Symbol:
Cntn2
Name:
contactin 2
RGD ID:
11392
MGI Page
MGI
Description:
Enables carbohydrate binding activity and cell adhesion mediator activity. Involved in several processes, including clustering of voltage-gated potassium channels; establishment of protein localization to juxtaparanode region of axon; and reduction of food intake in response to dietary excess. Acts upstream of or within several processes, including adult walking behavior; neurogenesis; and positive regulation of adenosine receptor signaling pathway. Located in several cellular components, including main axon; myelin sheath; and neuronal cell body. Is active in axon initial segment. Is expressed in eye; nervous system; olfactory epithelium; and yolk sac. Used to study T-cell adult acute lymphocytic leukemia. Human ortholog(s) of this gene implicated in familial adult myoclonic epilepsy 5. Orthologous to human CNTN2 (contactin 2).
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
a; axonal glycoprotein TAG-1; axonin; axonin-1; contactin-2; D130012K04Rik; Ta; TAG; TAG-; TAG-1; TAG1; Tax; TAX-1; transient axonal glycoprotein 1; transiently-expressed axonal glycoprotein
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CNTN2 (contactin 2) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Cntn2 (contactin 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Cntn2 (contactin 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CNTN2 (contactin 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CNTN2 (contactin 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Cntn2 (contactin 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CNTN2 (contactin 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CNTN2 (contactin 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Cntn2 (contactin 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
CNTN1 (contactin 1) HGNC
OrthoMCL
Homo sapiens (human):
CNTN3 (contactin 3) HGNC
OrthoMCL
Homo sapiens (human):
CNTN6 (contactin 6) HGNC
OrthoMCL
Homo sapiens (human):
CNTN5 (contactin 5) HGNC
OrthoMCL
Homo sapiens (human):
CNTN4 (contactin 4) HGNC
OrthoMCL
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Cntn2 (contactin 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
CNTN2 (contactin 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
cntn2 (contactin 2)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Drosophila melanogaster (fruit fly):
Cont
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
zig-4
Alliance
DIOPT (Ensembl Compara|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
cntn2
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PhylomeDB)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 132,437,163 - 132,470,989 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 132,437,165 - 132,470,994 (-) Ensembl GRCm39 Ensembl GRCm38 1 132,509,425 - 132,543,251 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 132,509,427 - 132,543,256 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 134,406,002 - 134,439,517 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 134,336,973 - 134,370,462 (-) NCBI MGSCv36 mm8 Celera 1 135,118,092 - 135,152,003 (-) NCBI Celera Cytogenetic Map 1 E4 NCBI cM Map 1 57.42 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Cntn2 Mouse 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions EXP 6480464 [2 more ... CTD PMID:25510870 Cntn2 Mouse 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO CNTN2 (Homo sapiens) 6480464 2 more ... CTD PMID:31326446 Cntn2 Mouse 2,2',5,5'-tetrachlorobiphenyl multiple interactions EXP 6480464 [2 more ... CTD PMID:25510870 Cntn2 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of CNTN2 protein CTD PMID:18227101 Cntn2 Mouse 3,3',5,5'-tetrabromobisphenol A increases expression ISO CNTN2 (Homo sapiens) 6480464 tetrabromobisphenol A results in increased expression of CNTN2 mRNA CTD PMID:31326446 Cntn2 Mouse 3,4-methylenedioxymethamphetamine increases expression EXP 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of CNTN2 mRNA CTD PMID:26251327 Cntn2 Mouse 3,4-methylenedioxymethamphetamine affects methylation EXP 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine affects the methylation of CNTN2 promoter CTD PMID:26251327 Cntn2 Mouse 4-hydroxyphenyl retinamide decreases expression EXP 6480464 Fenretinide results in decreased expression of CNTN2 mRNA CTD PMID:28973697 Cntn2 Mouse 5-aza-2'-deoxycytidine affects