Symbol:
Cntn2
Name:
contactin 2
RGD ID:
3821
Description:
Predicted to enable carbohydrate binding activity and cell-cell adhesion mediator activity. Involved in axonogenesis and cell-matrix adhesion. Located in plasma membrane and synapse. Human ortholog(s) of this gene implicated in familial adult myoclonic epilepsy 5. Orthologous to human CNTN2 (contactin 2); INTERACTS WITH 6-propyl-2-thiouracil; alpha-Zearalanol; ammonium chloride.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
axonal glycoprotein TAG-1; axonin-1; contactin 2 (axonal); contactin-2; TAG-1; TAG-564; TAG1; Tax; TAX-1; transient axonal glycoprotein 1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CNTN2 (contactin 2) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Cntn2 (contactin 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Cntn2 (contactin 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CNTN2 (contactin 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CNTN2 (contactin 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Cntn2 (contactin 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CNTN2 (contactin 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CNTN2 (contactin 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Cntn2 (contactin 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Cntn2 (contactin 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
CNTN2 (contactin 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
cntn2 (contactin 2)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Cont
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
zig-4
Alliance
DIOPT (Ensembl Compara|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
cntn2
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 46,497,269 - 46,528,112 (-) NCBI GRCr8 mRatBN7.2 13 43,942,868 - 43,975,973 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 43,947,265 - 43,975,887 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 46,554,249 - 46,582,887 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 47,842,379 - 47,871,008 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 45,103,086 - 45,131,717 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 49,280,913 - 49,314,061 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 49,285,310 - 49,313,940 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 54,356,315 - 54,389,667 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 45,399,915 - 45,428,789 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 45,413,957 - 45,442,832 (-) NCBI Celera 13 44,281,845 - 44,310,387 (-) NCBI Celera Cytogenetic Map 13 q13 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Cntn2 Rat 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene multiple interactions ISO RGD:11392 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Cntn2 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO RGD:11392 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Cntn2 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO RGD:734311 6480464 2,2',4,4'-tetrabromodiphenyl ether results in increased expression of CNTN2 mRNA CTD PMID:31326446 Cntn2 Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO RGD:11392 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Cntn2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:11392 6480464 Tetrachlorodibenzodioxin results in increased expression of CNTN2 protein CTD PMID:18227101 Cntn2 Rat 2,4,4'-trichlorobiphenyl multiple interactions ISO RGD:11392 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Cntn2 Rat 3,3',5,5'-tetrabromobisphenol A increases expression ISO RGD:734311 6480464 tetrabromobisphenol A results in increased expression of CNTN2 mRNA CTD PMID:31326446 Cntn2 Rat 3,4-methylenedioxymethamphetamine increases expression ISO