein co-treated with Triiodothyronine co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with Indomethacin co-treated with Nicotine] affects the expression of UCP1 protein CTD PMID:33091441 Ucp1 Rat nicotinic acid multiple interactions ISO Ucp1 (Mus musculus) 6480464 LEPR gene mutant form promotes the reaction [[Niacin binds to Chromium] which results in decreased expression of UCP1 mRNA] CTD PMID:16940432 Ucp1 Rat ochratoxin A decreases expression ISO UCP1 (Homo sapiens) 6480464 ochratoxin A metabolite results in decreased expression of UCP1 mRNA CTD PMID:24356939 Ucp1 Rat olanzapine multiple interactions EXP 6480464 [olanzapine co-treated with 1-(carboxymethylthio)tetradecane] results in decreased expression of UCP1 mRNA CTD PMID:23226405 Ucp1 Rat orlistat multiple interactions ISO UCP1 (Homo sapiens) 6480464 Orlistat inhibits the reaction [[Rosiglitazone co-treated with TF protein co-treated with INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Hydrocortisone co-treated with Triiodothyronine] results in increased expression of UCP1 mRNA] CTD PMID:33476690 Ucp1 Rat ozone decreases expression ISO Ucp1 (Mus musculus) 6480464 Ozone results in decreased expression of UCP1 mRNA CTD PMID:31626304 Ucp1 Rat ozone multiple interactions ISO Ucp1 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of UCP1 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of UCP1 mRNA CTD PMID:34911549 Ucp1 Rat ozone decreases expression EXP 6480464 Ozone results in decreased expression of UCP1 mRNA CTD PMID:23968387 Ucp1 Rat ozone multiple interactions EXP 6480464 [Ozone co-treated with Particulate Matter] results in decreased expression of UCP1 mRNA more ... CTD PMID:23968387 Ucp1 Rat paracetamol multiple interactions ISO Ucp1 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of UCP1 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of UCP1 mRNA] CTD PMID:17585979 Ucp1 Rat parathion increases methylation ISO UCP1 (Homo sapiens) 6480464 Parathion results in increased methylation of UCP1 promoter CTD PMID:22847954 Ucp1 Rat PD 0325901 multiple interactions ISO UCP1 (Homo sapiens) 6480464 mirdametinib inhibits the reaction [Protein Kinase Inhibitors inhibits the reaction [FASN protein results in increased expression of UCP1 protein]] CTD PMID:26670611 Ucp1 Rat perfluorooctane-1-sulfonic acid increases expression EXP 6480464 perfluorooctane sulfonic acid results in increased expression of UCP1 mRNA CTD PMID:21251948 Ucp1 Rat perfluorooctane-1-sulfonic acid affects response to substance ISO Ucp1 (Mus musculus) 6480464 UCP1 gene mutant form affects the susceptibility to perfluorooctane sulfonic acid CTD PMID:26001964 Ucp1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Ucp1 (Mus musculus) 6480464 perfluorooctane sulfonic acid results in increased expression of and results in increased activity of UCP1 protein CTD PMID:26001964 Ucp1 Rat perfluorooctanoic acid affects response to substance ISO Ucp1 (Mus musculus) 6480464 UCP1 gene mutant form affects the susceptibility to perfluorooctanoic acid CTD PMID:26001964 Ucp1 Rat perfluorooctanoic acid multiple interactions ISO Ucp1 (Mus musculus) 6480464 perfluorooctanoic acid results in increased expression of and results in increased activity of UCP1 protein CTD PMID:26001964 Ucp1 Rat permethrin multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in increased methylation of UCP1 gene and [Pyridostigmine Bromide co-treated with DEET co-treated with Permethrin] results in increased expression of UCP1 mRNA CTD PMID:28659758 and PMID:33148267 Ucp1 Rat pirinixic acid increases expression ISO Ucp1 (Mus musculus) 6480464 pirinixic acid results in increased expression of UCP1 mRNA CTD PMID:16306350 Ucp1 Rat pirinixic acid increases activity EXP 6480464 pirinixic acid results in increased activity of UCP1 promoter CTD PMID:10529360 Ucp1 Rat pirinixic acid multiple interactions EXP 6480464 pirinixic acid inhibits the reaction [rosiglitazone results in increased expression of UCP1 mRNA] CTD PMID:10529360 Ucp1 Rat pirinixic acid multiple interactions ISO UCP1 (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of UCP1 mRNA CTD PMID:19710929 Ucp1 Rat platycodin D increases expression ISO Ucp1 (Mus musculus) 6480464 platycodin D results in increased expression of UCP1 protein CTD PMID:30599906 Ucp1 Rat Prenalterol increases expression ISO Ucp1 (Mus musculus) 6480464 Prenalterol results in increased