expression ISO CNTN2 (Homo sapiens) 6480464 Decitabine affects the expression of CNTN2 mRNA CTD PMID:18791715 Cntn2 Mouse 6-propyl-2-thiouracil affects expression ISO Cntn2 (Rattus norvegicus) 6480464 Propylthiouracil affects the expression of CNTN2 mRNA CTD PMID:24780913 Cntn2 Mouse 6-propyl-2-thiouracil increases methylation ISO Cntn2 (Rattus norvegicus) 6480464 Propylthiouracil results in increased methylation of CNTN2 promoter CTD PMID:33150595 Cntn2 Mouse 6-propyl-2-thiouracil decreases expression ISO Cntn2 (Rattus norvegicus) 6480464 Propylthiouracil results in decreased expression of CNTN2 mRNA CTD PMID:33150595 Cntn2 Mouse acrylamide decreases expression ISO CNTN2 (Homo sapiens) 6480464 Acrylamide results in decreased expression of CNTN2 mRNA CTD PMID:32763439 Cntn2 Mouse all-trans-retinoic acid multiple interactions EXP 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of CNTN2 mRNA CTD PMID:36189433 Cntn2 Mouse alpha-amanitin affects expression EXP 6480464 Alpha-Amanitin affects the expression of CNTN2 mRNA CTD PMID:38531469 Cntn2 Mouse alpha-Zearalanol multiple interactions ISO Cntn2 (Rattus norvegicus) 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of CNTN2 mRNA CTD PMID:35163327 Cntn2 Mouse ammonium chloride affects expression ISO Cntn2 (Rattus norvegicus) 6480464 Ammonium Chloride affects the expression of CNTN2 mRNA CTD PMID:16483693 Cntn2 Mouse aristolochic acid A increases expression ISO CNTN2 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of CNTN2 mRNA CTD PMID:33212167 Cntn2 Mouse benzo[a]pyrene multiple interactions EXP 6480464 Benzo(a)pyrene promotes the reaction [AHR protein binds to CNTN2 promoter] CTD PMID:19654925 Cntn2 Mouse benzo[a]pyrene affects methylation ISO CNTN2 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of CNTN2 5' UTR and Benzo(a)pyrene affects the methylation of CNTN2 promoter CTD PMID:27901495 Cntn2 Mouse bis(2-ethylhexyl) phthalate decreases expression ISO CNTN2 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in decreased expression of CNTN2 mRNA CTD PMID:31163220 Cntn2 Mouse bis(2-ethylhexyl) phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of CNTN2 mRNA CTD PMID:39150890 Cntn2 Mouse bisphenol A decreases expression ISO Cntn2 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of CNTN2 mRNA CTD PMID:25181051 Cntn2 Mouse bisphenol A increases expression ISO Cntn2 (Rattus norvegicus) 6480464 bisphenol A results in increased expression of CNTN2 mRNA CTD PMID:30816183 Cntn2 Mouse bisphenol F increases expression EXP 6480464 bisphenol F results in increased expression of CNTN2 mRNA CTD PMID:30951980 Cntn2 Mouse Brodifacoum increases expression ISO Cntn2 (Rattus norvegicus) 6480464 bromfenacoum results in increased expression of CNTN2 protein CTD PMID:28903499 Cntn2 Mouse Butylbenzyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of CNTN2 mRNA CTD PMID:39150890 Cntn2 Mouse cadmium dichloride decreases expression ISO Cntn2 (Rattus norvegicus) 6480464 Cadmium Chloride results in decreased expression of CNTN2 mRNA CTD PMID:33453195 Cntn2 Mouse chlorpyrifos decreases expression EXP 6480464 Chlorpyrifos results in decreased expression of CNTN2 mRNA CTD PMID:37019170 Cntn2 Mouse copper(II) sulfate increases expression ISO CNTN2 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of CNTN2 mRNA CTD PMID:19549813 Cntn2 Mouse decabromodiphenyl ether increases expression ISO CNTN2 (Homo sapiens) 6480464 decabromobiphenyl ether results in increased expression of CNTN2 mRNA CTD PMID:31326446 Cntn2 Mouse dibutyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of CNTN2 mRNA CTD PMID:39150890 Cntn2 Mouse diethyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of CNTN2 mRNA CTD PMID:39150890 Cntn2 Mouse diisobutyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of CNTN2 mRNA CTD PMID:39150890 Cntn2 Mouse diisononyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of CNTN2 mRNA CTD PMID:39150890 Cntn2 Mouse dorsomorphin multiple interactions ISO CNTN2 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Cntn2 Mouse endosulfan decreases expression ISO Cntn2 (Rattus norvegicus) 6480464 Endosulfan results in decreased expression of CNTN2 mRNA CTD PMID:29391264 Cntn2 Mouse endosulfan increases expression ISO Cntn2 (Rattus norvegicus) 6480464 Endosulfan results in increased expression of CNTN2 protein CTD PMID:31464424 Cntn2 Mouse endosulfan affects expression ISO Cntn2 (Rattus