Tnfrsf4 (TNF receptor superfamily member 4)

Advanced Search (OLGA)

Gene: Tnfrsf4 (TNF receptor superfamily member 4) Rattus norvegicus

Analyze

Symbol:

Tnfrsf4

Name:

TNF receptor superfamily member 4

RGD ID:

3920

Description:

Predicted to enable tumor necrosis factor receptor activity. Involved in T cell proliferation. Located in cell surface. Human ortholog(s) of this gene implicated in immunodeficiency 16. Orthologous to human TNFRSF4 (TNF receptor superfamily member 4); PARTICIPATES IN cytokine mediated signaling pathway; INTERACTS WITH alpha-Zearalanol; ammonium chloride; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

MRC OX40; Ox40; OX40 antigen; OX40L receptor; Tax-transcriptionally activated glycoprotein 1; tumor necrosis factor (ligand) superfamily member 4; tumor necrosis factor (ligand) superfamily, member 4; tumor necrosis factor receptor superfamily member 4; tumor necrosis factor receptor superfamily, member 4; tumor necrosis factor superfamily member 4; tumor necrosis factor superfamily, member 4; Txgp1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	171,889,134 - 171,891,824 (+)	NCBI		GRCr8
mRatBN7.2	5	166,606,909 - 166,609,599 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	166,606,909 - 166,609,599 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	169,310,441 - 169,313,132 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	171,131,863 - 171,134,554 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	171,094,395 - 171,097,086 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	173,447,784 - 173,450,474 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	173,447,784 - 173,450,474 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	176,921,804 - 176,924,494 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	172,856,351 - 172,859,041 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	172,866,845 - 172,869,536 (+)	NCBI
Celera	5	164,807,766 - 164,810,456 (+)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autoimmune disease (ISO)

cervical squamous cell carcinoma (ISO)

chromosome 1p36 deletion syndrome (ISO)

congenital myasthenic syndrome 8 (ISO)

dilated cardiomyopathy (ISO)

dilated cardiomyopathy 1LL (ISO)

Ehlers-Danlos syndrome spondylodysplastic type 2 (ISO)

Goldberg-Shprintzen syndrome (ISO)

immunodeficiency 16 (ISO)

immunodeficiency 38 (ISO)

Joubert syndrome 25 (ISO)

myocarditis (ISO)

Neurodevelopmental Disorders (ISO)

Peroxisome Biogenesis Disorder, Complementation Group 7 (ISO)

Shprintzen-Goldberg Craniosynostosis (ISO)

spondyloepimetaphyseal dysplasia with joint laxity type 1 (ISO)

viral infectious disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

1-chloro-2,4-dinitrobenzene (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

4,4'-sulfonyldiphenol (ISO)

4-(ethoxymethylene)-2-phenyloxazol-5-one (ISO)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

aluminium hydroxide (ISO)

ammonium chloride (EXP)

aristolochic acid A (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

bromobenzene (EXP)

carbon nanotube (ISO)

cyclosporin A (EXP)

diarsenic trioxide (ISO)

dioxygen (ISO)

disodium selenite (ISO)

epoxiconazole (ISO)

fragrance (ISO)

fulvestrant (ISO)

furan (EXP)

ionomycin (EXP)

isoflurane (EXP)

mercury dichloride (EXP)

mevalonic acid (ISO)

monosodium L-glutamate (ISO)

nickel atom (ISO)

Nonylphenol (ISO)

ozone (ISO)

p-menthan-3-ol (ISO)

paracetamol (EXP,ISO)

phorbol 13-acetate 12-myristate (EXP)

pimecrolimus (ISO)

progesterone (ISO)

silicon dioxide (ISO)

simvastatin (ISO)

sodium arsenite (ISO)

staurosporine (EXP)

tetraphene (ISO)

titanium dioxide (ISO)

toluene 2,4-diisocyanate (ISO)

trimellitic anhydride (ISO)

triphenyl phosphate (ISO)

triptonide (ISO)

trovafloxacin (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular defense response (ISO,TAS)

inflammatory response (IBA,ISO)

negative regulation of activation-induced cell death of T cells (ISO)

negative regulation of cytokine production (ISO)

negative regulation of DNA-binding transcription factor activity (ISO)

negative regulation of DNA-templated transcription (ISO)

negative regulation of extrinsic apoptotic signaling pathway (ISO)

positive regulation of B cell proliferation (ISO)

positive regulation of immunoglobulin production (ISO)

programmed cell death (ISO)

regulation of apoptotic process (ISO)

regulation of protein kinase activity (ISO)

T cell proliferation (IMP)

tumor necrosis factor-mediated signaling pathway (ISO)