expression of UCP1 protein CTD PMID:10465291 Ucp1 Rat prostaglandin E2 multiple interactions EXP 6480464 UCP1 protein inhibits the reaction [Glucose results in increased chemical synthesis of Dinoprostone] CTD PMID:14514642 Ucp1 Rat protein kinase inhibitor multiple interactions ISO UCP1 (Homo sapiens) 6480464 mirdametinib inhibits the reaction [Protein Kinase Inhibitors inhibits the reaction [FASN protein results in increased expression of UCP1 protein]] more ... CTD PMID:26670611 Ucp1 Rat protein kinase inhibitor decreases expression ISO Ucp1 (Mus musculus) 6480464 Protein Kinase Inhibitors results in decreased expression of UCP1 mRNA CTD PMID:26670611 Ucp1 Rat Pyridostigmine bromide multiple interactions EXP 6480464 [Pyridostigmine Bromide co-treated with DEET co-treated with Permethrin] results in increased expression of UCP1 mRNA CTD PMID:28659758 Ucp1 Rat quercetin multiple interactions ISO Ucp1 (Mus musculus) 6480464 Quercetin inhibits the reaction [Dietary Fats results in decreased expression of UCP1 mRNA] CTD PMID:24465016 Ucp1 Rat quercetin multiple interactions EXP 6480464 Quercetin inhibits the reaction [Dietary Fats results in decreased expression of UCP1 mRNA] CTD PMID:30372826 Ucp1 Rat reactive oxygen species multiple interactions EXP 6480464 UCP1 protein inhibits the reaction [Glucose results in increased chemical synthesis of Reactive Oxygen Species] and UCP1 protein inhibits the reaction [TNF protein results in increased chemical synthesis of Reactive Oxygen Species] CTD PMID:14514642 and PMID:16644673 Ucp1 Rat resveratrol multiple interactions ISO Ucp1 (Mus musculus) 6480464 dorsomorphin inhibits the reaction [Resveratrol results in increased expression of UCP1 protein] more ... CTD PMID:19934007 and PMID:25761413 Ucp1 Rat resveratrol increases expression ISO Ucp1 (Mus musculus) 6480464 resveratrol results in increased expression of UCP1 mRNA and resveratrol results in increased expression of UCP1 protein CTD PMID:19934007 more ... Ucp1 Rat resveratrol increases expression EXP 6480464 resveratrol results in increased expression of UCP1 protein CTD PMID:23790948 Ucp1 Rat rosmarinic acid multiple interactions ISO UCP1 (Homo sapiens) 6480464 Rosmarinic Acid inhibits the reaction [[Rosiglitazone co-treated with TF protein co-treated with INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Hydrocortisone co-treated with Triiodothyronine] results in increased expression of UCP1 mRNA] CTD PMID:33476690 Ucp1 Rat ruxolitinib increases expression ISO UCP1 (Homo sapiens) 6480464 ruxolitinib results in increased expression of UCP1 mRNA CTD PMID:25487280 Ucp1 Rat selumetinib multiple interactions ISO Ucp1 (Mus musculus) 6480464 AZD 6244 inhibits the reaction [Harmine results in increased expression of UCP1 mRNA] CTD PMID:27805061 Ucp1 Rat sodium arsenite increases expression ISO UCP1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of UCP1 mRNA CTD PMID:38568856 Ucp1 Rat sodium arsenite increases expression ISO Ucp1 (Mus musculus) 6480464 sodium arsenite results in increased expression of UCP1 mRNA CTD PMID:37682722 Ucp1 Rat sodium arsenite multiple interactions ISO Ucp1 (Mus musculus) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of UCP1 mRNA CTD PMID:32045263 Ucp1 Rat stavudine decreases expression ISO Ucp1 (Mus musculus) 6480464 Stavudine results in decreased expression of UCP1 mRNA CTD PMID:17926646 Ucp1 Rat stavudine increases expression ISO UCP1 (Homo sapiens) 6480464 Stavudine results in increased expression of UCP1 CTD PMID:16038477 Ucp1 Rat superoxide multiple interactions EXP 6480464 UCP1 protein inhibits the reaction [[Glucose results in increased chemical synthesis of Superoxides] which results in decreased activity of GAPDH protein] CTD PMID:11050244 Ucp1 Rat T-2 toxin increases expression EXP 6480464 T-2 Toxin results in increased expression of UCP1 mRNA CTD PMID:29870751 Ucp1 Rat telmisartan multiple interactions ISO Ucp1 (Mus musculus) 6480464 PPARD promotes the reaction [telmisartan results in increased expression of UCP1 protein] CTD PMID:20176998 Ucp1 Rat telmisartan increases expression ISO Ucp1 (Mus musculus) 6480464 telmisartan results in increased expression of UCP1 protein CTD PMID:20176998 Ucp1 Rat terbufos increases methylation ISO UCP1 (Homo sapiens) 6480464 terbufos results in increased methylation of UCP1 promoter CTD PMID:22847954 Ucp1 Rat testosterone multiple interactions ISO Ucp1 (Mus