norvegicus) 6480464 Endosulfan affects the expression of CNTN2 mRNA CTD PMID:31464424 Cntn2 Mouse ethanol affects splicing EXP 6480464 Ethanol affects the splicing of CNTN2 mRNA CTD PMID:30319688 Cntn2 Mouse ethanol increases expression EXP 6480464 Ethanol results in increased expression of CNTN2 mRNA CTD PMID:30319688 Cntn2 Mouse folic acid decreases expression ISO CNTN2 (Homo sapiens) 6480464 Folic Acid results in decreased expression of CNTN2 mRNA CTD PMID:21867686 Cntn2 Mouse glyphosate increases expression EXP 6480464 Glyphosate results in increased expression of CNTN2 mRNA CTD PMID:35897073 Cntn2 Mouse glyphosate increases expression ISO Cntn2 (Rattus norvegicus) 6480464 Glyphosate results in increased expression of CNTN2 mRNA CTD PMID:38314887 Cntn2 Mouse lead(0) affects expression ISO CNTN2 (Homo sapiens) 6480464 Lead affects the expression of CNTN2 mRNA CTD PMID:28903495 Cntn2 Mouse Licochalcone B increases expression ISO CNTN2 (Homo sapiens) 6480464 licochalcone B results in increased expression of CNTN2 mRNA CTD PMID:33647349 Cntn2 Mouse mercury dibromide decreases expression ISO CNTN2 (Homo sapiens) 6480464 mercuric bromide results in decreased expression of CNTN2 mRNA CTD PMID:26272509 Cntn2 Mouse mercury dibromide multiple interactions ISO CNTN2 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of CNTN2 mRNA CTD PMID:27188386 Cntn2 Mouse methamphetamine decreases expression ISO Cntn2 (Rattus norvegicus) 6480464 Methamphetamine results in decreased expression of CNTN2 mRNA CTD PMID:19564919 Cntn2 Mouse methylmercury chloride decreases expression ISO CNTN2 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of CNTN2 mRNA CTD PMID:28001369 Cntn2 Mouse mono(2-ethylhexyl) phthalate multiple interactions EXP 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of CNTN2 mRNA CTD PMID:36189433 Cntn2 Mouse p-chloromercuribenzoic acid decreases expression ISO CNTN2 (Homo sapiens) 6480464 p-Chloromercuribenzoic Acid results in decreased expression of CNTN2 mRNA CTD PMID:26272509 Cntn2 Mouse p-chloromercuribenzoic acid multiple interactions ISO CNTN2 (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of CNTN2 mRNA CTD PMID:27188386 Cntn2 Mouse panobinostat decreases expression ISO CNTN2 (Homo sapiens) 6480464 panobinostat results in decreased expression of CNTN2 mRNA CTD PMID:26272509 Cntn2 Mouse panobinostat multiple interactions ISO CNTN2 (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of CNTN2 mRNA CTD PMID:27188386 Cntn2 Mouse paracetamol increases expression ISO Cntn2 (Rattus norvegicus) 6480464 Acetaminophen results in increased expression of CNTN2 mRNA CTD PMID:33387578 Cntn2 Mouse paraquat decreases expression ISO Cntn2 (Rattus norvegicus) 6480464 Paraquat results in decreased expression of CNTN2 mRNA CTD PMID:32680482 Cntn2 Mouse PCB138 multiple interactions EXP 6480464 [2 more ... CTD PMID:25510870 Cntn2 Mouse perfluorooctanoic acid multiple interactions ISO Cntn2 (Rattus norvegicus) 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of CNTN2 mRNA CTD PMID:35163327 Cntn2 Mouse phenylmercury acetate decreases expression ISO CNTN2 (Homo sapiens) 6480464 Phenylmercuric Acetate results in decreased expression of CNTN2 mRNA CTD PMID:26272509 Cntn2 Mouse phenylmercury acetate multiple interactions ISO CNTN2 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of CNTN2 mRNA CTD PMID:27188386 Cntn2 Mouse rotenone multiple interactions ISO Cntn2 (Rattus norvegicus) 6480464 [Rotenone co-treated with polylactic acid-polyglycolic acid copolymer] results in decreased expression of CNTN2 mRNA CTD PMID:23816754 Cntn2 Mouse SB 431542 multiple interactions ISO CNTN2 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Cntn2 Mouse sevoflurane affects expression ISO Cntn2 (Rattus norvegicus) 6480464 sevoflurane affects the expression of CNTN2 mRNA CTD PMID:15967596 Cntn2 Mouse sevoflurane decreases methylation EXP 6480464 Sevoflurane results in decreased methylation of CNTN2 mRNA CTD PMID:35249202 Cntn2 Mouse sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of CNTN2 mRNA CTD PMID:37682722 Cntn2 Mouse Tetrachlorobisphenol A increases expression ISO CNTN2 (Homo sapiens) 6480464 tetrachlorodian results in increased expression of CNTN2 mRNA CTD PMID:31326446 Cntn2 Mouse thiram increases expression ISO CNTN2 (Homo sapiens) 6480464 Thiram results in increased expression of CNTN2 mRNA CTD PMID:38568856 Cntn2 Mouse titanium