Symbol:
Kcnj3
Name:
potassium inwardly-rectifying channel, subfamily J, member 3
RGD ID:
2958
Description:
Enables G-protein activated inward rectifier potassium channel activity; phosphatidylinositol-4,5-bisphosphate binding activity; and voltage-gated monoatomic ion channel activity involved in regulation of presynaptic membrane potential. Contributes to inward rectifier potassium channel activity. Involved in response to electrical stimulus. Located in T-tubule and external side of plasma membrane. Orthologous to human KCNJ3 (potassium inwardly rectifying channel subfamily J member 3); PARTICIPATES IN acebutolol pharmacodynamics pathway; adrenergic beta receptor agonist and beta-blocker pharmacodynamics pathway; amiodarone pharmacodynamics pathway; INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
G protein-activated inward rectifier potassium channel 1; GIRK-1; GIRK1; inward rectifier K(+) channel Kir3.1; KGA; KGB1; potassium channel inwarding rectifying channel subfamily J member 3; potassium channel subunit Kir3.1 type 3 delta; potassium channel, inwardly rectifying subfamily J member 3; potassium channel, inwardly rectifying subfamily J, member 3; potassium inwardly-rectifying channel subfamily J member 3; potassium voltage-gated channel subfamily J member 3
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
KCNJ3 (potassium inwardly rectifying channel subfamily J member 3) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Kcnj3 (potassium inwardly-rectifying channel, subfamily J, member 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Kcnj3 (potassium inwardly rectifying channel subfamily J member 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
KCNJ3 (potassium inwardly rectifying channel subfamily J member 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
KCNJ3 (potassium inwardly rectifying channel subfamily J member 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Kcnj3 (potassium inwardly rectifying channel subfamily J member 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
KCNJ3 (potassium inwardly rectifying channel subfamily J member 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
KCNJ3 (potassium inwardly rectifying channel subfamily J member 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Kcnj3 (potassium inwardly rectifying channel subfamily J member 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
KCNJ3 (potassium inwardly rectifying channel subfamily J member 3)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Kcnj3 (potassium inwardly-rectifying channel, subfamily J, member 3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
kcnj3b (potassium inwardly-rectifying channel, subfamily J, member 3b)
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Danio rerio (zebrafish):
kcnj3a (potassium inwardly-rectifying channel, subfamily J, member 3a)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
irk-1
Alliance
DIOPT (OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
Irk1
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
Irk2
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
irk-2
Alliance
DIOPT (Hieranoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
kcnj3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Candidate Gene For:
Hrtrt17
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 60,353,990 - 60,518,110 (+) NCBI GRCr8 mRatBN7.2 3 39,944,896 - 40,106,646 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 39,945,351 - 40,109,124 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 43,306,813 - 43,466,585 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 51,891,606 - 52,051,367 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 49,676,492 - 49,836,251 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 41,019,898 - 41,181,070 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 41,019,898 - 41,181,070 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 46,103,695 - 46,264,737 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 37,068,672 - 37,256,990 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 70,763,612 - 70,766,543 (+) NCBI Celera 3 38,059,571 - 38,220,833 (+) NCBI Celera RH 3.4 Map 3 507.0 RGD Cytogenetic Map 3 q21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
(S)-duloxetine hydrochloride (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 4,4'-sulfonyldiphenol (ISO) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (EXP) acrylamide (EXP) aflatoxin B1 (EXP,ISO) all-trans-retinoic acid (ISO) amitrole (EXP) ammonium chloride (EXP) amoxapine (ISO) aripiprazole (EXP) aristolochic acid A (ISO) arsenous acid (ISO) atropine (ISO) belinostat (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) cadmium dichloride (EXP) carbachol (ISO) Cuprizon (EXP) diarsenic trioxide (ISO) dioxygen (ISO) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (EXP) entinostat (ISO) ethanol (EXP,ISO) ethosuximide (EXP,ISO) fluoxetine (ISO) folic acid (ISO) genistein (ISO) glycidol (EXP) maneb (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methamphetamine (ISO) methimazole (EXP) methoxychlor (EXP) mianserin (ISO) mirtazapine (ISO) N-acetyl-1,4-benzoquinone imine (ISO) nefazodone (ISO) nitrofen (EXP) O-methyleugenol (ISO) p-chloromercuribenzoic acid (ISO) panobinostat (ISO) paraquat (EXP,ISO) paroxetine (ISO) phenylmercury acetate (ISO) potassium atom (EXP,ISO) propranolol (ISO) rotenone (EXP) SB 431542 (ISO) scopolamine (ISO) sertraline (ISO) sodium arsenite (ISO) sunitinib (ISO) tetrachloromethane (EXP) thallium (ISO) titanium dioxide (EXP,ISO) triclosan (ISO) tropan-3alpha-yl 3-hydroxy-2-phenylpropanoate (ISO) Tropicamide (ISO) venlafaxine hydrochloride (ISO) vinclozolin (EXP)
1.
Cardiac strong inward rectifier potassium channels.
Anumonwo JM and Lopatin AN, J Mol Cell Cardiol. 2010 Jan;48(1):45-54. doi: 10.1016/j.yjmcc.2009.08.013. Epub 2009 Aug 22.
2.
Neuronal activity regulates phosphorylation-dependent surface delivery of G protein-activated inwardly rectifying potassium channels.
Chung HJ, etal., Proc Natl Acad Sci U S A. 2009 Jan 13;106(2):629-34. Epub 2008 Dec 31.