musculus) 6480464 Testosterone inhibits the reaction [Testosterone deficiency results in decreased expression of UCP1 mRNA] CTD PMID:21045173 Ucp1 Rat testosterone decreases expression ISO Ucp1 (Mus musculus) 6480464 Testosterone deficiency results in decreased expression of UCP1 mRNA CTD PMID:21045173 Ucp1 Rat tetraphene multiple interactions ISO Ucp1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of UCP1 mRNA CTD PMID:27858113 Ucp1 Rat titanium dioxide increases expression ISO Ucp1 (Mus musculus) 6480464 titanium dioxide results in increased expression of UCP1 mRNA CTD PMID:23557971 Ucp1 Rat titanium dioxide decreases expression ISO Ucp1 (Mus musculus) 6480464 titanium dioxide results in decreased expression of UCP1 mRNA CTD PMID:35295148 Ucp1 Rat tofacitinib multiple interactions ISO UCP1 (Homo sapiens) 6480464 cyclopamine inhibits the reaction [tofacitinib results in increased expression of UCP1 mRNA] and tofacitinib inhibits the reaction [TNF protein results in decreased expression of UCP1 mRNA] CTD PMID:25487280 Ucp1 Rat tofacitinib increases expression ISO UCP1 (Homo sapiens) 6480464 tofacitinib results in increased expression of UCP1 mRNA and tofacitinib results in increased expression of UCP1 protein CTD PMID:25487280 Ucp1 Rat tributylstannane increases expression ISO Ucp1 (Mus musculus) 6480464 tributyltin results in increased expression of UCP1 mRNA CTD PMID:21683088 Ucp1 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of UCP1 mRNA CTD PMID:33387578 Ucp1 Rat trichostatin A increases expression ISO UCP1 (Homo sapiens) 6480464 trichostatin A results in increased expression of UCP1 mRNA CTD PMID:24935251 Ucp1 Rat triptonide increases expression ISO Ucp1 (Mus musculus) 6480464 triptonide results in increased expression of UCP1 mRNA CTD PMID:33045310 Ucp1 Rat valproic acid affects expression ISO UCP1 (Homo sapiens) 6480464 Valproic Acid affects the expression of UCP1 mRNA CTD PMID:25979313 Ucp1 Rat valproic acid multiple interactions ISO UCP1 (Homo sapiens) 6480464 CEBPA protein affects the reaction [Valproic Acid results in increased expression of UCP1 mRNA] CTD PMID:32623605 Ucp1 Rat valproic acid increases expression ISO UCP1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of UCP1 mRNA CTD PMID:24383497 more ... Ucp1 Rat vanadium atom multiple interactions EXP 6480464 Vanadium promotes the reaction [LEP protein results in increased expression of UCP1 protein] CTD PMID:16195403 Ucp1 Rat vanadium(0) multiple interactions EXP 6480464 Vanadium promotes the reaction [LEP protein results in increased expression of UCP1 protein] CTD PMID:16195403 Ucp1 Rat zidovudine increases expression ISO UCP1 (Homo sapiens) 6480464 Zidovudine results in increased expression of UCP1 mRNA CTD PMID:14518702 Ucp1 Rat zidovudine decreases expression ISO Ucp1 (Mus musculus) 6480464 Zidovudine results in decreased expression of UCP1 mRNA CTD PMID:17926646
Imported Annotations - KEGG (archival)
(+)-taxifolin (EXP) (R)-noradrenaline (EXP,ISO) (S)-naringenin (EXP) (S)-nicotine (EXP,ISO) 15-acetyldeoxynivalenol (ISO) 17beta-estradiol (ISO) 2,2',5,5'-tetrachlorobiphenyl (EXP) 2,4-dinitrophenol (ISO) 3,3',5-triiodo-L-thyronine (EXP,ISO) 3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 9-cis-retinoic acid (EXP,ISO) abacavir (ISO) albuterol (ISO) aldehydo-D-glucose (EXP,ISO) all-trans-retinoic acid (ISO) all-trans-retinol (EXP) Amibegron (EXP) amitrole (EXP) ammonium chloride (EXP) arotinoid acid (ISO) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) ATP (EXP,ISO) benzene (ISO) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) bucladesine (EXP) Butylbenzyl phthalate (ISO) cannabidiol (ISO) capsaicin (EXP) carbon nanotube (ISO) CGP 52608 (ISO) chlordecone (ISO) chromium atom (ISO) chrysene (ISO) CL316243 (EXP,ISO) clenbuterol (ISO) clofibrate (ISO) cobalt dichloride (ISO) colforsin daropate hydrochloride (ISO) cortisol (ISO) curcumin (ISO) Cyclopamine (ISO) cyclophosphamide (ISO) D-glucose (EXP,ISO) dehydroepiandrosterone (EXP) dexamethasone (ISO) diarsenic trioxide (ISO) dibutyl phthalate (ISO) diethyl phthalate (ISO) diisobutyl phthalate (ISO) diisononyl phthalate (ISO) dioxygen (ISO) divanadium pentaoxide (ISO) dorsomorphin (ISO) enniatin (ISO) ethylparaben (ISO) flavonoids (EXP) fonofos (ISO) fructose (EXP) Ganoderic acid A (ISO) Geniposide (ISO) glucose (EXP,ISO) glutathione (EXP) harmine (ISO) hexadecanoic acid (EXP) Indeno[1,2,3-cd]pyrene (ISO) indinavir (ISO) indometacin (ISO) Iopanoic acid (EXP) isoprenaline (EXP) kaempferol (EXP) Licarin A (ISO) Liensinine (ISO) LY294002 (EXP) mangiferin (ISO) mercury dichloride (EXP) methimazole (EXP) methoprene (ISO) methotrexate (ISO) methylmercury chloride (ISO) mono(2-ethylhexyl) phthalate (ISO) N,N-diethyl-m-toluamide (EXP) N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide (EXP,ISO) nevirapine (ISO) nickel sulfate (ISO) nicotine (EXP,ISO) nicotinic acid (ISO) ochratoxin A (ISO) olanzapine (EXP) orlistat (ISO) ozone (EXP,ISO) paracetamol (ISO) parathion (ISO) PD 0325901 (ISO) perfluorooctane-1-sulfonic acid (EXP,ISO) perfluorooctanoic acid (ISO) permethrin (EXP) pirinixic acid (EXP,ISO) platycodin D (ISO) Prenalterol (ISO) prostaglandin E2 (EXP) protein kinase inhibitor (ISO) Pyridostigmine bromide (EXP) quercetin (EXP,ISO) reactive oxygen species (EXP) resveratrol (EXP,ISO) rosmarinic acid (ISO) ruxolitinib (ISO) selumetinib (ISO) sodium arsenite (ISO) stavudine (ISO) superoxide (EXP) T-2 toxin (EXP) telmisartan (ISO) terbufos (ISO) testosterone (ISO) tetraphene (ISO) titanium dioxide (ISO) tofacitinib (ISO) tributylstannane (ISO) trichloroethene (EXP) trichostatin A (ISO) triptonide (ISO) valproic acid (ISO) vanadium atom (EXP) vanadium(0) (EXP) zidovudine (ISO)
Biological Process
adaptive thermogenesis (IBA,IEA,ISO,ISS) brown fat cell differentiation (IEA,ISO) cellular response to cold (IEA,ISO) cellular response to dehydroepiandrosterone (IEP) cellular response to fatty acid (IDA,IEA,ISO) cellular response to hormone stimulus (IEA,IEP,ISO) cellular response to reactive oxygen species (IEA,ISO,ISS) diet induced thermogenesis (IEA,ISO) generation of precursor metabolites and energy (TAS) mitochondrial transmembrane transport (IBA,IDA,IEA,ISO) mitochondrial transport (IDA) monoatomic ion transmembrane transport (IEA) monoatomic ion transport (IEA) positive regulation of cold-induced thermogenesis (IEA,ISO,ISS) positive regulation of metabolic process (TAS) proton transmembrane transport (IDA,IEA,IMP,ISO) regulation of reactive oxygen species biosynthetic process (IEA,ISO,NAS) regulation of transcription by RNA polymerase II (IEA,ISO) response to cold (IBA) response to nutrient levels (IEA,ISO,ISS) response to temperature stimulus (IEA,ISO,ISS) transmembrane transport (IEA)
1.
The gene for rat uncoupling protein: complete sequence, structure of primary transcript and evolutionary relationship between exons.
Bouillaud F, etal., Biochem Biophys Res Commun 1988 Dec 15;157(2):783-92.
2.
Complete cDNA-derived amino acid sequence of rat brown fat uncoupling protein.
Bouillaud F, etal., J Biol Chem 1986 Feb 5;261(4):1487-90.
3.
Central stimulatory effect of leptin on T3 production is mediated by brown adipose tissue type II deiodinase.
Cettour-Rose P, etal., Am J Physiol Endocrinol Metab 2002 Nov;283(5):E980-7.
4.
Additive effect of A-->G (-3826) variant of the uncoupling protein gene and the Trp64Arg mutation of the beta 3-adrenergic receptor gene on weight gain in morbid obesity.
Clement K, etal., Int J Obes Relat Metab Disord. 1996 Dec;20(12):1062-6.
5.
Cellular stress response, sirtuins and UCP proteins in Alzheimer disease: role of vitagenes.
Cornelius C, etal., Immun Ageing. 2013 Oct 17;10(1):41. doi: 10.1186/1742-4933-10-41.
6.
High level of uncoupling protein 1 expression in muscle of transgenic mice selectively affects muscles at rest and decreases their IIb fiber content.
Couplan E, etal., J Biol Chem 2002 Nov 8;277(45):43079-88.
7.
Fatty acids change the conformation of uncoupling protein 1 (UCP1).
Divakaruni AS, etal., J Biol Chem. 2012 Oct 26;287(44):36845-53. doi: 10.1074/jbc.M112.381780. Epub 2012 Sep 5.
8.
The role of UCP 1 in production of reactive oxygen species by mitochondria isolated from brown adipose tissue.
Dlaskova A, etal., Biochim Biophys Acta. 2010 Aug;1797(8):1470-6. doi: 10.1016/j.bbabio.2010.04.008. Epub 2010 Apr 21.
9.
Superoxide activates mitochondrial uncoupling proteins.
Echtay KS, etal., Nature 2002 Jan 3;415(6867):96-9.
10.
Synergy of fatty acid and reactive alkenal activation of proton conductance through uncoupling protein 1 in mitochondria.
Esteves TC, etal., Biochem J. 2006 May 1;395(3):619-28.
11.
Nutritional and hormonal regulation of uncoupling protein gene expression in rat adipocytes.
Fukuda H, etal., J Nutr Sci Vitaminol (Tokyo). 2007 Oct;53(5):426-31.
12.