RGD:11392 6480464 N-Methyl-3,4-methylenedioxyamphetamine results in increased expression of CNTN2 mRNA CTD PMID:26251327 Cntn2 Rat 3,4-methylenedioxymethamphetamine affects methylation ISO RGD:11392 6480464 N-Methyl-3,4-methylenedioxyamphetamine affects the methylation of CNTN2 promoter CTD PMID:26251327 Cntn2 Rat 4-hydroxyphenyl retinamide decreases expression ISO RGD:11392 6480464 Fenretinide results in decreased expression of CNTN2 mRNA CTD PMID:28973697 Cntn2 Rat 5-aza-2'-deoxycytidine affects expression ISO RGD:734311 6480464 Decitabine affects the expression of CNTN2 mRNA CTD PMID:18791715 Cntn2 Rat 6-propyl-2-thiouracil affects expression EXP 6480464 Propylthiouracil affects the expression of CNTN2 mRNA CTD PMID:24780913 Cntn2 Rat 6-propyl-2-thiouracil increases methylation EXP 6480464 Propylthiouracil results in increased methylation of CNTN2 promoter CTD PMID:33150595 Cntn2 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of CNTN2 mRNA CTD PMID:33150595 Cntn2 Rat acrylamide decreases expression ISO RGD:734311 6480464 Acrylamide results in decreased expression of CNTN2 mRNA CTD PMID:32763439 Cntn2 Rat all-trans-retinoic acid multiple interactions ISO RGD:11392 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of CNTN2 mRNA CTD PMID:36189433 Cntn2 Rat alpha-amanitin affects expression ISO RGD:11392 6480464 Alpha-Amanitin affects the expression of CNTN2 mRNA CTD PMID:38531469 Cntn2 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of CNTN2 mRNA CTD PMID:35163327 Cntn2 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of CNTN2 mRNA CTD PMID:16483693 Cntn2 Rat aristolochic acid A increases expression ISO RGD:734311 6480464 aristolochic acid I results in increased expression of CNTN2 mRNA CTD PMID:33212167 Cntn2 Rat benzo[a]pyrene multiple interactions ISO RGD:11392 6480464 Benzo(a)pyrene promotes the reaction [AHR protein binds to CNTN2 promoter] CTD PMID:19654925 Cntn2 Rat benzo[a]pyrene affects methylation ISO RGD:734311 6480464 Benzo(a)pyrene affects the methylation of CNTN2 5' UTR; Benzo(a)pyrene affects the methylation of CNTN2 promoter CTD PMID:27901495 Cntn2 Rat bis(2-ethylhexyl) phthalate decreases expression ISO RGD:734311 6480464 Diethylhexyl Phthalate results in decreased expression of CNTN2 mRNA CTD PMID:31163220 Cntn2 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO RGD:11392 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated more ... CTD PMID:39150890 Cntn2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of CNTN2 mRNA CTD PMID:25181051 Cntn2 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of CNTN2 mRNA CTD PMID:30816183 Cntn2 Rat bisphenol F increases expression ISO RGD:11392 6480464 bisphenol F results in increased expression of CNTN2 mRNA CTD PMID:30951980 Cntn2 Rat Brodifacoum increases expression EXP 6480464 bromfenacoum results in increased expression of CNTN2 protein CTD PMID:28903499 Cntn2 Rat Butylbenzyl phthalate multiple interactions ISO RGD:11392 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated more ... CTD PMID:39150890 Cntn2 Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of CNTN2 mRNA CTD PMID:33453195 Cntn2 Rat chlorpyrifos decreases expression ISO RGD:11392 6480464 Chlorpyrifos results in decreased expression of CNTN2 mRNA CTD PMID:37019170 Cntn2 Rat copper(II) sulfate increases expression ISO RGD:734311 6480464 Copper Sulfate results in increased expression of CNTN2 mRNA CTD PMID:19549813 Cntn2 Rat decabromodiphenyl ether increases expression ISO RGD:734311 6480464 decabromobiphenyl ether results in increased expression of CNTN2 mRNA CTD PMID:31326446 Cntn2 Rat dibutyl phthalate multiple interactions ISO RGD:11392 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated more ... CTD PMID:39150890 Cntn2 Rat diethyl