Cellular Component

cell surface (IMP)

external side of plasma membrane (IBA,ISO)

plasma membrane (ISO)

Molecular Function

protein binding (ISO)

tumor necrosis factor receptor activity (IBA,ISO,TAS)

Molecular Pathway Annotations Click to see Annotation Detail View

cytokine mediated signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Characterization of the MRC OX40 antigen of activated CD4 positive T lymphocytes--a molecule related to nerve growth factor receptor.	Mallett S, etal., EMBO J 1990 Apr;9(4):1063-8.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
7.	Antigens of activated rat T lymphocytes including a molecule of 50,000 Mr detected only on CD4 positive T blasts.	Paterson DJ, etal., Mol Immunol 1987 Dec;24(12):1281-90.
8.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
9.	GOA pipeline	RGD automated data pipeline
10.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
12.	Negative immune factors might predominate local tumor immune status and promote carcinogenesis in cervical carcinoma.	Zhao M, etal., Virol J. 2017 Jan 13;14(1):5. doi: 10.1186/s12985-016-0670-8.

Additional References at PubMed

PMID:7749983	PMID:8765008	PMID:10586044	PMID:11567634	PMID:12626546	PMID:14635034	PMID:14730361	PMID:16301745	PMID:19008373	PMID:20871162

Genomics

Comparative Map Data

Tnfrsf4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	171,889,134 - 171,891,824 (+)	NCBI		GRCr8
mRatBN7.2	5	166,606,909 - 166,609,599 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	166,606,909 - 166,609,599 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	169,310,441 - 169,313,132 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	171,131,863 - 171,134,554 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	171,094,395 - 171,097,086 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	173,447,784 - 173,450,474 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	173,447,784 - 173,450,474 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	176,921,804 - 176,924,494 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	172,856,351 - 172,859,041 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	172,866,845 - 172,869,536 (+)	NCBI
Celera	5	164,807,766 - 164,810,456 (+)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

TNFRSF4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	1,211,340 - 1,214,153 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	1,211,326 - 1,214,153 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	1,146,720 - 1,149,533 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	1,136,569 - 1,139,375 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	1,186,629 - 1,189,435	NCBI
Celera	1	1,434,142 - 1,436,950 (+)	NCBI		Celera
Cytogenetic Map	1	p36.33	NCBI
HuRef	1	418,421 - 421,246 (-)	NCBI		HuRef
CHM1_1	1	1,133,180 - 1,136,022 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	639,783 - 642,610 (-)	NCBI		T2T-CHM13v2.0

Tnfrsf4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	156,098,049 - 156,101,070 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	156,098,300 - 156,101,069 (+)	Ensembl		GRCm39 Ensembl
GRCm38	4	156,013,595 - 156,016,613 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	156,013,843 - 156,016,612 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	155,387,804 - 155,390,698 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	154,857,495 - 154,860,389 (+)	NCBI		MGSCv36	mm8
Celera	4	158,276,449 - 158,279,355 (+)	NCBI		Celera
Cytogenetic Map	4	E2	NCBI
cM Map	4	87.68	NCBI

Tnfrsf4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955486	9,567,220 - 9,569,676 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955486	9,565,424 - 9,569,836 (+)	NCBI	ChiLan1.0	ChiLan1.0

TNFRSF4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	227,011,897 - 227,014,893 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	225,707,527 - 225,711,573 (+)	NCBI		NHGRI_mPanPan1
PanPan1.1	1	1,168,706 - 1,171,341 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	1,168,935 - 1,171,337 (-)	Ensembl	panpan1.1		panPan2

TNFRSF4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	56,401,410 - 56,404,410 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	56,401,384 - 56,404,761 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	56,478,386 - 56,481,328 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	56,604,302 - 56,607,244 (-)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	5	56,595,039 - 56,597,980 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	56,487,321 - 56,490,255 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	56,877,316 - 56,880,258 (-)	NCBI		UU_Cfam_GSD_1.0