Association of the -112A>C polymorphism of the uncoupling protein 1 gene with insulin resistance in Japanese individuals with type 2 diabetes.
Fukuyama K, etal., Biochem Biophys Res Commun. 2006 Jan 27;339(4):1212-6. Epub 2005 Dec 5.
13.
Growth factor regulation of uncoupling protein-1 mRNA expression in brown adipocytes.
Garcia B and Obregon MJ, Am J Physiol Cell Physiol 2002 Jan;282(1):C105-12.
14.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
15.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
16.
Energy metabolism and expression of uncoupling proteins 1, 2, and 3 after 21 days of recovery from intracerebroventricular mouse leptin in rats.
Gullicksen PS, etal., Physiol Behav 2002 Apr 1;75(4):473-82.
17.
Resveratrol protects against peripheral deficits in a mouse model of Huntington's disease.
Ho DJ, etal., Exp Neurol. 2010 Sep;225(1):74-84. doi: 10.1016/j.expneurol.2010.05.006. Epub 2010 Jun 1.
18.
Fatty acid activation of the uncoupling proteins requires the presence of the central matrix loop from UCP1.
Jimenez-Jimenez J, etal., Biochim Biophys Acta. 2006 Sep-Oct;1757(9-10):1292-6. Epub 2006 May 24.
19.
UCP1 deficiency causes brown fat respiratory chain depletion and sensitizes mitochondria to calcium overload-induced dysfunction.
Kazak L, etal., Proc Natl Acad Sci U S A. 2017 Jul 25;114(30):7981-7986. doi: 10.1073/pnas.1705406114. Epub 2017 Jun 19.
20.
The uncoupling protein-1 gene -3826A/G polymorphism and hypertension in Japanese subjects.
Kotani K, etal., Clin Chem Lab Med. 2007;45(9):1186-9.
21.
Putative role of polymorphisms in UCP1-3 genes for diabetic nephropathy.
Lindholm E, etal., J Diabetes Complications. 2004 Mar-Apr;18(2):103-7.
22.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
23.
A polymorphism in the 5' untranslated region and a Met229-->Leu variant in exon 5 of the human UCP1 gene are associated with susceptibility to type II diabetes mellitus.
Mori H, etal., Diabetologia. 2001 Mar;44(3):373-6.
24.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
25.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
26.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
27.
GOA pipeline
RGD automated data pipeline
28.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
29.
Complete nucleotide and derived amino acid sequence of cDNA encoding the mitochondrial uncoupling protein of rat brown adipose tissue: lack of a mitochondrial targeting presequence.
Ridley RG, etal., Nucleic Acids Res 1986 May 27;14(10):4025-35.
30.
DHEA administration increases brown fat uncoupling protein 1 levels in obese OLETF rats.
Ryu JW, etal., Biochem Biophys Res Commun. 2003 Apr 4;303(2):726-31.
31.
Gene-based anchoring of the rat genetic linkage and cytogenetic maps: new regional localizations, orientation of the linkage groups, and insights into mammalian chromosome evolution.
Szpirer C, etal., Mamm Genome 1998 Sep;9(9):721-34
32.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
33.
Rosiglitazone and retinoic acid induce uncoupling protein-1 (UCP-1) in a p38 mitogen-activated protein kinase-dependent manner in fetal primary brown adipocytes.
Teruel T, etal., J Biol Chem 2003 Jan 3;278(1):263-9.
34.
Substitutional mutations in the uncoupling protein-specific sequences of mitochondrial uncoupling protein UCP1 lead to the reduction of fatty acid-induced H+ uniport.
Urbankova E, etal., Int J Biochem Cell Biol. 2003 Feb;35(2):212-20.
35.
Thermoregulatory and metabolic defects in Huntington's disease transgenic mice implicate PGC-1alpha in Huntington's disease neurodegeneration.
Weydt P, etal., Cell Metab. 2006 Nov;4(5):349-62. Epub 2006 Oct 19.