dioxide decreases expression ISO Cntn2 (Rattus norvegicus) 6480464 titanium dioxide results in decreased expression of CNTN2 mRNA CTD PMID:30012374 Cntn2 Mouse titanium dioxide increases methylation EXP 6480464 titanium dioxide results in increased methylation of CNTN2 gene CTD PMID:35295148 Cntn2 Mouse triazines multiple interactions EXP 6480464 Triazines inhibits the reaction [IDH2 protein mutant form results in decreased expression of CNTN2 mRNA] CTD PMID:27469509 Cntn2 Mouse trichloroethene increases expression ISO Cntn2 (Rattus norvegicus) 6480464 Trichloroethylene results in increased expression of CNTN2 mRNA CTD PMID:33387578 Cntn2 Mouse trichostatin A decreases expression ISO CNTN2 (Homo sapiens) 6480464 trichostatin A results in decreased expression of CNTN2 mRNA CTD PMID:24935251 and PMID:26272509 Cntn2 Mouse trichostatin A multiple interactions ISO CNTN2 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of CNTN2 mRNA CTD PMID:27188386 Cntn2 Mouse triclosan increases expression ISO CNTN2 (Homo sapiens) 6480464 Triclosan results in increased expression of CNTN2 mRNA CTD PMID:30510588 Cntn2 Mouse triptonide increases expression EXP 6480464 triptonide results in increased expression of CNTN2 mRNA CTD PMID:33045310 Cntn2 Mouse valproic acid increases methylation ISO CNTN2 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of CNTN2 gene CTD PMID:29154799 Cntn2 Mouse valproic acid multiple interactions ISO CNTN2 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of CNTN2 mRNA CTD PMID:27188386 Cntn2 Mouse valproic acid decreases expression ISO CNTN2 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of CNTN2 mRNA CTD PMID:23179753 more ... Cntn2 Mouse valproic acid affects expression ISO CNTN2 (Homo sapiens) 6480464 Valproic Acid affects the expression of CNTN2 mRNA CTD PMID:25979313 Cntn2 Mouse venlafaxine hydrochloride increases expression ISO Cntn2 (Rattus norvegicus) 6480464 Venlafaxine Hydrochloride results in increased expression of CNTN2 mRNA CTD PMID:25423262
2,2',4,4',5,5'-hexachlorobiphenyl (EXP) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,2',5,5'-tetrachlorobiphenyl (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 3,3',5,5'-tetrabromobisphenol A (ISO) 3,4-methylenedioxymethamphetamine (EXP) 4-hydroxyphenyl retinamide (EXP) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (ISO) acrylamide (ISO) all-trans-retinoic acid (EXP) alpha-amanitin (EXP) alpha-Zearalanol (ISO) ammonium chloride (ISO) aristolochic acid A (ISO) benzo[a]pyrene (EXP,ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (ISO) bisphenol F (EXP) Brodifacoum (ISO) Butylbenzyl phthalate (EXP) cadmium dichloride (ISO) chlorpyrifos (EXP) copper(II) sulfate (ISO) decabromodiphenyl ether (ISO) dibutyl phthalate (EXP) diethyl phthalate (EXP) diisobutyl phthalate (EXP) diisononyl phthalate (EXP) dorsomorphin (ISO) endosulfan (ISO) ethanol (EXP) folic acid (ISO) glyphosate (EXP,ISO) lead(0) (ISO) Licochalcone B (ISO) mercury dibromide (ISO) methamphetamine (ISO) methylmercury chloride (ISO) mono(2-ethylhexyl) phthalate (EXP) p-chloromercuribenzoic acid (ISO) panobinostat (ISO) paracetamol (ISO) paraquat (ISO) PCB138 (EXP) perfluorooctanoic acid (ISO) phenylmercury acetate (ISO) rotenone (ISO) SB 431542 (ISO) sevoflurane (EXP,ISO) sodium arsenite (EXP) Tetrachlorobisphenol A (ISO) thiram (ISO) titanium dioxide (EXP,ISO) triazines (EXP) trichloroethene (ISO) trichostatin A (ISO) triclosan (ISO) triptonide (EXP) valproic acid (ISO) venlafaxine hydrochloride (ISO)
1.
Nr-CAM and TAG-1 are expressed in distinct populations of developing precerebellar and cerebellar neurons.
Backer S, etal., Neuroscience 2002;113(4):743-8.
2.
Neuropilin-2 regulates the development of selective cranial and sensory nerves and hippocampal mossy fiber projections.
Chen H, etal., Neuron 2000 Jan;25(1):43-56.
3.
Electronic Transfer of Homolog Data
MGD and Homologene mouse data transfer
4.
MGDs mouse GO annotations
MGD data from the GO Consortium
5.
MGD IEA
MGD IEA
6.
Increased expression of HBZ and Foxp3 mRNA in bronchoalveolar lavage cells taken from human T-lymphotropic virus type 1-associated lung disorder patients.
Nakayama Y, etal., Intern Med. 2013;52(23):2599-609. doi: 10.2169/internalmedicine.52.0845.
7.
Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.
Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
8.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