phthalate multiple interactions ISO RGD:11392 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated more ... CTD PMID:39150890 Cntn2 Rat diisobutyl phthalate multiple interactions ISO RGD:11392 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated more ... CTD PMID:39150890 Cntn2 Rat diisononyl phthalate multiple interactions ISO RGD:11392 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated more ... CTD PMID:39150890 Cntn2 Rat dorsomorphin multiple interactions ISO RGD:734311 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Cntn2 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of CNTN2 mRNA CTD PMID:29391264 Cntn2 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of CNTN2 protein CTD PMID:31464424 Cntn2 Rat endosulfan affects expression EXP 6480464 Endosulfan affects the expression of CNTN2 mRNA CTD PMID:31464424 Cntn2 Rat ethanol affects splicing ISO RGD:11392 6480464 Ethanol affects the splicing of CNTN2 mRNA CTD PMID:30319688 Cntn2 Rat ethanol increases expression ISO RGD:11392 6480464 Ethanol results in increased expression of CNTN2 mRNA CTD PMID:30319688 Cntn2 Rat folic acid decreases expression ISO RGD:734311 6480464 Folic Acid results in decreased expression of CNTN2 mRNA CTD PMID:21867686 Cntn2 Rat glyphosate increases expression ISO RGD:11392 6480464 Glyphosate results in increased expression of CNTN2 mRNA CTD PMID:35897073 Cntn2 Rat glyphosate increases expression EXP 6480464 Glyphosate results in increased expression of CNTN2 mRNA CTD PMID:38314887 Cntn2 Rat lead(0) affects expression ISO RGD:734311 6480464 Lead affects the expression of CNTN2 mRNA CTD PMID:28903495 Cntn2 Rat Licochalcone B increases expression ISO RGD:734311 6480464 licochalcone B results in increased expression of CNTN2 mRNA CTD PMID:33647349 Cntn2 Rat mercury dibromide decreases expression ISO RGD:734311 6480464 mercuric bromide results in decreased expression of CNTN2 mRNA CTD PMID:26272509 Cntn2 Rat mercury dibromide multiple interactions ISO RGD:734311 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Cntn2 Rat methamphetamine decreases expression EXP 6480464 Methamphetamine results in decreased expression of CNTN2 mRNA CTD PMID:19564919 Cntn2 Rat methylmercury chloride decreases expression ISO RGD:734311 6480464 methylmercuric chloride results in decreased expression of CNTN2 mRNA CTD PMID:28001369 Cntn2 Rat mono(2-ethylhexyl) phthalate multiple interactions ISO RGD:11392 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of CNTN2 mRNA CTD PMID:36189433 Cntn2 Rat p-chloromercuribenzoic acid decreases expression ISO RGD:734311 6480464 p-Chloromercuribenzoic Acid results in decreased expression of CNTN2 mRNA CTD PMID:26272509 Cntn2 Rat p-chloromercuribenzoic acid multiple interactions ISO RGD:734311 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Cntn2 Rat panobinostat decreases expression ISO RGD:734311 6480464 panobinostat results in decreased expression of CNTN2 mRNA CTD PMID:26272509 Cntn2 Rat panobinostat multiple interactions ISO RGD:734311 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ... CTD PMID:27188386 Cntn2 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of CNTN2 mRNA CTD PMID:33387578 Cntn2 Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of CNTN2 mRNA CTD PMID:32680482 Cntn2 Rat PCB138 multiple interactions ISO RGD:11392 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Cntn2 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of CNTN2 mRNA CTD PMID:35163327 Cntn2 Rat phenylmercury acetate decreases expression ISO RGD:734311 6480464 Phenylmercuric Acetate results in decreased expression of CNTN2 mRNA CTD PMID:26272509 Cntn2 Rat phenylmercury acetate multiple interactions ISO RGD:734311 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Cntn2 Rat