Ucp1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 19 41,713,350 - 41,721,421 (-) NCBI GRCr8 mRatBN7.2 19 24,808,782 - 24,816,853 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 19 24,808,783 - 24,816,852 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 19 31,627,843 - 31,635,958 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 19 32,282,249 - 32,290,366 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 19 34,500,303 - 34,508,418 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 19 24,456,976 - 24,464,808 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 19 24,456,976 - 24,464,807 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 19 35,434,980 - 35,442,812 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 19 26,527,548 - 26,535,621 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 19 26,532,373 - 26,540,447 (-) NCBI Celera 19 24,348,444 - 24,356,517 (-) NCBI Celera Cytogenetic Map 19 q11 NCBI
UCP1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 4 140,559,431 - 140,568,961 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 4 140,559,431 - 140,568,961 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 4 141,480,585 - 141,490,115 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 4 141,700,500 - 141,709,457 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 4 141,838,654 - 141,847,612 NCBI Celera 4 138,811,044 - 138,819,947 (-) NCBI Celera Cytogenetic Map 4 q31.1 NCBI HuRef 4 137,211,503 - 137,220,406 (-) NCBI HuRef CHM1_1 4 141,458,398 - 141,467,306 (-) NCBI CHM1_1 T2T-CHM13v2.0 4 143,879,138 - 143,888,662 (-) NCBI T2T-CHM13v2.0
Ucp1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 84,016,977 - 84,025,085 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 84,016,981 - 84,025,081 (+) Ensembl GRCm39 Ensembl GRCm38 8 83,290,348 - 83,298,456 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 83,290,352 - 83,298,452 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 85,814,247 - 85,822,355 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 86,180,467 - 86,188,157 (+) NCBI MGSCv36 mm8 Celera 8 87,564,747 - 87,572,801 (+) NCBI Celera Cytogenetic Map 8 C2 NCBI cM Map 8 39.65 NCBI
Ucp1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955428 3,274,810 - 3,283,237 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955428 3,253,363 - 3,282,518 (+) NCBI ChiLan1.0 ChiLan1.0
UCP1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 3 138,435,652 - 138,445,332 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 4 138,823,275 - 138,832,954 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 4 132,921,033 - 132,930,714 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 4 144,230,858 - 144,239,803 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 4 144,230,858 - 144,240,178 (-) Ensembl panpan1.1 panPan2
UCP1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 19 2,254,881 - 2,289,902 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 19 2,528,227 - 2,536,537 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 19 2,346,071 - 2,354,913 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 19 2,344,973 - 2,354,916 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 19 2,283,269 - 2,291,546 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 19 2,644,470 - 2,652,732 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 19 3,000,436 - 3,008,747 (+) NCBI UU_Cfam_GSD_1.0
Ucp1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405301 49,820,808 - 49,828,140 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936535 7,258,343 - 7,265,398 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936535 7,258,146 - 7,265,475 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
UCP1
UCP1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 7 87,492,444 - 87,502,894 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 7 87,492,195 - 87,502,665 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 67,019,274 - 67,029,935 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ucp1
.
Predicted Target Of
Count of predictions: 66 Count of miRNA genes: 51 Interacting mature miRNAs: 53 Transcripts: ENSRNOT00000004900 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1549847 Bss8 Bone structure and strength QTL 8 4 lumbar vertebra strength trait (VT:0010574) vertebra ultimate force (CMO:0001678) 19 1 31963836 Rat 61447 Tcas1 Tongue tumor susceptibility QTL 1 6.08 tongue integrity trait (VT:0010553) squamous cell carcinoma of the tongue maximum tumor diameter (CMO:0001875) 19 2316121 47316121 Rat 631681 Cm12 Cardiac mass QTL 12 3.33 0.00053 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 19 1 28982497 Rat 9590298 Uminl5 Urine mineral level QTL 5 3.59 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 19 1 36824771 Rat 1331737 Uae29 Urinary albumin excretion QTL 29 5.