Symbol:
Npy1r
Name:
neuropeptide Y receptor Y1
RGD ID:
3198
Description:
Predicted to enable neuropeptide binding activity; pancreatic polypeptide receptor activity; and peptide YY receptor activity. Involved in several processes, including positive regulation of cholesterol biosynthetic process; regulation of presynaptic cytosolic calcium ion concentration; and regulation of secretion by cell. Located in axon and synaptic vesicle. Is active in glutamatergic synapse; neuronal dense core vesicle; and presynaptic membrane. Used to study absence epilepsy; anxiety disorder; depressive disorder; and hypertension. Biomarker of obesity. Human ortholog(s) of this gene implicated in amphetamine abuse; cocaine abuse; heroin dependence; nicotine dependence; and opiate dependence. Orthologous to human NPY1R (neuropeptide Y receptor Y1); INTERACTS WITH 17beta-estradiol; 1D-myo-inositol 1,4,5-trisphosphate; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
FC5; MGC109393; Neuropepetide Y1 Receptor; neuropeptide Y receptor type 1; neuropeptide Y1 receptor; NPY-1; NPY1-R
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 16 27,804,416 - 27,814,070 (-) NCBI GRCr8 mRatBN7.2 16 23,037,788 - 23,047,330 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 16 23,037,789 - 23,046,759 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 16 26,400,898 - 26,409,918 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 16 29,835,589 - 29,844,607 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 16 25,766,507 - 25,775,523 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 16 24,779,480 - 24,789,131 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 16 24,779,477 - 24,788,740 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 16 24,663,045 - 24,672,508 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 16 24,747,183 - 24,756,507 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 16 24,748,298 - 24,749,803 (-) NCBI Celera 16 23,162,089 - 23,171,059 (-) NCBI Celera Cytogenetic Map 16 p14 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Npy1r Rat 1,2-dichloroethane increases expression ISO Npy1r (Mus musculus) 6480464 ethylene dichloride results in increased expression of NPY1R mRNA CTD PMID:28189721 and PMID:28960355 Npy1r Rat 17alpha-ethynylestradiol affects expression ISO Npy1r (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of NPY1R mRNA CTD PMID:17555576 Npy1r Rat 17beta-estradiol multiple interactions ISO NPY1R (Homo sapiens) 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in decreased expression of NPY1R mRNA more ... CTD PMID:19146866 more ... Npy1r Rat 17beta-estradiol multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in increased expression of NPY1R mRNA CTD PMID:26496021 Npy1r Rat 17beta-estradiol increases expression ISO NPY1R (Homo sapiens) 6480464 Estradiol results in increased expression of NPY1R mRNA CTD PMID:19146866 more ... Npy1r Rat 1D-myo-inositol 1,4,5-trisphosphate affects abundance EXP 6480464 NPY1R protein affects the abundance of Inositol 1 more ... CTD PMID:7742479 Npy1r Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO NPY1R (Homo sapiens) 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in decreased expression of NPY1R mRNA and Cycloheximide inhibits the reaction [Tetrachlorodibenzodioxin results in decreased expression of NPY1R mRNA] CTD PMID:11007951 and PMID:19619570 Npy1r Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of NPY1R mRNA CTD PMID:33387578 Npy1r Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO NPY1R (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of NPY1R mRNA CTD PMID:11007951 more ... Npy1r Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Npy1r (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of NPY1R mRNA CTD PMID:19933214 Npy1r Rat 2,4,6-trinitrobenzenesulfonic acid increases expression EXP 6480464 Trinitrobenzenesulfonic Acid results in increased expression of NPY1R mRNA CTD PMID:23537331 Npy1r Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Npy1r (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Npy1r Rat 2-methyl-4-chlorophenoxybutyric acid multiple interactions EXP 6480464 [2-amino-3-chloro-1 and 4-naphthoquinone co-treated with Ziram co-treated with cyromazine co-treated with 2-methyl-4-chlorophenoxy gamma-butyric acid co-treated with pirimicarb co-treated with Thiram] results in increased expression of NPY1R mRNA CTD PMID:29321614 Npy1r Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of NPY1R mRNA CTD PMID:24780913 Npy1r Rat acrylamide increases expression ISO NPY1R (Homo sapiens) 6480464 Acrylamide results in increased expression of NPY1R mRNA CTD PMID:32763439 Npy1r Rat afimoxifene multiple interactions ISO NPY1R (Homo sapiens) 6480464 afimoxifene inhibits the reaction [Estrogens results in increased expression of NPY1R mRNA] CTD PMID:21233418 Npy1r Rat aflatoxin B1 affects expression ISO NPY1R (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of NPY1R protein CTD PMID:20106945 Npy1r Rat aflatoxin B1 decreases methylation ISO NPY1R (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of NPY1R gene CTD PMID:27153756 Npy1r Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of NPY1R mRNA CTD PMID:23630614 Npy1r Rat all-trans-retinoic acid increases expression ISO NPY1R (Homo sapiens) 6480464 Tretinoin results in increased expression of NPY1R mRNA CTD PMID:21934132 Npy1r Rat all-trans-retinol increases response to substance ISO Npy1r (Mus musculus) 6480464 NPY1R protein results in increased susceptibility to Vitamin A CTD PMID:17400914 Npy1r Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of NPY1R mRNA CTD PMID:35163327 Npy1r Rat ammonium acetate decreases expression EXP 6480464 ammonium acetate results in decreased expression of NPY1R mRNA CTD PMID:33404927 Npy1r Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of NPY1R mRNA CTD PMID:16483693 Npy1r Rat antirheumatic drug increases expression ISO NPY1R (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of NPY1R mRNA CTD