9.
Mouse MP Annotation Import Pipeline
RGD automated import pipeline
10.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
12.
The gene for the axonal cell adhesion molecule TAX-1 is amplified and aberrantly expressed in malignant gliomas.
Rickman DS, etal., Cancer Res 2001 Mar 1;61(5):2162-8.
Cntn2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 132,437,163 - 132,470,989 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 132,437,165 - 132,470,994 (-) Ensembl GRCm39 Ensembl GRCm38 1 132,509,425 - 132,543,251 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 132,509,427 - 132,543,256 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 134,406,002 - 134,439,517 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 134,336,973 - 134,370,462 (-) NCBI MGSCv36 mm8 Celera 1 135,118,092 - 135,152,003 (-) NCBI Celera Cytogenetic Map 1 E4 NCBI cM Map 1 57.42 NCBI
CNTN2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 205,042,949 - 205,078,289 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 205,042,937 - 205,078,289 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 205,012,077 - 205,047,417 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 203,278,963 - 203,313,761 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 201,743,996 - 201,778,793 NCBI Celera 1 178,147,407 - 178,182,200 (+) NCBI Celera Cytogenetic Map 1 q32.1 NCBI HuRef 1 176,177,847 - 176,212,673 (+) NCBI HuRef CHM1_1 1 206,435,687 - 206,470,502 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 204,307,317 - 204,342,659 (+) NCBI T2T-CHM13v2.0
Cntn2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 46,497,269 - 46,528,112 (-) NCBI GRCr8 mRatBN7.2 13 43,942,868 - 43,975,973 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 43,947,265 - 43,975,887 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 46,554,249 - 46,582,887 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 47,842,379 - 47,871,008 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 45,103,086 - 45,131,717 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 49,280,913 - 49,314,061 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 49,285,310 - 49,313,940 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 54,356,315 - 54,389,667 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 45,399,915 - 45,428,789 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 45,413,957 - 45,442,832 (-) NCBI Celera 13 44,281,845 - 44,310,387 (-) NCBI Celera Cytogenetic Map 13 q13 NCBI
Cntn2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955406 40,831,850 - 40,858,569 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955406 40,831,897 - 40,862,445 (+) NCBI ChiLan1.0 ChiLan1.0
CNTN2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 44,298,727 - 44,333,562 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 44,264,002 - 44,298,806 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 180,645,259 - 180,680,081 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 184,931,902 - 184,966,482 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 184,931,497 - 184,966,482 (+) Ensembl panpan1.1 panPan2
CNTN2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 38 1,570,598 - 1,600,524 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 38 1,576,898 - 1,596,621 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 38 1,661,917 - 1,694,727 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 38 1,564,191 - 1,597,016 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 38 1,563,948 - 1,596,983 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 38 1,560,461 - 1,593,270 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 38 1,951,695 - 1,980,625 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 38 2,151,770 - 2,184,597 (+) NCBI UU_Cfam_GSD_1.0
Cntn2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409344 70,057,146 - 70,080,384 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936557 7,297,422 - 7,320,846 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936557 7,297,429 - 7,320,666 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CNTN2
CNTN2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 25 24,262,092 - 24,296,740 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 25 24,261,651 - 24,296,850 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666055 25,018,404 - 25,053,686 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Cntn2
.