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 19 4096155 55283277 Rat 2298478 Eau8 Experimental allergic uveoretinitis QTL 8 0.0163 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 19 17154433 57337602 Rat 61328 Eae8 Experimental allergic encephalomyelitis QTL 8 4 nervous system integrity trait (VT:0010566) percentage of study population developing experimental autoimmune encephalomyelitis during a period of time (CMO:0001047) 19 24816041 33061905 Rat 1578764 Stresp19 Stress response QTL 19 3.6 0.001 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 19 15630201 57337602 Rat 1558656 Prcs1 Prostate cancer susceptibility QTL 1 5 prostate integrity trait (VT:0010571) percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943) 19 15114598 34521833 Rat 9590090 Insglur8 Insulin/glucose ratio QTL 8 10.81 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 19 1 36824771 Rat 1331788 Rf45 Renal function QTL 45 2.818 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 19 15605023 46559041 Rat 724566 Uae12 Urinary albumin excretion QTL 12 5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 19 2187927 56457239 Rat 724565 Tcas5 Tongue tumor susceptibility QTL 5 10.04 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 19 9977753 39654489 Rat 61407 Scl12 Serum cholesterol level QTL 12 0.001 blood HDL cholesterol amount (VT:0000184) serum high density lipoprotein cholesterol level (CMO:0000361) 19 13926401 30303727 Rat 8552935 Pigfal10 Plasma insulin-like growth factor 1 level QTL 10 5.7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 19 1 36824771 Rat 61350 Bp32 Blood pressure QTL 32 0.012 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 19 20483575 57337602 Rat 7411549 Bw130 Body weight QTL 130 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 19 15455860 57337602 Rat 10054132 Srcrt9 Stress Responsive Cort QTL 9 2.87 0.0017 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 19 1 27355345 Rat 724518 Uae19 Urinary albumin excretion QTL 19 5.5 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 19 7457249 42983518 Rat 8694186 Bw152 Body weight QTL 152 3.34 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 19 569374 45569374 Rat 61423 Cia14 Collagen induced arthritis QTL 14 3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 19 10827970 43544039 Rat 631678 Cm9 Cardiac mass QTL 9 4.27 0.0001 aorta mass (VT:0002845) aorta weight (CMO:0000076) 19 1 28982497 Rat 9590250 Scort11 Serum corticosterone level QTL 11 23.45 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 19 1 36824771 Rat 2317848 Alcrsp21 Alcohol response QTL 21 1.899999976158142 0.05 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 19 3204777 48204777 Rat 9589102 Slep13 Serum leptin concentration QTL 13 4.63 0.001 blood leptin amount (VT:0005667) plasma leptin level (CMO:0000781) 19 569374 45569374 Rat 7247442 Uae39 Urinary albumin excretion QTL 39 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 19 2187927 46708701 Rat
D19Mit9
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 19 41,720,609 - 41,720,770 (+) Marker Load Pipeline mRatBN7.2 19 24,816,041 - 24,816,202 (-) MAPPER mRatBN7.2 Rnor_6.0 19 24,457,627 - 24,457,787 NCBI Rnor6.0 Rnor_5.0 19 35,435,631 - 35,435,791 UniSTS Rnor5.0 RGSC_v3.4 19 26,534,809 - 26,534,971 UniSTS RGSC3.4 RGSC_v3.4 19 26,534,810 - 26,534,971 RGD RGSC3.4 RGSC_v3.1 19 26,539,634 - 26,539,797 RGD Celera 19 24,355,706 - 24,355,866 UniSTS Cytogenetic Map 19 p11-q11 UniSTS
D19Wox8
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 19 41,722,546 - 41,722,671 (+) Marker Load Pipeline mRatBN7.2 19 24,817,978 - 24,818,103 (-) MAPPER mRatBN7.2 Rnor_6.0 19 24,455,726 - 24,455,850 NCBI Rnor6.0 Rnor_5.0 19 35,433,730 - 35,433,854 UniSTS Rnor5.0 RGSC_v3.4 19 26,536,747 - 26,536,872 RGD RGSC3.4 RGSC_v3.4 19 26,536,748 - 26,536,872 UniSTS RGSC3.4 RGSC_v3.1 19 26,541,573 - 26,541,698 RGD Celera 19 24,357,643 - 24,357,761 UniSTS Cytogenetic Map 19 p11-q11 UniSTS
D19Arb8
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 19 24,813,116 - 24,813,393 (-) MAPPER mRatBN7.2 mRatBN7.2 19 24,813,116 - 24,813,393 (+) MAPPER mRatBN7.2 Rnor_6.0 19 29,400,398 - 29,400,674 NCBI Rnor6.0 Rnor_6.0 19 24,460,436 - 24,460,712 NCBI Rnor6.0 Rnor_5.0 19 35,438,440 - 35,438,716 UniSTS Rnor5.0 Rnor_5.0 19 40,308,557 - 40,308,833 UniSTS Rnor5.0 RGSC_v3.4 19 26,531,884 - 26,532,160 UniSTS RGSC3.4 RGSC_v3.4 19 26,531,883 - 26,532,160 RGD RGSC3.4 RGSC_v3.1 19 26,536,709 - 26,536,986 RGD Celera 19 24,352,781 - 24,353,057 UniSTS SHRSP x BN Map 19 18.5999 RGD SHRSP x BN Map 19 18.5999 UniSTS FHH x ACI Map 19 21.16 RGD Cytogenetic Map 19 p11-q11 UniSTS
AI385626
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 19 24,816,612 - 24,816,715 (-) MAPPER mRatBN7.2 Rnor_6.0 19 24,457,114 - 24,457,216 NCBI Rnor6.0 Rnor_5.0 19 35,435,118 - 35,435,220 UniSTS Rnor5.0 RGSC_v3.4 19 26,535,382 - 26,535,484 UniSTS RGSC3.4 Celera 19 24,356,277 - 24,356,379 UniSTS Cytogenetic Map 19 p11-q11 UniSTS
RH94828