PMID:24449571 Npy1r Rat aristolochic acid A decreases expression ISO NPY1R (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of NPY1R mRNA CTD PMID:33212167 Npy1r Rat arsenite(3-) increases expression ISO Npy1r (Mus musculus) 6480464 arsenite results in increased expression of NPY1R mRNA CTD PMID:33053406 Npy1r Rat Azoxymethane multiple interactions ISO Npy1r (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of NPY1R mRNA CTD PMID:29950665 Npy1r Rat benzo[a]pyrene increases expression ISO Npy1r (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of NPY1R mRNA CTD PMID:22228805 Npy1r Rat benzo[a]pyrene increases expression ISO NPY1R (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of NPY1R mRNA CTD PMID:32234424 Npy1r Rat benzo[a]pyrene increases methylation ISO NPY1R (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of NPY1R 5' UTR and Benzo(a)pyrene results in increased methylation of NPY1R promoter CTD PMID:27901495 Npy1r Rat benzo[a]pyrene multiple interactions ISO Npy1r (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of NPY1R mRNA CTD PMID:27858113 Npy1r Rat benzo[b]fluoranthene increases expression ISO Npy1r (Mus musculus) 6480464 benzo(b)fluoranthene results in increased expression of NPY1R mRNA CTD PMID:26377693 Npy1r Rat benzo[b]fluoranthene multiple interactions ISO Npy1r (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of NPY1R mRNA CTD PMID:27858113 Npy1r Rat bis(2-chloroethyl) sulfide increases expression ISO Npy1r (Mus musculus) 6480464 Mustard Gas results in increased expression of NPY1R mRNA CTD PMID:15674844 Npy1r Rat bis(2-ethylhexyl) phthalate decreases expression ISO NPY1R (Homo sapiens) 6480464 Diethylhexyl Phthalate results in decreased expression of NPY1R mRNA CTD PMID:31163220 Npy1r Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in increased expression of NPY1R mRNA and [bisphenol A co-treated with Genistein] results in increased methylation of NPY1R gene CTD PMID:26496021 and PMID:28505145 Npy1r Rat bisphenol A increases expression ISO NPY1R (Homo sapiens) 6480464 bisphenol A results in increased expression of NPY1R mRNA CTD PMID:36828454 Npy1r Rat bisphenol A decreases expression ISO NPY1R (Homo sapiens) 6480464 bisphenol A results in decreased expression of NPY1R mRNA CTD PMID:27685785 Npy1r Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of NPY1R mRNA CTD PMID:25181051 and PMID:34947998 Npy1r Rat bisphenol F increases expression ISO Npy1r (Mus musculus) 6480464 bisphenol F results in increased expression of NPY1R mRNA CTD PMID:30951980 Npy1r Rat cadmium atom multiple interactions ISO Npy1r (Mus musculus) 6480464 [Tetradecanoylphorbol Acetate co-treated with [Cadmium Chloride results in increased abundance of Cadmium]] affects the expression of NPY1R mRNA CTD PMID:31904401 Npy1r Rat cadmium dichloride decreases methylation EXP 6480464 Cadmium Chloride results in decreased methylation of NPY1R promoter CTD PMID:22457795 Npy1r Rat cadmium dichloride multiple interactions ISO Npy1r (Mus musculus) 6480464 [Tetradecanoylphorbol Acetate co-treated with [Cadmium Chloride results in increased abundance of Cadmium]] affects the expression of NPY1R mRNA CTD PMID:31904401 Npy1r Rat cantharidin increases expression ISO Npy1r (Mus musculus) 6480464 Cantharidin results in increased expression of NPY1R mRNA CTD PMID:36907384 Npy1r Rat capsaicin multiple interactions EXP 6480464 neuropeptide Y and Leu(31)-Pro(34)- inhibits the reaction [NPY1R protein results in increased susceptibility to Capsaicin] CTD PMID:16714086 Npy1r Rat capsaicin increases response to substance EXP 6480464 NPY1R protein results in increased susceptibility to Capsaicin CTD PMID:16714086 Npy1r Rat carbon nanotube decreases expression ISO Npy1r (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Npy1r Rat chrysene multiple interactions ISO Npy1r (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of NPY1R mRNA CTD PMID:27858113 Npy1r Rat coumestrol multiple interactions ISO NPY1R (Homo sapiens) 6480464 [Coumestrol co-treated with 2 more ... CTD PMID:18310284 and PMID:19167446 Npy1r Rat coumestrol increases expression ISO NPY1R (Homo sapiens) 6480464 Coumestrol results in increased expression of NPY1R mRNA CTD PMID:19167446 Npy1r Rat cycloheximide multiple interactions ISO NPY1R (Homo sapiens) 6480464 Cycloheximide inhibits the reaction [Tetrachlorodibenzodioxin results in decreased expression of NPY1R mRNA] CTD PMID:11007951 Npy1r Rat cyclosporin A decreases expression ISO NPY1R (Homo sapiens) 6480464 Cyclosporine results in decreased expression of NPY1R mRNA CTD PMID:20106945 Npy1r Rat cyromazine multiple interactions EXP 6480464 [2-amino-3-chloro-1 and 4-naphthoquinone co-treated with Ziram co-treated with cyromazine co-treated with 2-methyl-4-chlorophenoxy gamma-butyric acid co-treated with pirimicarb co-treated with Thiram] results in increased expression of NPY1R mRNA CTD PMID:29321614 Npy1r Rat DDE decreases expression ISO NPY1R (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of NPY1R mRNA CTD PMID:38568856 Npy1r Rat dexamethasone increases expression ISO Npy1r (Mus musculus) 6480464 Dexamethasone results in increased expression of NPY1R mRNA CTD PMID:22733784 Npy1r Rat dextran sulfate multiple interactions ISO Npy1r (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of NPY1R mRNA CTD PMID:29950665 Npy1r Rat Diallyl sulfide multiple interactions ISO NPY1R (Homo sapiens) 6480464 allyl sulfide inhibits the reaction [tobacco tar analog results in increased expression of NPY1R mRNA] CTD PMID:36758788 Npy1r Rat dibenz[a,h]anthracene increases expression ISO Npy1r (Mus musculus) 6480464 1 more ... CTD PMID:26377693 Npy1r Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of NPY1R mRNA CTD PMID:15620428 Npy1r Rat dioxygen increases expression ISO NPY1R (Homo sapiens) 6480464 Oxygen deficiency results in increased expression of NPY1R mRNA CTD PMID:25596134 Npy1r Rat dorsomorphin multiple interactions ISO NPY1R (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Npy1r