Predicted Target Of
Count of predictions: 3046 Count of miRNA genes: 856 Interacting mature miRNAs: 1184 Transcripts: ENSMUST00000086521 Prediction methods: Miranda, Targetscan Result types: miRGate_prediction
11039528 Ccc3_m colitis susceptibility in the Collaborative Cross 3 (mouse) 1 3680142 195051546 Mouse 27095901 Scvln8_m sacral vertebrae length 2, 10 week (mouse) 1 94127725 172027567 Mouse 1302098 Eila1_m ethanol induced locomotor activity 1 (mouse) Not determined 1 112008822 175468938 Mouse 1302161 Exq2_m exploratory and excitability QTL 2 (mouse) Not determined 1 118099720 152099816 Mouse 1357847 Jckm2_m juvenile cystic kidney modifier 2 (mouse) Not determined 1 74991977 133290937 Mouse 27226779 Tibl1_m tibia length 1, 5 week (mouse) 1 95527725 162027569 Mouse 27226714 Metcl1_m metatarsal-calcaneal length 1, 5 week (mouse) 1 121727729 139727738 Mouse 10412185 Hcs9_m hepatocarcinogenesis susceptibility 9 (mouse) Not determined 1 63854690 189303617 Mouse 1301979 Melm1_m melanoma modifier 1 (mouse) Not determined 1 109638262 143638479 Mouse 1301722 Cia9_m collagen induced arthritis QTL 9 (mouse) Not determined 1 45783900 189303617 Mouse 13824984 Twq5_m testis weight QTL 5 (mouse) 1 3069992 184732197 Mouse 1301149 Lrnx12_m learning-contextual 12 (mouse) Not determined 1 112008822 168186402 Mouse 27226767 Tibl10_m tibia length 10, 10 week (mouse) 1 121727729 164827569 Mouse 12790994 Aaaq1_m aortic arch angle QTL 1 (mouse) 1 109495943 143495943 Mouse 10045640 Jckm4_m juvenile cystic kidney modifier 4 (mouse) Not determined 1 116290836 150290937 Mouse 1301249 Sbw1_m splenomegaly-NZB x NZW 1 (mouse) Not determined 1 112131005 146131085 Mouse 1301193 Lxw3_m lupus BXSB x NZW 3 (mouse) Not determined 1 102968534 136968667 Mouse 1558860 W10q7_m weight 10 weeks QTL 7 (mouse) Not determined 1 34760138 150193871 Mouse 10412162 Nobq3_m New Zealand obese QTL 3 (mouse) Not determined 1 103933405 191225397 Mouse 12880408 V125Dq3_m vitamin D active form serum level QTL 3 (mouse) 1 122927738 156927738 Mouse 27095935 Ulnl5_m ulna length 5, 10 week (mouse) 1 128727737 181327565 Mouse 1302128 Ity3_m immunity to S. typhimurium 3 (mouse) Not determined 11 131156308 165139464 Mouse 1357488 Splq3_m spleen weight QTL 3 (mouse) Not determined 1 34760138 150193871 Mouse 4141914 Gcsfis_m G-CSF induced splenomegaly (mouse) Not determined 74516235 148715579 Mouse 27095928 Pglq6_m pelvic girdle length QTL 6, 10 week (mouse) 1 75976637 148775742 Mouse 13524520 Bodwtq1_m body wweight QTL 1 (mouse) 1 131191160 135621161 Mouse 27226743 Metcl7_m metatarsal-calcaneal length 7, 10 week (mouse) 1 121727729 153875746 Mouse 1357439 Popoa_m premature ovulation and primary oocyte arrest (mouse) Not determined 1 82643189 135615379 Mouse 27226740 Metcl13_m metatarsal-calcaneal length 13, 16 week (mouse) 1 121727729 153775746 Mouse 4142291 Aec2_m autoimmune exocrinopathy 2 (mouse) Not determined 52457737 182250592 Mouse 1357753 Kidq2_m kidney weight QTL 2 (mouse) Not determined 1 34760138 150193871 Mouse 1300989 Lrdg1_m light induced