rotenone multiple interactions EXP 6480464 [Rotenone co-treated with polylactic acid-polyglycolic acid copolymer] results in decreased expression of CNTN2 mRNA CTD PMID:23816754 Cntn2 Rat SB 431542 multiple interactions ISO RGD:734311 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Cntn2 Rat sevoflurane affects expression EXP 6480464 sevoflurane affects the expression of CNTN2 mRNA CTD PMID:15967596 Cntn2 Rat sevoflurane decreases methylation ISO RGD:11392 6480464 Sevoflurane results in decreased methylation of CNTN2 mRNA CTD PMID:35249202 Cntn2 Rat sodium arsenite increases expression ISO RGD:11392 6480464 sodium arsenite results in increased expression of CNTN2 mRNA CTD PMID:37682722 Cntn2 Rat Tetrachlorobisphenol A increases expression ISO RGD:734311 6480464 tetrachlorodian results in increased expression of CNTN2 mRNA CTD PMID:31326446 Cntn2 Rat thiram increases expression ISO RGD:734311 6480464 Thiram results in increased expression of CNTN2 mRNA CTD PMID:38568856 Cntn2 Rat titanium dioxide decreases expression EXP 6480464 titanium dioxide results in decreased expression of CNTN2 mRNA CTD PMID:30012374 Cntn2 Rat titanium dioxide increases methylation ISO RGD:11392 6480464 titanium dioxide results in increased methylation of CNTN2 gene CTD PMID:35295148 Cntn2 Rat triazines multiple interactions ISO RGD:11392 6480464 Triazines inhibits the reaction [IDH2 protein mutant form results in decreased expression of CNTN2 mRNA] CTD PMID:27469509 Cntn2 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of CNTN2 mRNA CTD PMID:33387578 Cntn2 Rat trichostatin A decreases expression ISO RGD:734311 6480464 trichostatin A results in decreased expression of CNTN2 mRNA CTD PMID:24935251|PMID:26272509 Cntn2 Rat trichostatin A multiple interactions ISO RGD:734311 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Cntn2 Rat triclosan increases expression ISO RGD:734311 6480464 Triclosan results in increased expression of CNTN2 mRNA CTD PMID:30510588 Cntn2 Rat triptonide increases expression ISO RGD:11392 6480464 triptonide results in increased expression of CNTN2 mRNA CTD PMID:33045310 Cntn2 Rat valproic acid affects expression ISO RGD:734311 6480464 Valproic Acid affects the expression of CNTN2 mRNA CTD PMID:25979313 Cntn2 Rat valproic acid multiple interactions ISO RGD:734311 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Cntn2 Rat valproic acid decreases expression ISO RGD:734311 6480464 Valproic Acid results in decreased expression of CNTN2 mRNA CTD PMID:23179753|PMID:24383497|PMID:24935251|PMID:26272509|PMID:28001369 Cntn2 Rat valproic acid increases methylation ISO RGD:734311 6480464 Valproic Acid results in increased methylation of CNTN2 gene CTD PMID:29154799 Cntn2 Rat venlafaxine hydrochloride increases expression EXP 6480464 Venlafaxine Hydrochloride results in increased expression of CNTN2 mRNA CTD PMID:25423262
1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4,4'-trichlorobiphenyl (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3,4-methylenedioxymethamphetamine (ISO) 4-hydroxyphenyl retinamide (ISO) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (EXP) acrylamide (ISO) all-trans-retinoic acid (ISO) alpha-amanitin (ISO) alpha-Zearalanol (EXP) ammonium chloride (EXP) aristolochic acid A (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP) bisphenol F (ISO) Brodifacoum (EXP) Butylbenzyl phthalate (ISO) cadmium dichloride (EXP) chlorpyrifos (ISO) copper(II) sulfate (ISO) decabromodiphenyl ether (ISO) dibutyl phthalate (ISO) diethyl phthalate (ISO) diisobutyl phthalate (ISO) diisononyl phthalate (ISO) dorsomorphin (ISO) endosulfan (EXP) ethanol (ISO) folic acid (ISO) glyphosate (EXP,ISO) lead(0) (ISO) Licochalcone B (ISO) mercury dibromide (ISO) methamphetamine (EXP) methylmercury chloride (ISO) mono(2-ethylhexyl) phthalate (ISO) p-chloromercuribenzoic acid (ISO) panobinostat (ISO) paracetamol (EXP) paraquat (EXP) PCB138 (ISO) perfluorooctanoic acid (EXP) phenylmercury acetate (ISO) rotenone (EXP) SB 431542 (ISO) sevoflurane (EXP,ISO) sodium arsenite (ISO) Tetrachlorobisphenol A (ISO) thiram (ISO) titanium dioxide (EXP,ISO) triazines (ISO) trichloroethene (EXP) trichostatin A (ISO) triclosan (ISO) triptonide (ISO) valproic acid (ISO) venlafaxine hydrochloride (EXP)