Tnfrsf4
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	27,561,562 - 27,567,137 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936737	1,901,749 - 1,904,382 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TNFRSF4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	63,523,804 - 63,526,666 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	63,523,850 - 63,526,672 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	58,011,607 - 58,014,420 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TNFRSF4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	130,231,064 - 130,234,525 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	130,231,584 - 130,234,313 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666054	34,799,764 - 34,803,311 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tnfrsf4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624818	8,373,810 - 8,376,204 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624818	8,372,092 - 8,376,108 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Tnfrsf4
1 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	58
Count of miRNA genes:	50
Interacting mature miRNAs:	56
Transcripts:	ENSRNOT00000027251
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
10053720	Scort26	Serum corticosterone level QTL 26	2.06	0.0147	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	124965598	166875058	Rat
631272	Lanf1	Left ventricular atrial natriuretic factor QTL 1	12		heart left ventricle natriuretic peptide A amount (VT:0010596)	heart left ventricle natriuretic peptide A level (CMO:0002165)	5	151113452	166875058	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
631562	Apr2	Acute phase response QTL 2	3.7		blood murinoglobulin 1 amount (VT:0010597)	plasma murinoglobulin 1 level (CMO:0001931)	5	135927956	166875058	Rat
634349	Bp139	Blood pressure QTL 139		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	128924607	166875058	Rat
61444	Strs2	Sensitivity to stroke QTL 2	4.7		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	5	135929696	166875058	Rat
724525	Bp147	Blood pressure QTL 147	4.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	126424772	166875058	Rat
1549904	Neuinf1	Neuroinflammation QTL 1	3	0	nervous system integrity trait (VT:0010566)	blood T lymphocyte count (CMO:0000110)	5	154828214	166875058	Rat
738018	Anxrr4	Anxiety related response QTL 4	5.1		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	5	130130159	166875058	Rat
8552908	Pigfal4	Plasma insulin-like growth factor 1 level QTL 4	6.6		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	128506074	166875058	Rat
7794791	Mcs33	Mammary carcinoma susceptibility QTL 33	1.93		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	5	131345754	166875058	Rat
1302790	Scl20	Serum cholesterol level QTL 20	6.4	0.0001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	82394392	166664054	Rat
1598861	Cm64	Cardiac mass QTL 64	2.9		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	127798274	166875058	Rat
1641920	Colcs1	Colorectal carcinoma susceptibility QTL 1	2.99	0.0055	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	5	121846814	166846814	Rat
1598819	Bp292	Blood pressure QTL 292	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	127798274	166875058	Rat
8694169	Bw148	Body weight QTL 148	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	128506074	166875058	Rat
1331721	Bp210	Blood pressure QTL 210	3.413		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	5	143069996	166846814	Rat

Markers in Region

RH136773

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	166,606,111 - 166,606,287 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	173,446,987 - 173,447,162	NCBI	Rnor6.0
Rnor_5.0	5	176,921,007 - 176,921,182	UniSTS	Rnor5.0
RGSC_v3.4	5	172,855,554 - 172,855,729	UniSTS	RGSC3.4
Celera	5	164,806,969 - 164,807,144	UniSTS
RH 3.4 Map	5	1174.5	UniSTS
Cytogenetic Map	5	q36	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_013049	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC126156	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473968	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X17037	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000027251 ⟹ ENSRNOP00000027251

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	166,606,909 - 166,609,599 (+)	Ensembl
Rnor_6.0 Ensembl	5	173,447,784 - 173,450,474 (+)	Ensembl

RefSeq Acc Id:

NM_013049 ⟹ NP_037181

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	171,889,134 - 171,891,824 (+)	NCBI
mRatBN7.2	5	166,606,909 - 166,609,599 (+)	NCBI
Rnor_6.0	5	173,447,784 - 173,450,474 (+)	NCBI
Rnor_5.0	5	176,921,804 - 176,924,494 (+)	NCBI
RGSC_v3.4	5	172,856,351 - 172,859,041 (+)	RGD
Celera	5	164,807,766 - 164,810,456 (+)	RGD

Sequence:

show sequence

GAACACAGACAAGGATGTATGTGTGGGTTCAGCAGCCCACAGCATTTCTGCTCCTGGGACTCTC
ACTTGGAGTTACAGTGAAGCTCAACTGTGTTAAAGATACCTACCCCAGTGGTCACAAGTGCTGT
CGTGAGTGCCAGCCAGGCCATGGTATGGTGAGCCGCTGTGATCACACCAGGGACACTGTATGTC
ATCCATGTGAGCCTGGCTTCTACAATGAGGCTGTCAATTACGACACCTGCAAGCAGTGTACACA
GTGCAACCACCGAAGTGGAAGTGAACTCAAGCAGAACTGCACACCTACTGAGGATACTGTCTGC
CAGTGTAGACCAGGCACCCAACCCCGGCAAGACAGCAGCCACAAGCTTGGAGTTGACTGTGTTC
CCTGCCCCCCTGGCCACTTTTCTCCAGGCAGCAACCAAGCCTGCAAGCCCTGGACCAATTGTAC
CTTATCTGGAAAGCAGATCCGCCACCCAGCCAGTAACAGCTTGGACACAGTCTGTGAAGACAGA
AGCCTCCTGGCCACACTGCTCTGGGAGACCCAGCGCACTACATTCAGGCCAACCACTGTCCCGT
CCACCACAGTCTGGCCCAGGACTTCTCAGTTGCCCTCTACACCCACCTTGGTGGCTCCTGAGGG
CCCTGCATTTGCTGTTATCCTAGGCCTAGGCCTGGGCTTGCTGGCTCCCTTGACTGTCCTGCTA
GCCTTGTACCTGCTCCGAAAGGCTTGGAGATCGCCCAACACTCCCAAACCTTGTTGGGGAAACA
GCTTCAGGACCCCTATCCAGGAGGAGCAGACCGACACACACTTTACTCTAGCCAAGATCTGAGC
AATACCACAGGAGTGGATTTTATGGGGCACAGACAGCCCATATCCTGATGCCTGCCTGCCAGGG
CCCTCCACACCGTTCTAGGCGCTGGGCTGGCTGTGCACTCTCCCATGTATGCTGTGCATACTAC
CTGCCTGGTGGCACTCCTAATAAACATGCTCGCAGCTGTGAGTCTGTCACTGGCCCT