Rat Enterolactone multiple interactions ISO NPY1R (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of NPY1R mRNA CTD PMID:19167446 Npy1r Rat epoxiconazole increases expression ISO Npy1r (Mus musculus) 6480464 epoxiconazole results in increased expression of NPY1R mRNA CTD PMID:35436446 Npy1r Rat ethanol decreases expression EXP 405096484 Ethanol decreases expression of Npy1r mRNA in hippocampus more ... RGD Npy1r Rat ethanol decreases expression EXP 405096485 Ethanol decreases expression of Npy1r mRNA in the central gray substance of midbrain RGD Npy1r Rat ethanol increases expression EXP 402463946 [Ethanol cotreated with restraint stress] increases expression of Npy1r protein in the amygdala RGD Npy1r Rat ethanol increases expression EXP 405096486 Ethanol increases expression of Npy1r mRNA in the hippocampus RGD Npy1r Rat fluoxetine affects expression EXP 6480464 Fluoxetine affects the expression of NPY1R mRNA CTD PMID:9729278 Npy1r Rat genistein multiple interactions EXP 6480464 [bisphenol A co-treated with Genistein] results in increased methylation of NPY1R gene CTD PMID:28505145 Npy1r Rat genistein increases expression ISO Npy1r (Mus musculus) 6480464 Genistein results in increased expression of NPY1R mRNA CTD PMID:32186404 Npy1r Rat ifosfamide increases expression ISO NPY1R (Homo sapiens) 6480464 Ifosfamide results in increased expression of NPY1R mRNA CTD PMID:25596134 Npy1r Rat ketamine decreases expression EXP 6480464 Ketamine results in decreased expression of NPY1R mRNA CTD PMID:20080153 Npy1r Rat lead diacetate increases expression EXP 6480464 lead acetate results in increased expression of NPY1R mRNA CTD PMID:11578147 Npy1r Rat medroxyprogesterone acetate multiple interactions ISO NPY1R (Homo sapiens) 6480464 Medroxyprogesterone Acetate inhibits the reaction [Estradiol results in increased expression of NPY1R mRNA] CTD PMID:19146866 Npy1r Rat medroxyprogesterone acetate decreases expression ISO NPY1R (Homo sapiens) 6480464 Medroxyprogesterone Acetate results in decreased expression of NPY1R mRNA CTD PMID:18497975 Npy1r Rat mercury dichloride increases expression EXP 6480464 Mercuric Chloride results in increased expression of NPY1R mRNA CTD PMID:16507785 Npy1r Rat methamphetamine increases response to substance ISO NPY1R (Homo sapiens) 6480464 NPY1R gene SNP results in increased susceptibility to Methamphetamine CTD PMID:19566775 Npy1r Rat methamphetamine affects expression ISO Npy1r (Mus musculus) 6480464 Methamphetamine affects the expression of NPY1R mRNA CTD PMID:15930374 Npy1r Rat methylmercury chloride decreases expression ISO NPY1R (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of NPY1R mRNA CTD PMID:28001369 Npy1r Rat morphine decreases expression ISO Npy1r (Mus musculus) 6480464 Morphine results in decreased expression of NPY1R mRNA CTD PMID:20144693 Npy1r Rat N-Nitrosopyrrolidine increases expression ISO NPY1R (Homo sapiens) 6480464 N-Nitrosopyrrolidine results in increased expression of NPY1R mRNA CTD PMID:32234424 Npy1r Rat nickel atom decreases expression ISO NPY1R (Homo sapiens) 6480464 Nickel results in decreased expression of NPY1R mRNA CTD PMID:24768652 and PMID:25583101 Npy1r Rat O-methyleugenol increases expression ISO NPY1R (Homo sapiens) 6480464 methyleugenol results in increased expression of NPY1R mRNA CTD PMID:32234424 Npy1r Rat panobinostat multiple interactions ISO NPY1R (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of NPY1R mRNA CTD PMID:27188386 Npy1r Rat panobinostat decreases expression ISO NPY1R (Homo sapiens) 6480464 panobinostat results in decreased expression of NPY1R mRNA CTD PMID:26272509 Npy1r Rat pentobarbital multiple interactions ISO Npy1r (Mus musculus) 6480464 NPY1R protein affects the reaction [NPY protein results in increased susceptibility to Pentobarbital] CTD PMID:11454027 Npy1r Rat pentobarbital increases response to substance ISO Npy1r (Mus musculus) 6480464 NPY1R protein results in increased susceptibility to Pentobarbital CTD PMID:11454027 Npy1r Rat perfluorohexanesulfonic acid increases expression ISO Npy1r (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of NPY1R mRNA CTD PMID:37995155 Npy1r Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of NPY1R mRNA CTD PMID:35163327 Npy1r Rat phenylmercury acetate decreases expression ISO NPY1R (Homo sapiens) 6480464 Phenylmercuric Acetate results in decreased expression of NPY1R mRNA CTD PMID:26272509 Npy1r Rat phenylmercury acetate multiple interactions ISO NPY1R (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of NPY1R mRNA CTD PMID:27188386 Npy1r Rat phenylpropanolamine affects response to substance EXP 6480464 NPY1R protein affects the susceptibility to Phenylpropanolamine CTD PMID:23052195 Npy1r Rat phenylpropanolamine multiple interactions EXP 6480464 NPY1R protein affects the reaction [Phenylpropanolamine results in decreased expression of NPY protein] CTD PMID:23052195 Npy1r Rat phenylpropanolamine increases expression EXP 6480464 Phenylpropanolamine results in increased expression of NPY1R protein CTD PMID:23052195 Npy1r Rat phorbol 13-acetate 12-myristate multiple interactions ISO Npy1r (Mus musculus) 6480464 [Tetradecanoylphorbol Acetate co-treated with [Cadmium Chloride results in increased abundance of Cadmium]] affects the expression of NPY1R mRNA CTD PMID:31904401 Npy1r Rat picrotoxin increases expression EXP 6480464 Picrotoxin results in increased expression of NPY1R mRNA CTD PMID:15170462 Npy1r Rat pioglitazone multiple interactions ISO Npy1r (Mus musculus) 6480464 [N-nitroso-tris-chloroethylurea co-treated with pioglitazone] results in decreased expression of NPY1R mRNA CTD PMID:27935865 Npy1r Rat pirimicarb multiple interactions EXP 6480464 [2-amino-3-chloro-1 and 4-naphthoquinone co-treated with Ziram co-treated with cyromazine co-treated with 2-methyl-4-chlorophenoxy gamma-butyric acid co-treated with pirimicarb co-treated with Thiram] results in increased expression of NPY1R mRNA CTD PMID:29321614 Npy1r Rat progesterone increases