Biological Process
adult walking behavior (IEA,ISO) axon guidance (IBA,IEA,ISO) axonal fasciculation (IEA,ISO) axonogenesis (IDA) cell adhesion (IEA) cell-cell adhesion (IBA) cell-matrix adhesion (IDA) central nervous system myelination (IEA,ISO) central nervous system neuron differentiation (IEA,ISO) cerebral cortex GABAergic interneuron migration (IEA,ISO) clustering of voltage-gated potassium channels (IEA,ISO) establishment of localization in cell (IEA,ISO) establishment of protein localization to juxtaparanode region of axon (IEA,ISO) fat cell differentiation (IEA,ISO) G protein-coupled adenosine receptor signaling pathway (IEA,ISO) learning (IEA,ISO) microtubule cytoskeleton organization (IEA,ISO) negative regulation of neuron differentiation (IEA,ISO) neuron migration (IEA,ISO) neuron projection development (IEA,ISO) positive regulation of adenosine receptor signaling pathway (IEA,ISO) positive regulation of protein processing (IEA,ISO) presynaptic membrane organization (IEA,ISO,ISS) protein localization to juxtaparanode region of axon (IEA,ISO) protein processing (IEA,ISO) receptor internalization (IEA,ISO) reduction of food intake in response to dietary excess (IEA,ISO) regulation of astrocyte differentiation (IEA,ISO) regulation of axon diameter (IEA,ISO) regulation of cell morphogenesis (IEA,ISO) regulation of neuronal synaptic plasticity (IEA,ISO) response to dietary excess (IEA,ISO)
Cellular Component
axon (IBA,IEA,ISO) axon initial segment (IEA,ISO) cell surface (IEA,ISO,TAS) juxtaparanode region of axon (IEA,ISO) membrane (IEA) myelin sheath (IEA,ISO) neuron projection (IEA,ISO) neuronal cell body (IEA,ISO) node of Ranvier (IEA,ISO) plasma membrane (IBA,IDA,IEA) postsynaptic membrane (IEA,ISO) side of membrane (IEA) synapse (IDA)
1.
Nr-CAM and TAG-1 are expressed in distinct populations of developing precerebellar and cerebellar neurons.
Backer S, etal., Neuroscience 2002;113(4):743-8.
2.
Molecular cytogenetic analysis and resequencing of contactin associated protein-like 2 in autism spectrum disorders.
Bakkaloglu B, etal., Am J Hum Genet. 2008 Jan;82(1):165-73. doi: 10.1016/j.ajhg.2007.09.017.
3.
The axonal glycoprotein TAG-1 is an immunoglobulin superfamily member with neurite outgrowth-promoting activity.
Furley AJ, etal., Cell 1990 Apr 6;61(1):157-70.
4.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
6.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
7.
Increased expression of HBZ and Foxp3 mRNA in bronchoalveolar lavage cells taken from human T-lymphotropic virus type 1-associated lung disorder patients.
Nakayama Y, etal., Intern Med. 2013;52(23):2599-609. doi: 10.2169/internalmedicine.52.0845.
8.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
9.
GOA pipeline
RGD automated data pipeline
10.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
12.
The gene for the axonal cell adhesion molecule TAX-1 is amplified and aberrantly expressed in malignant gliomas.
Rickman DS, etal., Cancer Res 2001 Mar 1;61(5):2162-8.
13.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
14.
The neuronal adhesion protein TAG-1 is expressed by Schwann cells and oligodendrocytes and is localized to the juxtaparanodal region of myelinated fibers.
Traka M, etal., J Neurosci 2002 Apr 15;22(8):3016-24.