retinal degeneration 1 (mouse) Not determined 1 73755175 147125370 Mouse 27226799 Feml5_m femur length 5, 5 week (mouse) 1 122027729 164827569 Mouse 1301536 Pbbcp1_m peripheral blood B cell percentage 1 (mouse) Not determined 1 99507660 133507845 Mouse 27095913 Scvln2_m sacral vertebrae length 2, 5 week (mouse) 1 94127725 148775742 Mouse 1357600 Obq17_m obesity QTL 17 (mouse) Not determined 1 110553179 144553298 Mouse 1301350 Nidd4k_m Nidd4 on KK-A (mouse) Not determined 7 82291982 147125370 Mouse 27095915 Scvln13_m sacral vertebrae length 2, 16 week (mouse) 1 117527730 179827565 Mouse 13513913 Heal51_m wound healing/ regeneration 51 (mouse) 1 131780648 135499606 Mouse 1300841 Ssial1_m susceptibility to sialadenitis 1 (mouse) Not determined 1 63920002 153557562 Mouse 26884448 Sklq1_m skull length QTL 1, 5 week (mouse) 1 75976637 181327565 Mouse 1301608 Emo3_m emotionality 3 (mouse) Not determined 1 129130858 163130993 Mouse 10401248 Bglu12_m blood glucose level 12 (mouse) Not determined 1 110553179 144553298 Mouse
Cntn2
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 1 E4 UniSTS cM Map 1 57.42 UniSTS
RH142422
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 1 132,526,339 - 132,527,788 UniSTS GRCm38 MGSCv37 1 134,422,916 - 134,424,365 UniSTS GRCm37 Celera 1 135,134,903 - 135,136,352 UniSTS Cytogenetic Map 1 E4 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000086521 ⟹ ENSMUSP00000083707
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 132,439,520 - 132,470,677 (-) Ensembl GRCm38.p6 Ensembl 1 132,511,782 - 132,542,939 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000186487
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 132,439,516 - 132,470,628 (-) Ensembl GRCm38.p6 Ensembl 1 132,511,778 - 132,542,890 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000186530 ⟹ ENSMUSP00000139897
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 132,461,395 - 132,470,994 (-) Ensembl GRCm38.p6 Ensembl 1 132,533,657 - 132,543,256 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000188065 ⟹ ENSMUSP00000140306
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 132,437,165 - 132,451,131 (-) Ensembl GRCm38.p6 Ensembl 1 132,509,427 - 132,523,393 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000188143
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 132,444,739 - 132,446,895 (-) Ensembl GRCm38.p6 Ensembl 1 132,517,001 - 132,519,157 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000188943 ⟹ ENSMUSP00000139795
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 132,456,737 - 132,461,622 (-) Ensembl GRCm38.p6 Ensembl 1 132,528,999 - 132,533,884 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000189528 ⟹ ENSMUSP00000141179
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 132,437,165 - 132,443,375 (-) Ensembl GRCm38.p6 Ensembl 1 132,509,427 - 132,515,637 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000190601
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 132,439,530 - 132,470,603 (-) Ensembl GRCm38.p6 Ensembl 1 132,511,792 - 132,542,865 (-) Ensembl