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 19 24,815,082 - 24,815,182 (-) MAPPER mRatBN7.2 Rnor_6.0 19 24,458,647 - 24,458,746 NCBI Rnor6.0 Rnor_5.0 19 35,436,651 - 35,436,750 UniSTS Rnor5.0 RGSC_v3.4 19 26,533,850 - 26,533,949 UniSTS RGSC3.4 Celera 19 24,354,747 - 24,354,846 UniSTS Cytogenetic Map 19 p11-q11 UniSTS
RH94640
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 19 41,720,092 - 41,720,258 (+) Marker Load Pipeline mRatBN7.2 19 24,815,524 - 24,815,690 (-) MAPPER mRatBN7.2 Rnor_6.0 19 24,458,139 - 24,458,304 NCBI Rnor6.0 Rnor_5.0 19 35,436,143 - 35,436,308 UniSTS Rnor5.0 RGSC_v3.4 19 26,534,292 - 26,534,457 UniSTS RGSC3.4 Celera 19 24,355,189 - 24,355,354 UniSTS Cytogenetic Map 19 p11-q11 UniSTS
RH94528
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 19 24,808,802 - 24,808,876 (-) MAPPER mRatBN7.2 mRatBN7.2 19 24,808,802 - 24,808,876 (+) MAPPER mRatBN7.2 Rnor_6.0 19 24,464,714 - 24,464,787 NCBI Rnor6.0 Rnor_6.0 19 29,396,084 - 29,396,157 NCBI Rnor6.0 Rnor_5.0 19 40,304,243 - 40,304,316 UniSTS Rnor5.0 Rnor_5.0 19 35,442,718 - 35,442,791 UniSTS Rnor5.0 RGSC_v3.4 19 26,527,568 - 26,527,641 UniSTS RGSC3.4 Celera 19 24,348,465 - 24,348,538 UniSTS Cytogenetic Map 19 p11-q11 UniSTS
Ucp1
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 19 41,720,342 - 41,721,199 (+) Marker Load Pipeline mRatBN7.2 19 24,815,774 - 24,816,631 (-) MAPPER mRatBN7.2 Rnor_6.0 19 24,457,198 - 24,458,054 NCBI Rnor6.0 Rnor_5.0 19 35,435,202 - 35,436,058 UniSTS Rnor5.0 RGSC_v3.4 19 26,534,542 - 26,535,400 UniSTS RGSC3.4 Celera 19 24,355,439 - 24,356,295 UniSTS Cytogenetic Map 19 p11-q11 UniSTS
D19Mit9
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 19 24,816,042 - 24,816,202 (-) MAPPER mRatBN7.2 Rnor_6.0 19 24,457,627 - 24,457,786 NCBI Rnor6.0 Rnor_5.0 19 35,435,631 - 35,435,790 UniSTS Rnor5.0 RGSC_v3.4 19 26,534,810 - 26,534,971 UniSTS RGSC3.4 Celera 19 24,355,707 - 24,355,866 UniSTS Cytogenetic Map 15 p11 UniSTS Cytogenetic Map 19 p11-q11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
5
8
20
34
44
41
12
22
12
4
114
59
16
30
37
29
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000004900 ⟹ ENSRNOP00000004900
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 24,808,783 - 24,816,852 (-) Ensembl Rnor_6.0 Ensembl 19 24,456,976 - 24,464,807 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000072100 ⟹ ENSRNOP00000065918
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 19 29,396,157 - 29,400,355 (-) Ensembl
RefSeq Acc Id:
NM_012682 ⟹ NP_036814
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 41,713,350 - 41,721,421 (-) NCBI mRatBN7.2 19 24,808,782 - 24,816,853 (-) NCBI Rnor_6.0 19 24,456,976 - 24,464,808 (+) NCBI Rnor_5.0 19 35,434,980 - 35,442,812 (+) NCBI RGSC_v3.4 19 26,527,548 - 26,535,621 (-) RGD Celera 19 24,348,444 - 24,356,517 (-) NCBI
Sequence:
GTGCCGGGCGATCCGGGCTTAAAGAGCGAGAGGAAGGGACGCTCACCTTTGAGCTCCTCCACAAATAGCCCTGGTGGCTGCCACAGAAGTTCGAAGTTGAGAGTTCGGTACCCACATCAGGCAACAGT
hide sequence
RefSeq Acc Id:
NP_036814 ⟸ NM_012682
- UniProtKB:
P04633 (UniProtKB/Swiss-Prot), A6IYF5 (UniProtKB/TrEMBL)
- Sequence:
MVSSTTSEVQPTMGVKIFSAGVSACLADIITFPLDTAKVRLQIQGEGQASSTIRYKGVLGTITTLAKTEGLPKLYSGLPAGIQRQISFASLRIGLYDTVQEYFSSGRETPASLGSKISAGLMTGGVAV
hide sequence
Ensembl Acc Id:
ENSRNOP00000004900 ⟸ ENSRNOT00000004900
Ensembl Acc Id:
ENSRNOP00000065918 ⟸ ENSRNOT00000072100
RGD ID: 13700995 Promoter ID: EPDNEW_R11518 Type: single initiation site Name: Ucp1_1 Description: uncoupling protein 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 19 24,456,978 - 24,457,038 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2021-03-09
Ucp1
uncoupling protein 1
LOC100909612
mitochondrial brown fat uncoupling protein 1-like
Data merged from RGD:6502621
737654 PROVISIONAL
2016-05-05
Ucp1
uncoupling protein 1
Ucp1
uncoupling protein 1 (mitochondrial, proton carrier)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2012-07-05
LOC100909612
mitochondrial brown fat uncoupling protein 1-like
Symbol and Name status set to provisional
70820 PROVISIONAL
2006-03-30
Ucp1
uncoupling protein 1 (mitochondrial, proton carrier)
uncoupling protein 1
Name updated
1299863 APPROVED
2004-12-14
Ucp1
uncoupling protein 1
Symbol and Name status set to approved
1299863 APPROVED
2002-06-10
Ucp1
uncoupling protein 1
Name updated
70585 PROVISIONAL
Note Type
Note
Reference
gene_expression
expressed only in the inner mitochondrial membrane of brown adipocytes
70670
gene_function
inner mitochondrial membrane transporter
70670
gene_pathway
increased mRNA expression is induced by activation of the retinoic acid and retinoid X receptors and occurs via activation of a MAP kinase signaling pathway
730207
gene_process
T3 by itself induces the transcription of Ucp1
70670
gene_process
uncouples electron transport from oxidative phosphorylation
70670
gene_regulation
aFGF and bFGF increase the expression, EGF and vasopressin decrease the expression
70670
gene_regulation
triiodothyronine (T3) inhibits the mitogenic activity of aFGF and bFGF
70670
gene_regulation
mRNA expression is upregulated by leptin
631305