expression ISO NPY1R (Homo sapiens) 6480464 Progesterone results in increased expression of NPY1R mRNA CTD PMID:18070364 Npy1r Rat raloxifene multiple interactions ISO NPY1R (Homo sapiens) 6480464 Raloxifene Hydrochloride inhibits the reaction [Estradiol results in increased expression of NPY1R mRNA] CTD PMID:21185374 Npy1r Rat resveratrol multiple interactions ISO NPY1R (Homo sapiens) 6480464 [Coumestrol co-treated with resveratrol] results in increased expression of NPY1R mRNA CTD PMID:19167446 Npy1r Rat SB 431542 multiple interactions ISO NPY1R (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Npy1r Rat silicon dioxide decreases expression ISO NPY1R (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of NPY1R mRNA CTD PMID:25895662 Npy1r Rat sodium arsenite increases expression ISO NPY1R (Homo sapiens) 6480464 sodium arsenite results in increased expression of NPY1R mRNA CTD PMID:35954277 and PMID:38568856 Npy1r Rat tamoxifen affects expression ISO Npy1r (Mus musculus) 6480464 Tamoxifen affects the expression of NPY1R mRNA CTD PMID:17555576 Npy1r Rat testosterone decreases expression ISO NPY1R (Homo sapiens) 6480464 Testosterone results in decreased expression of NPY1R mRNA CTD PMID:33359661 Npy1r Rat tetrachloromethane affects expression EXP 6480464 Carbon Tetrachloride affects the expression of NPY1R mRNA CTD PMID:12734012 Npy1r Rat tetraphene multiple interactions ISO Npy1r (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of NPY1R mRNA CTD PMID:27858113 Npy1r Rat thiram multiple interactions EXP 6480464 [2-amino-3-chloro-1 and 4-naphthoquinone co-treated with Ziram co-treated with cyromazine co-treated with 2-methyl-4-chlorophenoxy gamma-butyric acid co-treated with pirimicarb co-treated with Thiram] results in increased expression of NPY1R mRNA CTD PMID:29321614 Npy1r Rat thiram increases expression ISO NPY1R (Homo sapiens) 6480464 Thiram results in increased expression of NPY1R mRNA CTD PMID:38568856 Npy1r Rat titanium dioxide multiple interactions ISO Npy1r (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of NPY1R mRNA CTD PMID:29950665 Npy1r Rat tribromoethanol increases response to substance ISO Npy1r (Mus musculus) 6480464 NPY1R protein results in increased susceptibility to tribromoethanol CTD PMID:11454027 Npy1r Rat trichostatin A increases expression ISO NPY1R (Homo sapiens) 6480464 trichostatin A results in increased expression of NPY1R mRNA CTD PMID:24935251 Npy1r Rat trichostatin A decreases expression ISO NPY1R (Homo sapiens) 6480464 trichostatin A results in decreased expression of NPY1R mRNA CTD PMID:24935251 Npy1r Rat trifluoroacetic acid multiple interactions EXP 6480464 Trifluoroacetic Acid binds to and results in decreased activity of NPY1R protein CTD PMID:16714086 Npy1r Rat triptonide decreases expression ISO Npy1r (Mus musculus) 6480464 triptonide results in decreased expression of NPY1R mRNA CTD PMID:33045310 Npy1r Rat valproic acid increases expression ISO Npy1r (Mus musculus) 6480464 Valproic Acid results in increased expression of NPY1R mRNA CTD PMID:19136453 Npy1r Rat valproic acid affects expression ISO NPY1R (Homo sapiens) 6480464 Valproic Acid affects the expression of NPY1R mRNA CTD PMID:25979313 Npy1r Rat valproic acid increases expression ISO NPY1R (Homo sapiens) 6480464 Valproic Acid results in increased expression of NPY1R mRNA CTD PMID:23179753 more ... Npy1r Rat valproic acid multiple interactions ISO NPY1R (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of NPY1R mRNA CTD PMID:27188386 Npy1r Rat zearalenone increases expression ISO NPY1R (Homo sapiens) 6480464 Zearalenone results in increased expression of NPY1R mRNA CTD PMID:36828454 Npy1r Rat ziram multiple interactions EXP 6480464 [2-amino-3-chloro-1 and 4-naphthoquinone co-treated with Ziram co-treated with cyromazine co-treated with 2-methyl-4-chlorophenoxy gamma-butyric acid co-treated with pirimicarb co-treated with Thiram] results in increased expression of NPY1R mRNA CTD PMID:29321614
1,2-dichloroethane (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 1D-myo-inositol 1,4,5-trisphosphate (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-trinitrobenzenesulfonic acid (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2-methyl-4-chlorophenoxybutyric acid (EXP) 6-propyl-2-thiouracil (EXP) acrylamide (ISO) afimoxifene (ISO) aflatoxin B1 (EXP,ISO) all-trans-retinoic acid (ISO) all-trans-retinol (ISO) alpha-Zearalanol (EXP) ammonium acetate (EXP) ammonium chloride (EXP) antirheumatic drug (ISO) aristolochic acid A (ISO) arsenite(3-) (ISO) Azoxymethane (ISO) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) bis(2-chloroethyl) sulfide (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) cadmium atom (ISO) cadmium dichloride (EXP,ISO) cantharidin (ISO) capsaicin (EXP) carbon nanotube (ISO) chrysene (ISO) coumestrol (ISO) cycloheximide (ISO) cyclosporin A (ISO) cyromazine (EXP) DDE (ISO) dexamethasone (ISO) dextran sulfate (ISO) Diallyl sulfide (ISO) dibenz[a,h]anthracene (ISO) dibutyl phthalate (EXP) dioxygen (ISO) dorsomorphin (ISO) Enterolactone (ISO) epoxiconazole (ISO) ethanol (EXP) fluoxetine (EXP) genistein (EXP,ISO) ifosfamide (ISO) ketamine (EXP) lead diacetate (EXP) medroxyprogesterone acetate (ISO) mercury dichloride (EXP) methamphetamine (ISO) methylmercury chloride (ISO) morphine (ISO) N-Nitrosopyrrolidine (ISO) nickel atom (ISO) O-methyleugenol (ISO) panobinostat (ISO) pentobarbital (ISO) perfluorohexanesulfonic acid (ISO) perfluorooctanoic acid (EXP) phenylmercury acetate (ISO) phenylpropanolamine (EXP) phorbol 13-acetate 12-myristate (ISO) picrotoxin (EXP) pioglitazone (ISO) pirimicarb (EXP) progesterone (ISO) raloxifene (ISO) resveratrol (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (ISO) tamoxifen (ISO) testosterone (ISO) tetrachloromethane (EXP) tetraphene (ISO) thiram (EXP,ISO) titanium dioxide (ISO) tribromoethanol (ISO) trichostatin A (ISO) trifluoroacetic acid (EXP) triptonide (ISO) valproic acid (ISO) zearalenone (ISO) ziram (EXP)
1.