RefSeq Acc Id:
NM_177129 ⟹ NP_796103
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 132,437,163 - 132,470,678 (-) NCBI GRCm38 1 132,509,425 - 132,542,940 (-) NCBI MGSCv37 1 134,406,002 - 134,439,517 (-) RGD Celera 1 135,118,092 - 135,152,003 (-) RGD cM Map 1 ENTREZGENE
Sequence:
AGTGAGCGGAGCCTGCGAGAGGGAGGAGCGCATCCTGATGCAGAGATGCTGCAGTGGCTCGGGGCGCGCACACACATACGCACCCTCGCCCGCTGCCGCCACGCCAGGACAGCCAGTGGCTAAGGCCG
hide sequence
RefSeq Acc Id:
XM_006529362 ⟹ XP_006529425
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 132,437,165 - 132,470,989 (-) NCBI GRCm38 1 132,509,427 - 132,543,251 (-) NCBI
Sequence:
GAGGCTTGCTGTGGATCCCATTCTCTAACAAGGGACTAGAGCGCCCCTCTGCAGCTTTGGGCTG
hide sequence
RefSeq Acc Id:
XR_878318
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 132,437,165 - 132,470,718 (-) NCBI GRCm38 1 132,509,427 - 132,542,984 (-) NCBI
Sequence:
CCATCTCCGGCCGAGCGTTGGCTGAGGAGCCGAGCCAGCCAGTGAGCGGAGCCTGCGAGAGGGA
hide sequence
RefSeq Acc Id:
NP_796103 ⟸ NM_177129
- Peptide Label:
precursor
- UniProtKB:
Q6NZJ4 (UniProtKB/Swiss-Prot), Q7TSJ5 (UniProtKB/Swiss-Prot), Q61330 (UniProtKB/Swiss-Prot), Q3UH39 (UniProtKB/TrEMBL)
- Sequence:
MGAPARKRASLLLLLLATMALVSSPGWSFSQGTPATFGPVFEEQPVGLLFPEESAEDQVTLACRARASPPATYRWKMNGTEMNLEPGSRHQLMGGNLVIMSPTKAQDAGVYQCLASNPVGTVVSKEAV
hide sequence
RefSeq Acc Id:
XP_006529425 ⟸ XM_006529362
- Peptide Label:
isoform X1
- UniProtKB:
Q6NZJ4 (UniProtKB/Swiss-Prot), Q7TSJ5 (UniProtKB/Swiss-Prot), Q61330 (UniProtKB/Swiss-Prot), Q3UH39 (UniProtKB/TrEMBL)
- Sequence:
MGAPARKRASLLLLLLATMALVSSPGWSFSQGTPATFGPVFEEQPVGLLFPEESAEDQVTLACR
hide sequence
Ensembl Acc Id:
ENSMUSP00000083707 ⟸ ENSMUST00000086521
Ensembl Acc Id:
ENSMUSP00000139897 ⟸ ENSMUST00000186530
Ensembl Acc Id:
ENSMUSP00000139795 ⟸ ENSMUST00000188943
Ensembl Acc Id:
ENSMUSP00000140306 ⟸ ENSMUST00000188065
Ensembl Acc Id:
ENSMUSP00000141179 ⟸ ENSMUST00000189528
RGD ID: 6874930 Promoter ID: EPDNEW_M916 Type: initiation region Name: Cntn2_1 Description: Mus musculus contactin 2 , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 1 132,542,871 - 132,542,931 EPDNEW
RGD ID: 6817529 Promoter ID: MM_KWN:2081 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Brain Transcripts: UC007CPC.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 1 134,419,691 - 134,420,191 (-) MPROMDB
RGD ID: 6848942 Promoter ID: MM_XEF:353 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Brain Transcripts: NM_001004395, NM_001131518, NM_131446, NM_180969 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 1 134,425,241 - 134,425,741 (-) MPROMDB
RGD ID: 6846587 Promoter ID: MM_ACW:2321 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Brain Transcripts: CNTN2.GSEP07 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 1 134,430,041 - 134,430,541 (-) MPROMDB
RGD ID: 6817528 Promoter ID: MM_KWN:2082 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Brain, ES_Cell Transcripts: ENSMUST00000086522, NM_177129, UC007CPB.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 1 134,439,204 - 134,439,704 (-) MPROMDB