Cntn2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 46,497,269 - 46,528,112 (-) NCBI GRCr8 mRatBN7.2 13 43,942,868 - 43,975,973 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 43,947,265 - 43,975,887 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 46,554,249 - 46,582,887 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 47,842,379 - 47,871,008 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 45,103,086 - 45,131,717 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 49,280,913 - 49,314,061 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 49,285,310 - 49,313,940 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 54,356,315 - 54,389,667 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 45,399,915 - 45,428,789 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 45,413,957 - 45,442,832 (-) NCBI Celera 13 44,281,845 - 44,310,387 (-) NCBI Celera Cytogenetic Map 13 q13 NCBI
CNTN2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 205,042,949 - 205,078,289 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 205,042,937 - 205,078,289 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 205,012,077 - 205,047,417 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 203,278,963 - 203,313,761 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 201,743,996 - 201,778,793 NCBI Celera 1 178,147,407 - 178,182,200 (+) NCBI Celera Cytogenetic Map 1 q32.1 NCBI HuRef 1 176,177,847 - 176,212,673 (+) NCBI HuRef CHM1_1 1 206,435,687 - 206,470,502 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 204,307,317 - 204,342,659 (+) NCBI T2T-CHM13v2.0
Cntn2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 132,437,163 - 132,470,989 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 132,437,165 - 132,470,994 (-) Ensembl GRCm39 Ensembl GRCm38 1 132,509,425 - 132,543,251 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 132,509,427 - 132,543,256 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 134,406,002 - 134,439,517 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 134,336,973 - 134,370,462 (-) NCBI MGSCv36 mm8 Celera 1 135,118,092 - 135,152,003 (-) NCBI Celera Cytogenetic Map 1 E4 NCBI cM Map 1 57.42 NCBI
Cntn2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955406 40,831,850 - 40,858,569 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955406 40,831,897 - 40,862,445 (+) NCBI ChiLan1.0 ChiLan1.0
CNTN2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 44,298,727 - 44,333,562 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 44,264,002 - 44,298,806 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 180,645,259 - 180,680,081 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 184,931,902 - 184,966,482 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 184,931,497 - 184,966,482 (+) Ensembl panpan1.1 panPan2
CNTN2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 38 1,570,598 - 1,600,524 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 38 1,576,898 - 1,596,621 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 38 1,661,917 - 1,694,727 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 38 1,564,191 - 1,597,016 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 38 1,563,948 - 1,596,983 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 38 1,560,461 - 1,593,270 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 38 1,951,695 - 1,980,625 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 38 2,151,770 - 2,184,597 (+) NCBI UU_Cfam_GSD_1.0
Cntn2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409344 70,057,146 - 70,080,384 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936557 7,297,422 - 7,320,846 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936557 7,297,429 - 7,320,666 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CNTN2
CNTN2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 25 24,262,092 - 24,296,740 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 25 24,261,651 - 24,296,850 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666055 25,018,404 - 25,053,686 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Cntn2
.
Predicted Target Of