NPY modulates epinephrine-induced leukocytosis via Y-1 and Y-5 receptor activation in vivo: sympathetic co-transmission during leukocyte mobilization.
Bedoui S, etal., J Neuroimmunol 2002 Nov;132(1-2):25-33.
2.
The antidepressant effects of running and escitalopram are associated with levels of hippocampal NPY and Y1 receptor but not cell proliferation in a rat model of depression.
Bjornebekk A, etal., Hippocampus. 2010 Jul;20(7):820-8. doi: 10.1002/hipo.20683.
3.
The effect of cardiac ischemic preconditioning on rat left ventricular gene expression profile.
Canatan H Cell Biochem Funct. 2007 Jun 11;.
4.
Alteration of NPY and Y1 receptor in dorsomedial and ventromedial areas of hypothalamus in anorectic tumor-bearing rats.
Chance WT, etal., Peptides. 2007 Feb;28(2):295-301. Epub 2007 Jan 17.
5.
NPY stimulates cholesterol synthesis acutely by activating the SREBP2-HMGCR pathway through the Y1 and Y5 receptors in murine hepatocytes.
Chen F, etal., Life Sci. 2020 Dec 1;262:118478. doi: 10.1016/j.lfs.2020.118478. Epub 2020 Sep 22.
6.
Neuropeptide Y-Y1 receptor antisense oligodeoxynucleotide increases the infarct volume after middle cerebral artery occlusion in rats.
Cheung RT and Cechetto DF, Neuroscience. 2000;98(4):771-7.
7.
Expression of neuropeptide Y and its receptors Y1 and Y2 in the rat heart and its supplying autonomic and spinal sensory ganglia in experimentally induced diabetes.
Chottova Dvorakova M, etal., Neuroscience. 2008 Feb 19;151(4):1016-28. doi: 10.1016/j.neuroscience.2007.07.069. Epub 2007 Dec 8.
8.
Molecular cloning of a novel G protein-coupled receptor that may belong to the neuropeptide receptor family.
Eva C, etal., FEBS Lett 1990 Oct 1;271(1-2):81-4.
9.
Neuropeptide Y1 and Y5 receptors mediate the effects of neuropeptide Y on the hypothalamic-pituitary-thyroid axis.
Fekete C, etal., Endocrinology 2002 Dec;143(12):4513-9.
10.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
11.
Neuropeptide Y inhibits capsaicin-sensitive nociceptors via a Y1-receptor-mediated mechanism.
Gibbs J, etal., Neuroscience. 2004;125(3):703-9.
12.
Neuropeptide Y modulates effects of bradykinin and prostaglandin E2 on trigeminal nociceptors via activation of the Y1 and Y2 receptors.
Gibbs JL, etal., Br J Pharmacol. 2007 Jan;150(1):72-9. Epub 2006 Dec 4.
13.
Ultrastructural localization of neuropeptide Y Y1 receptors in the rat medial nucleus tractus solitarius: relationships with neuropeptide Y or catecholamine neurons.
Glass MJ, etal., J Neurosci Res. 2002 Mar 15;67(6):753-65.
14.
Physiological role of neuropeptide Y in the regulation of the ascending phase of the peristaltic reflex.
Grider JR and Langdon LE, Am J Physiol Gastrointest Liver Physiol. 2003 Dec;285(6):G1139-46. Epub 2003 Aug 14.
15.
Estrogen Induces Neuropeptide Y (NPY) Y1 receptor gene expression and responsiveness to NPY in gonadotrope-enriched pituitary cell cultures.
Hill JW, etal., Endocrinology. 2004 May;145(5):2283-90. Epub 2004 Jan 15.
16.
Neuropeptide y and neuropeptide y y5 receptor interaction restores impaired growth potential of aging bone marrow stromal cells.
Igura K, etal., Rejuvenation Res. 2011 Aug;14(4):393-403. doi: 10.1089/rej.2010.1129. Epub 2011 May 19.
17.
Infusion of neuropeptide Y into CA3 region of hippocampus produces antidepressant-like effect via Y1 receptor.
Ishida H, etal., Hippocampus. 2007;17(4):271-80.
18.
Electroconvulsive stimuli selectively affect behavior and neuropeptide Y (NPY) and NPY Y(1) receptor gene expressions in hippocampus and hypothalamus of Flinders Sensitive Line rat model of depression.
Jiménez-Vasquez PA, etal., Eur Neuropsychopharmacol. 2007 Mar;17(4):298-308. doi: 10.1016/j.euroneuro.2006.06.011. Epub 2006 Aug 9.
19.
Differential regulation of mRNAs for neuropeptide Y and its receptor subtypes in widespread areas of the rat limbic system during kindling epileptogenesis.
Kopp J, etal., Brain Res Mol Brain Res. 1999 Sep 8;72(1):17-29.
20.
Obesity and mild hyperinsulinemia found in neuropeptide Y-Y1 receptor-deficient mice.
Kushi A, etal., Proc Natl Acad Sci U S A. 1998 Dec 22;95(26):15659-64.
21.
Genetic variations in genes of the stress response pathway are associated with prolonged abstinence from heroin.
Levran O, etal., Pharmacogenomics. 2018 Mar;19(4):333-341. doi: 10.2217/pgs-2017-0179. Epub 2018 Feb 21.
22.
A 3' UTR SNP rs885863, a cis-eQTL for the circadian gene VIPR2 and lincRNA 689, is associated with opioid addiction.
Levran O, etal., PLoS One. 2019 Nov 5;14(11):e0224399. doi: 10.1371/journal.pone.0224399. eCollection 2019.
23.
Stress-related genes and heroin addiction: a role for a functional FKBP5 haplotype.
Levran O, etal., Psychoneuroendocrinology. 2014 Jul;45:67-76. doi: 10.1016/j.psyneuen.2014.03.017. Epub 2014 Apr 6.
24.
Of mice and men: neuropeptide Y and its receptors are associated with atherosclerotic lesion burden and vulnerability.
Li L, etal., J Cardiovasc Transl Res. 2011 Jun;4(3):351-62. doi: 10.1007/s12265-011-9271-5. Epub 2011 Apr 6.
25.
Gene Expression Changes in Glutamate and GABA-A Receptors, Neuropeptides, Ion Channels, and Cholesterol Synthesis in the Periaqueductal Gray Following Binge-Like Alcohol Drinking by Adolescent Alcohol-Preferring (P) Rats.