hide sequence

Protein Sequences


Protein RefSeqs	NP_037181	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	CAA34897	(Get FASTA)	NCBI Sequence Viewer
	EDL81353	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000027251.3
	ENSRNOP00055020004
	ENSRNOP00060005958
	ENSRNOP00065012767
GenBank Protein	P15725	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_037181 ⟸ NM_013049
- Peptide Label:	precursor
- UniProtKB:	P15725 (UniProtKB/Swiss-Prot), A6IUV2 (UniProtKB/TrEMBL)
- Sequence:	show sequence MYVWVQQPTAFLLLGLSLGVTVKLNCVKDTYPSGHKCCRECQPGHGMVSRCDHTRDTVCHPCEP GFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTEDTVCQCRPGTQPRQDSSHKLGVDCVPCPPG HFSPGSNQACKPWTNCTLSGKQIRHPASNSLDTVCEDRSLLATLLWETQRTTFRPTTVPSTTVW PRTSQLPSTPTLVAPEGPAFAVILGLGLGLLAPLTVLLALYLLRKAWRSPNTPKPCWGNSFRTP IQEEQTDTHFTLAKI hide sequence

Ensembl Acc Id:

ENSRNOP00000027251 ⟸ ENSRNOT00000027251

Protein Domains

TNFR-Cys

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P15725-F1-model_v2	AlphaFold	P15725	1-271	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13694342

Promoter ID:

EPDNEW_R4866

Type:

single initiation site

Name:

Tnfrsf4_1

Description:

TNF receptor superfamily member 4

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	173,447,767 - 173,447,827	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3920	AgrOrtholog
BioCyc Gene	G2FUF-38878	BioCyc
Ensembl Genes	ENSRNOG00000020106	Ensembl, UniProtKB/Swiss-Prot
	ENSRNOG00055014258	UniProtKB/Swiss-Prot
	ENSRNOG00060004741	UniProtKB/Swiss-Prot
	ENSRNOG00065010350	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000027251.5	UniProtKB/Swiss-Prot
	ENSRNOT00055024482	UniProtKB/Swiss-Prot
	ENSRNOT00060007931	UniProtKB/Swiss-Prot
	ENSRNOT00065016725	UniProtKB/Swiss-Prot
Gene3D-CATH	Tumor Necrosis Factor Receptor, subunit A, domain 2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	TNFR/NGFR_Cys_rich_reg	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TNFR_4	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TNFRSF4_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:25572	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene	25572	ENTREZGENE
PANTHER	PTHR47881	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TUMOR NECROSIS FACTOR RECEPTOR SUPERFAMILY MEMBER 4	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	TNFR_c6	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Tnfrsf4	PhenoGen
PRINTS	TNFACTORR4	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	TNFR_NGFR_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TNFR_NGFR_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000020106	RatGTEx
	ENSRNOG00055014258	RatGTEx
	ENSRNOG00060004741	RatGTEx
	ENSRNOG00065010350	RatGTEx
SMART	TNFR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	TNF receptor-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A6IUV2	ENTREZGENE, UniProtKB/TrEMBL
	P15725	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-07-05	Tnfrsf4	TNF receptor superfamily member 4	Tnfrsf4	tumor necrosis factor receptor superfamily, member 4	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Tnfrsf4	tumor necrosis factor receptor superfamily, member 4		tumor necrosis factor superfamily, member 4	Name updated	1299863	APPROVED
2002-06-10	Tnfrsf4	tumor necrosis factor superfamily, member 4			Name updated	70585	PROVISIONAL
2001-12-10	Tnfrsf4	tumor necrosis factor (ligand) superfamily, member 4			Symbol and Name updated to reflect Human and Mouse nomenclature	69665	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_product	member of the tumor necrosis factor (TNF)-receptor superfamily	70044

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)