Count of predictions: 293 Count of miRNA genes: 170 Interacting mature miRNAs: 214 Transcripts: ENSRNOT00000012190 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
10755495 Bp387 Blood pressure QTL 387 3.78 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 34663461 87525369 Rat 9589141 Insul28 Insulin level QTL 28 10.82 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 13 9313465 54313465 Rat 6893344 Cm79 Cardiac mass QTL 79 1.5 0.04 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 13 43720770 62022792 Rat 70220 Bp55 Blood pressure QTL 55 5.75 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 13 37374509 82374509 Rat 61391 Bp5 Blood pressure QTL 5 5.6 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 13 22301875 67301875 Rat 4889861 Pur29 Proteinuria QTL 29 13.8 0.005 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 13 37415584 80753406 Rat 1300163 Cardf1 Cardiac cell morphology QTL 1 4.18 aorta morphology trait (VT:0000272) artery lesion measurement (CMO:0000975) 13 11929449 45417941 Rat 2317040 Aia21 Adjuvant induced arthritis QTL 21 2.75 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 13 9831541 54831541 Rat 631645 Bp121 Blood pressure QTL 121 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 14915655 59915655 Rat 2317046 Aia8 Adjuvant induced arthritis QTL 8 3.9700000286102295 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 13 9831541 54831541 Rat 619615 Bp80 Blood pressure QTL 80 0.0354 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 39754544 84754544 Rat 1581570 Eae17 Experimental allergic encephalomyelitis QTL 17 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 13 8897350 101631289 Rat 61339 Bp24 Blood pressure QTL 24 0.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 5994668 44807491 Rat 70170 Eae14 Experimental allergic encephalomyelitis QTL 14 0.0024 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 13 23203448 68203448 Rat 2303032 Bp328 Blood pressure QTL 328 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 41184022 45417941 Rat 1331784 Bp222 Blood pressure QTL 222 2.944 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 17694436 53050594 Rat 61340 Bp25 Blood pressure QTL 25 4.2 0.004 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 34535218 79535218 Rat 1581573 Uae36 Urinary albumin excretion QTL 36 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 13 5994833 77046787 Rat 1549897 Stresp12 Stress response QTL 12 3.35 stress-related behavior trait (VT:0010451) number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960) 13 38433408 83433408 Rat 2302275 Gluco37 Glucose level QTL 37 3.8 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 13 11929449 46193066 Rat 7207885 Glom27 Glomerulus QTL 27 3.9 kidney glomerulus integrity trait (VT:0010546) kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139) 13 20605871 101339738 Rat 4145117 Mcs27 Mammary carcinoma susceptibility QTL 27 0.0001 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 13 43437904 47841255 Rat 1558644 Cm45 Cardiac mass QTL 45 3.6 0.002 heart mass (VT:0007028) heart wet weight (CMO:0000069) 13 23692969 68692969 Rat 70181 BpQTLcluster11 Blood pressure QTL cluster 11 6.922 arterial blood pressure trait (VT:2000000) absolute change in mean arterial blood pressure (CMO:0000533) 13 31241331 93395974 Rat 61349 Bp31 Blood pressure QTL 31 5.75 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 13 37374509 82374509 Rat 2303563 Bw89 Body weight QTL 89 6 body mass (VT:0001259) body weight (CMO:0000012) 13 32284471 77284471 Rat 1354621 Rf47 Renal function QTL 47 3.7 kidney renin amount (VT:0010559) kidney renin level (CMO:0002166) 13 30395351 101056920 Rat 2301962 Cm72 Cardiac mass QTL 72 4.12 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 13 31241331 58363171 Rat 1581554 Pur11 Proteinuria QTL 11 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 13 5994833 77046787 Rat 12879477 Bp401 Blood pressure QTL 401 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 37262092 82262092 Rat 1331750 Bp220 Blood pressure QTL 220 2.98 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 13 37415584 82415584 Rat 6893338 Cm76 Cardiac mass QTL 76 0 0.99 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 13 23692969 68692969 Rat 1354666 Bp244 Blood pressure QTL 244 4.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 1 101056920 Rat 9589164 Gluco66 Glucose level QTL 66 6.67 0.001 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 13 15158722 60158722 Rat 7411662 Foco29 Food consumption QTL 29 20.8 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 13 9313465 54313465 Rat