McClintick JN, etal., Alcohol Clin Exp Res. 2016 May;40(5):955-68. doi: 10.1111/acer.13056. Epub 2016 Apr 8.
26.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
27.
Central neuropeptide Y signaling ameliorates N(omega)-nitro-L-arginine methyl ester hypertension in the rat through a Y1 receptor mechanism.
Michalkiewicz M, etal., Hypertension 2005 Apr;45(4):780-5. Epub 2005 Feb 7.
28.
Role of neuropeptide Y Y(1) and Y(2) receptors on behavioral despair in a rat model of depression with co-morbid anxiety.
Morales-Medina JC, etal., Neuropharmacology. 2012 Jan;62(1):200-8. doi: 10.1016/j.neuropharm.2011.06.030. Epub 2011 Jul 23.
29.
Neuropeptide Y suppresses absence seizures in a genetic rat model primarily through effects on Y receptors.
Morris MJ, etal., Eur J Neurosci. 2007 Feb;25(4):1136-43.
30.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
31.
The neuropeptide Y receptors, Y1 and Y2, are transiently and differentially expressed in the developing cerebellum.
Neveu I, etal., Neuroscience 2002;113(4):767-77.
32.
Association between neuropeptide Y gene and its receptor Y1 gene and methamphetamine dependence.
Okahisa Y, etal., Psychiatry Clin Neurosci. 2009 Jun;63(3):417-22. doi: 10.1111/j.1440-1819.2009.01961.x.
33.
Gene expression in the neuropeptide Y system during ethanol withdrawal kindling in rats.
Olling JD, etal., Alcohol Clin Exp Res. 2010 Mar 1;34(3):462-70. doi: 10.1111/j.1530-0277.2009.01110.x. Epub 2009 Dec 17.
34.
Complex plastic changes in the neuropeptide Y system during ethanol intoxication and withdrawal in the rat brain.
Olling JD, etal., J Neurosci Res. 2009 Aug 1;87(10):2386-97. doi: 10.1002/jnr.22049.
35.
Polymorphisms in Stress-Related Genes Are Associated with Reduced Cocaine Abuse and Longer Retention in Methadone Maintenance Treatment for Opioid Use Disorder.
Peles E, etal., Eur Addict Res. 2021;27(3):198-205. doi: 10.1159/000511898. Epub 2020 Nov 26.
36.
An immunohistochemical marker for Wallerian degeneration of fibers in the central and peripheral nervous system.
Pesini P, etal., Brain Res. 1999 May 15;828(1-2):41-59.
37.
Characterization of NPY receptors mediating contraction in rat intramyocardial coronary arteries.
Prieto D, etal., Regul Pept. 1998 Sep 25;75-76:155-60.
38.
Further evidence for the association of GAL, GALR1 and NPY1R variants with opioid dependence.
Randesi M, etal., Pharmacogenomics. 2020 Aug;21(13):903-917. doi: 10.2217/pgs-2020-0045. Epub 2020 Aug 6.
39.
GOA pipeline
RGD automated data pipeline
40.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
41.
Comprehensive gene review and curation
RGD comprehensive gene curation
42.
Medial prefrontal cortex neuropeptide Y modulates binge-like ethanol consumption in C57BL/6J mice.
Robinson SL, etal., Neuropsychopharmacology. 2019 May;44(6):1132-1140. doi: 10.1038/s41386-018-0310-7. Epub 2019 Jan 7.
43.
Impact of intermittent voluntary ethanol consumption during adolescence on the expression of endocannabinoid system and neuroinflammatory mediators.
Sanchez-Marin L, etal., Eur Neuropsychopharmacol. 2020 Apr;33:126-138. doi: 10.1016/j.euroneuro.2020.01.012. Epub 2020 Feb 10.
44.
Neuropeptide Y Y1 receptors mediate morphine-induced reductions of natural killer cell activity.
Saurer TB, etal., J Neuroimmunol. 2006 Aug;177(1-2):18-26. doi: 10.1016/j.jneuroim.2006.05.002.
45.
Modulation of intracellular calcium changes and glutamate release by neuropeptide Y1 and Y2 receptors in the rat hippocampus: differential effects in CA1, CA3 and dentate gyrus.
Silva AP, etal., J Neurochem. 2001 Oct;79(2):286-96. doi: 10.1046/j.1471-4159.2001.00560.x.
46.
Antisense mRNA for NPY-Y1 receptor in the medial preoptic area increases prolactin secretion.
Silveira NA and Franci CR, Braz J Med Biol Res. 1999 Sep;32(9):1161-5.
47.
Differential roles for neuropeptide Y Y1 and Y5 receptors in anxiety and sedation.
Sorensen G, etal., J Neurosci Res. 2004 Sep 1;77(5):723-9.
48.
Central neuropeptide Y modulates binge-like ethanol drinking in C57BL/6J mice via Y1 and Y2 receptors.
Sparrow AM, etal., Neuropsychopharmacology. 2012 May;37(6):1409-21. doi: 10.1038/npp.2011.327. Epub 2012 Jan 4.
49.
Acute stress and alcohol exposure during adolescence result in an anxious phenotype in adulthood: Role of altered glutamate/endocannabinoid transmission mechanisms.
Sánchez-Marín L, etal., Prog Neuropsychopharmacol Biol Psychiatry. 2022 Mar 8;113:110460. doi: 10.1016/j.pnpbp.2021.110460. Epub 2021 Oct 22.
50.
Ultrastructural Characterization of Corticotropin-Releasing Factor and Neuropeptide Y in the Rat Locus Coeruleus: Anatomical Evidence for Putative Interactions.
Theisen CC, etal., Neuroscience. 2018 Aug 1;384:21-40. doi: 10.1016/j.neuroscience.2018.04.043. Epub 2018 May 22.
51.
Influence of dehydration on the expression of neuropeptide Y Y1 receptors in hypothalamic magnocellular neurons.
Urban JH, etal., Endocrinology. 2006 Sep;147(9):4122-31. Epub 2006 May 25.
52.
Overexpression of NPY and Y2 receptors in epileptic brain tissue: an endogenous neuroprotective mechanism in temporal lobe epilepsy?
Vezzani A and Sperk G, Neuropeptides. 2004 Aug;38(4):245-52.
53.
Difference of NPY and its receptor gene expressions between obesity and obesity-resistant rats in response to high-fat diet.
Wang C, etal., Horm Metab Res. 2007 Apr;39(4):262-7.
54.
Activation of neuropeptide Y Y1 receptors inhibits glutamate release through reduction of voltage-dependent Ca2+ entry in the rat cerebral cortex nerve terminals: suppression of this inhibitory effect by the protein kinase C-dependent facilitatory pathway.
Wang SJ, Neuroscience. 2005;134(3):987-1000. doi: 10.1016/j.neuroscience.2005.04.053.
55.
Association study of 45 candidate genes in nicotine dependence in Han Chinese.
Wei J, etal., Addict Behav. 2012 May;37(5):622-6. doi: 10.1016/j.addbeh.2012.01.009. Epub 2012 Jan 18.
Npy1r Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 16 27,804,416 - 27,814,070 (-) NCBI GRCr8 mRatBN7.2 16 23,037,788 - 23,047,330 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 16 23,037,789 - 23,046,759 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 16 26,400,898 - 26,409,918 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 16 29,835,589 - 29,844,607 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 16 25,766,507 - 25,775,523 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 16 24,779,480 - 24,789,131 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 16 24,779,477 - 24,788,740 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 16 24,663,045 - 24,672,508 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 16 24,747,183 - 24,756,507 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 16 24,748,298 - 24,749,803 (-) NCBI Celera 16 23,162,089 - 23,171,059 (-) NCBI Celera Cytogenetic Map 16 p14 NCBI
NPY1R Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 4 163,323,962 - 163,344,689 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 4 163,323,962 - 163,344,832 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 4 164,245,114 - 164,253,748 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 4 164,464,567 - 164,473,198 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 4 164,602,721 - 164,611,353 NCBI Celera 4 161,577,336 - 161,585,966 (-) NCBI Celera Cytogenetic Map 4 q32.2 NCBI HuRef 4 159,999,060 - 160,008,005 (-) NCBI HuRef CHM1_1 4 164,221,563 - 164,230,393 (-) NCBI CHM1_1 T2T-CHM13v2.0 4 166,671,793 - 166,692,717 (-) NCBI T2T-CHM13v2.0
Npy1r Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 67,149,595 - 67,159,452 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 67,149,844 - 67,159,444 (+) Ensembl GRCm39 Ensembl GRCm38 8 66,697,149 - 66,706,800 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 66,697,192 - 66,706,792 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 69,221,321 - 69,230,697 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 69,632,837 - 69,635,097 (+) NCBI MGSCv36 mm8 Celera 8 69,251,576 - 69,260,940 (+) NCBI Celera Cytogenetic Map 8 B3.1 NCBI cM Map 8 33.15 NCBI
Npy1r Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955403 41,681,728 - 41,694,020 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955403 41,681,834 - 41,693,094 (+) NCBI ChiLan1.0 ChiLan1.0
NPY1R Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 3 161,132,638 - 161,153,546 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 4 161,495,180 - 161,516,073 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 4 155,583,870 - 155,604,336 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 4 167,372,306 - 167,392,716 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 4 167,372,310 - 167,381,597 (-) Ensembl panpan1.1 panPan2
NPY1R Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 15 59,580,546 - 59,587,753 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 15 59,580,809 - 59,583,237 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 15 59,946,494 - 59,947,746 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 15 60,338,999 - 60,348,168 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 15 60,339,001 - 60,348,197 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 15 59,574,468 - 59,575,720 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 15 59,665,153 - 59,666,405 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 15 60,034,141 - 60,035,393 (-) NCBI UU_Cfam_GSD_1.0
Npy1r Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404943 16,293,825 - 16,314,919 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936555 2,267,669 - 2,276,778 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936555 2,267,727 - 2,276,673 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
NPY1R Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 8 52,152,646 - 52,162,328 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 8 52,152,649 - 52,163,080 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 8 55,280,107 - 55,290,551 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
NPY1R Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 7 109,774,700 - 109,794,543 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 7 109,774,918 - 109,776,905 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 89,580,043 - 89,600,565 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Npy1r
.
Predicted Target Of
Count of predictions: 402 Count of miRNA genes: 218 Interacting mature miRNAs: 258 Transcripts: ENSRNOT00000018952 Prediction methods: Microtar, Miranda Result types: miRGate_prediction
631561 Hcuc2 Hepatic copper content QTL 2 2.8 liver copper amount (VT:0003065) liver total copper weight (CMO:0001507) 16 1 39533949 Rat 1582235 Insul8 Insulin level QTL 8 3.3 0.0063 blood insulin amount (VT:0001560) calculated serum insulin level (CMO:0000359) 16 1 26727669 Rat 70215 Niddm29 Non-insulin dependent diabetes mellitus QTL 29 3.54 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 16 19004435 75226532 Rat 2307172 Activ4 Activity QTL 4 3.71 0.00023 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 16 1 33418960 Rat 2302057 Pia29 Pristane induced arthritis QTL 29 3.6 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111) 16 21735975 66735975 Rat 1354584 Despr6 Despair related QTL 6 3.1 0.0067 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 16 1 39533930 Rat 2302380 Slep6 Serum leptin concentration QTL 6 3.36 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 16 1 32139025 Rat 737819 Hcas4 Hepatocarcinoma susceptibility QTL 4 4.43 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 16 4227609 