RH142422
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 13 43,959,548 - 43,960,824 (+) MAPPER mRatBN7.2 Rnor_6.0 13 49,297,603 - 49,298,877 NCBI Rnor6.0 Rnor_5.0 13 54,373,249 - 54,374,523 UniSTS Rnor5.0 RGSC_v3.4 13 45,412,454 - 45,413,728 UniSTS RGSC3.4 Celera 13 44,294,052 - 44,295,326 UniSTS Cytogenetic Map 13 q13 UniSTS
AW528446
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 13 43,947,330 - 43,947,474 (+) MAPPER mRatBN7.2 Rnor_6.0 13 49,285,376 - 49,285,519 NCBI Rnor6.0 Rnor_5.0 13 54,360,776 - 54,360,919 UniSTS Rnor5.0 RGSC_v3.4 13 45,399,981 - 45,400,124 UniSTS RGSC3.4 Celera 13 44,281,911 - 44,282,054 UniSTS Cytogenetic Map 13 q13 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
64
63
32
24
32
6
190
96
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000012190 ⟹ ENSRNOP00000012190
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 43,947,265 - 43,975,887 (-) Ensembl Rnor_6.0 Ensembl 13 49,285,310 - 49,313,940 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000109604 ⟹ ENSRNOP00000076834
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 43,947,265 - 43,962,830 (-) Ensembl
RefSeq Acc Id:
NM_012884 ⟹ NP_037016
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 46,499,396 - 46,528,025 (-) NCBI mRatBN7.2 13 43,947,265 - 43,975,885 (-) NCBI Rnor_6.0 13 49,285,310 - 49,313,938 (-) NCBI Rnor_5.0 13 54,356,315 - 54,389,667 (-) NCBI RGSC_v3.4 13 45,399,915 - 45,428,789 (-) RGD Celera 13 44,281,845 - 44,310,387 (-) RGD
Sequence:
GAATTCCCGCCCGCTGCCGCCACGCCAGGACAGCCAGTGGCTAAGGCCGGCGGGGCAAGCAGCCCTGAGGCTGGCAGCAGGGTCTGCTCACCAGGCGGCCGCAGCAGTGCCCCAGCCAACACCCTTCC
hide sequence
RefSeq Acc Id:
XM_006249746 ⟹ XP_006249808
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 46,497,269 - 46,528,110 (-) NCBI mRatBN7.2 13 43,942,868 - 43,975,972 (-) NCBI Rnor_6.0 13 49,280,913 - 49,314,061 (-) NCBI Rnor_5.0 13 54,356,315 - 54,389,667 (-) NCBI
Sequence:
TCTCCGGCCGAGCGTTGGCTGAGGAGCCTAGCCAGCCAGTGAGCGGAGCCTGCGAGAGGGAGGA
hide sequence
RefSeq Acc Id:
XM_039090383 ⟹ XP_038946311
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 46,497,269 - 46,528,112 (-) NCBI mRatBN7.2 13 43,942,868 - 43,975,973 (-) NCBI
RefSeq Acc Id:
XR_010056901
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 46,497,269 - 46,528,110 (-) NCBI
RefSeq Acc Id:
NP_037016 ⟸ NM_012884
- Peptide Label:
precursor
- UniProtKB:
P22063 (UniProtKB/Swiss-Prot), G3V758 (UniProtKB/TrEMBL), A6IC54 (UniProtKB/TrEMBL)
- Sequence:
MGTHARKKASLLLLVLATVALVSSPGWSFAQGTPATFGPIFEEQPIGLLFPEESAEDQVTLACRARASPPATYRWKMNGTDMNLEPGSRHQLMGGNLVIMSPTKTQDAGVYQCLASNPVGTVVSKEAV
hide sequence
RefSeq Acc Id:
XP_006249808 ⟸ XM_006249746
- Peptide Label:
isoform X1
- UniProtKB:
P22063 (UniProtKB/Swiss-Prot), G3V758 (UniProtKB/TrEMBL), A6IC54 (UniProtKB/TrEMBL)
- Sequence:
MGTHARKKASLLLLVLATVALVSSPGWSFAQGTPATFGPIFEEQPIGLLFPEESAEDQVTLACR
hide sequence
Ensembl Acc Id:
ENSRNOP00000012190 ⟸ ENSRNOT00000012190
RefSeq Acc Id:
XP_038946311 ⟸ XM_039090383
- Peptide Label:
isoform X2
- UniProtKB:
P22063 (UniProtKB/Swiss-Prot)
Ensembl Acc Id:
ENSRNOP00000076834 ⟸ ENSRNOT00000109604
RGD ID: 13698816 Promoter ID: EPDNEW_R9339 Type: single initiation site Name: Cntn2_1 Description: contactin 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 13 49,313,950 - 49,314,010 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-12-16
Cntn2
contactin 2
Cntn2
contactin 2 (axonal)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-09-09
Cntn2
contactin 2 (axonal)
Cntn2
contactin 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2001-11-29
Cntn2
Contactin 2
Symbol and Name updated to reflect Human and Mouse nomenclature
68913 APPROVED
Note Type
Note
Reference
gene_expression
expressed by Schwann cells and oligodendrocytes
625462