46975965 Rat 9590151 Scort8 Serum corticosterone level QTL 8 8.45 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 16 1 30836262 Rat 1354625 Despr7 Despair related QTL 7 3.16 0.016 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 16 1 44977551 Rat 61338 Bp23 Blood pressure QTL 23 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 16 4227609 49227609 Rat 61405 Niddm6 Non-insulin dependent diabetes mellitus QTL 6 3.66 0.001 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 16 4227609 48972724 Rat 631830 Alc7 Alcohol consumption QTL 7 2.9 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 16 1 26727669 Rat 7411664 Foco30 Food consumption QTL 30 11 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 16 1 44588133 Rat 1600378 Arunc4 Aerobic running capacity QTL 4 0.03 exercise endurance trait (VT:0002332) maximum distance run on treadmill (CMO:0001406) 16 380245 80345693 Rat 70183 BpQTLcluster13 Blood pressure QTL cluster 13 3.654 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 16 4227609 43025077 Rat 737826 Alc11 Alcohol consumption QTL 11 3.2 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 16 4227609 60252231 Rat 2303566 Bw90 Body weight QTL 90 2 body mass (VT:0001259) body weight (CMO:0000012) 16 1 39533930 Rat 2312663 Slep9 Serum leptin concentration QTL 9 0.001 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 16 832236 59492508 Rat 2306902 Bp339 Blood pressure QTL 339 0.01 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 16 3380150 43025077 Rat 2312660 Bw95 Body weight QTL 95 0.05 inguinal fat pad mass (VT:0010424) inguinal fat pad weight to body weight ratio (CMO:0001253) 16 832236 59492508 Rat 2312666 Insul16 Insulin level QTL 16 0.01 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 16 832236 59492508 Rat 634355 Rends4 Renal damage susceptibility QTL 4 0.05 kidney blood vessel morphology trait (VT:0000530) organ lesion measurement (CMO:0000677) 16 1 26727669 Rat 70205 Gcr3 Gastric cancer resistance QTL 3 2.3 stomach morphology trait (VT:0000470) stomach tumor diameter (CMO:0001889) 16 17696791 82635055 Rat 2293343 Glom16 Glomerulus QTL 16 7.4 kidney glomerulus integrity trait (VT:0010546) kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269) 16 832236 46053497 Rat 6903319 Bw114 Body weight QTL 114 2.7 0.0037 body mass (VT:0001259) body weight (CMO:0000012) 16 1 43534949 Rat 2312669 Stl23 Serum triglyceride level QTL 23 0.01 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 16 832236 59492508 Rat
UniSTS:256984
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 16 23,039,172 - 23,039,540 (+) MAPPER mRatBN7.2 Rnor_6.0 16 24,780,864 - 24,781,231 NCBI Rnor6.0 Rnor_5.0 16 24,664,429 - 24,664,796 UniSTS Rnor5.0 RGSC_v3.4 16 24,748,567 - 24,748,934 UniSTS RGSC3.4 Celera 16 23,163,473 - 23,163,840 UniSTS Cytogenetic Map 16 p14 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
43
109
62
61
30
25
30
6
183
91
89
45
58
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000018952 ⟹ ENSRNOP00000018952
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 16 23,037,789 - 23,046,759 (-) Ensembl Rnor_6.0 Ensembl 16 24,779,477 - 24,788,740 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000079412 ⟹ ENSRNOP00000068980
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 16 23,037,790 - 23,046,759 (-) Ensembl Rnor_6.0 Ensembl 16 24,779,481 - 24,788,456 (-) Ensembl
RefSeq Acc Id:
NM_001113357 ⟹ NP_001106828
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 27,804,416 - 27,813,387 (-) NCBI mRatBN7.2 16 23,037,789 - 23,046,759 (-) NCBI Rnor_6.0 16 24,779,480 - 24,788,456 (-) NCBI Rnor_5.0 16 24,663,045 - 24,672,508 (-) NCBI RGSC_v3.4 16 24,747,183 - 24,756,507 (-) RGD Celera 16 23,162,089 - 23,171,059 (-) RGD
Sequence:
GGCGAACAGACGGATTCTTTAAAAGAGTATTCAGTTCAAGGGAACGAAGAATTGAGAATTATTTTTGGTGAATGGATTCAAATAAATGGAATAAGAGACAGCTGAAGATCTGATCCATTTCGAAGAAC
hide sequence
RefSeq Acc Id:
XM_006253024 ⟹ XP_006253086
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 27,804,416 - 27,814,070 (-) NCBI mRatBN7.2 16 23,037,788 - 23,047,330 (-) NCBI Rnor_6.0 16 24,779,480 - 24,789,131 (-) NCBI Rnor_5.0 16 24,663,045 - 24,672,508 (-) NCBI
Sequence:
AAATCTGACTCAAATGCATTTTCTTAGTGAGGAGGAAAAAGGCTCAAAGGCTCTCAACGGAGAT
hide sequence
RefSeq Acc Id:
XM_006253025 ⟹ XP_006253087
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 27,804,416 - 27,814,070 (-) NCBI mRatBN7.2 16 23,037,788 - 23,047,330 (-) NCBI Rnor_6.0 16 24,779,480 - 24,789,131 (-) NCBI Rnor_5.0 16 24,663,045 - 24,672,508 (-) NCBI
Sequence:
AAATCTGACTCAAATGCATTTTCTTAGTGAGGAGGAAAAAGGCTCAAAGGCTCTCAACGGAGAT
hide sequence
RefSeq Acc Id:
XM_063275269 ⟹ XP_063131339
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 27,804,416 - 27,814,066 (-) NCBI
RefSeq Acc Id:
NP_001106828 ⟸ NM_001113357
- UniProtKB:
P21555 (UniProtKB/Swiss-Prot), G3V7T1 (UniProtKB/TrEMBL), A6KFL5 (UniProtKB/TrEMBL)
- Sequence:
MNSTLFSRVENYSVHYNVSENSPFLAFENDDCHLPLAVIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAVMCLPFTFVYTLMDHWVFGETMCKLNPFVQCVSITVSIF
hide sequence
RefSeq Acc Id:
XP_006253087 ⟸ XM_006253025
- Peptide Label:
isoform X1
- UniProtKB:
P21555 (UniProtKB/Swiss-Prot), G3V7T1 (UniProtKB/TrEMBL), A6KFL5 (UniProtKB/TrEMBL)
- Sequence:
MNSTLFSRVENYSVHYNVSENSPFLAFENDDCHLPLAVIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAVMCLPFTFVYTLMDHWVFGETMCKLNPFVQCVSITVSIF
hide sequence
RefSeq Acc Id:
XP_006253086 ⟸ XM_006253024
- Peptide Label:
isoform X1
- UniProtKB:
P21555 (UniProtKB/Swiss-Prot), G3V7T1 (UniProtKB/TrEMBL), A6KFL5 (UniProtKB/TrEMBL)
- Sequence:
MNSTLFSRVENYSVHYNVSENSPFLAFENDDCHLPLAVIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAVMCLPFTFVYTLMDHWVFGETMCKLNPFVQCVSITVSIF
hide sequence
Ensembl Acc Id:
ENSRNOP00000068980 ⟸ ENSRNOT00000079412
Ensembl Acc Id:
ENSRNOP00000018952 ⟸ ENSRNOT00000018952
RefSeq Acc Id:
XP_063131339 ⟸ XM_063275269
- Peptide Label:
isoform X2
- UniProtKB:
Q5FVH5 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-11-06
Npy1r
neuropeptide Y receptor Y1
neuropeptide Y1 receptor
Name updated
625702 APPROVED
2002-06-10
Npy1r
neuropeptide Y1 receptor
Name updated
70584 APPROVED
Note Type
Note
Reference
gene_expression
expressed in thalamus, cerebral cortex and hippocampus
69907