3.
Atrial G protein-activated K+ channel: expression cloning and molecular properties.
Dascal N, etal., Proc Natl Acad Sci U S A 1993 Nov 1;90(21):10235-9.
4.
Distribution of the muscarinic K+ channel proteins Kir3.1 and Kir3.4 in the ventricle, atrium, and sinoatrial node of heart.
Dobrzynski H, etal., J Histochem Cytochem. 2001 Oct;49(10):1221-34.
5.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
7.
Direct activation of inward rectifier potassium channels by PIP2 and its stabilization by Gbetagamma.
Huang CL, etal., Nature. 1998 Feb 19;391(6669):803-6. doi: 10.1038/35882.
8.
IRK(1-3) and GIRK(1-4) inwardly rectifying K+ channel mRNAs are differentially expressed in the adult rat brain.
Karschin C, etal., J Neurosci 1996 Jun 1;16(11):3559-70.
9.
Primary structure and functional expression of a rat G-protein-coupled muscarinic potassium channel.
Kubo Y, etal., Nature 1993 Aug 26;364(6440):802-6.
10.
High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.
Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
11.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
12.
Identification of the structural determinant responsible for the phosphorylation of G-protein activated potassium channel 1 by cAMP-dependent protein kinase.
Mullner C, etal., FEBS J. 2009 Nov;276(21):6218-26. doi: 10.1111/j.1742-4658.2009.07325.x. Epub 2009 Sep 17.
13.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
14.
Cloning and characterization of Kir3.1 (GIRK1) C-terminal alternative splice variants.
Nelson CS, etal., Brain Res Mol Brain Res 1997 Jun;46(1-2):185-96.
15.
Alteration in expression of G-protein-activated inward rectifier K+-channel subunits GIRK1 and GIRK2 in the rat brain following electroconvulsive shock.
Pei Q, etal., Neuroscience. 1999 May;90(2):621-7.
16.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
17.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
18.
GOA pipeline
RGD automated data pipeline
19.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
20.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
21.
Identification of structural elements involved in G protein gating of the GIRK1 potassium channel.
Slesinger PA, etal., Neuron. 1995 Nov;15(5):1145-56. doi: 10.1016/0896-6273(95)90102-7.
Kcnj3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 60,353,990 - 60,518,110 (+) NCBI GRCr8 mRatBN7.2 3 39,944,896 - 40,106,646 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 39,945,351 - 40,109,124 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 43,306,813 - 43,466,585 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 51,891,606 - 52,051,367 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 49,676,492 - 49,836,251 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 41,019,898 - 41,181,070 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 41,019,898 - 41,181,070 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 46,103,695 - 46,264,737 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 37,068,672 - 37,256,990 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 70,763,612 - 70,766,543 (+) NCBI Celera 3 38,059,571 - 38,220,833 (+) NCBI Celera RH 3.4 Map 3 507.0 RGD Cytogenetic Map 3 q21 NCBI
KCNJ3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 154,698,695 - 154,858,354 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 154,697,855 - 154,858,354 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 155,555,207 - 155,714,866 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 155,263,339 - 155,421,260 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 2 155,380,600 - 155,538,522 NCBI Celera 2 149,169,529 - 149,327,383 (+) NCBI Celera Cytogenetic Map 2 q24.1 NCBI HuRef 2 147,441,981 - 147,601,674 (+) NCBI HuRef CHM1_1 2 155,561,395 - 155,721,100 (+) NCBI CHM1_1 T2T-CHM13v2.0 2 155,151,671 - 155,311,378 (+) NCBI T2T-CHM13v2.0
Kcnj3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 55,301,814 - 55,488,157 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 55,325,982 - 55,488,157 (+) Ensembl GRCm39 Ensembl GRCm38 2 55,411,798 - 55,598,145 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 55,435,970 - 55,598,145 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 55,289,567 - 55,447,936 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 55,252,542 - 55,410,911 (+) NCBI MGSCv36 mm8 Celera 2 57,211,331 - 57,365,389 (+) NCBI Celera Cytogenetic Map 2 C1.1 NCBI cM Map 2 31.66 NCBI
Kcnj3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955440 19,716,081 - 19,833,437 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955440 19,716,081 - 19,836,957 (+) NCBI ChiLan1.0 ChiLan1.0
KCNJ3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 13 57,366,681 - 57,525,646 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2B 57,381,657 - 57,540,624 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2B 41,965,152 - 42,124,285 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2B 159,214,030 - 159,370,956 (+) NCBI panpan1.1 PanPan1.1 panPan2
KCNJ3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 36 1,354,686 - 1,496,397 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 36 1,354,678 - 1,493,766 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 36 1,385,232 - 1,526,573 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 36 1,366,227 - 1,507,708 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 36 1,366,153 - 1,507,279 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 36 1,374,461 - 1,515,573 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 36 1,435,400 - 1,577,189 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 36 1,478,631 - 1,620,408 (+) NCBI UU_Cfam_GSD_1.0
Kcnj3 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405303 118,314,441 - 118,454,663 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936469 23,165,707 - 23,302,830 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936469 23,163,057 - 23,304,178 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
KCNJ3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 15 62,264,069 - 62,413,566 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 15 62,263,913 - 62,415,915 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 15 69,329,216 - 69,481,280 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
KCNJ3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 10 40,096,042 - 40,258,641 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 10 40,096,527 - 40,255,646 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666040 159,286,264 - 159,444,061 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Kcnj3
.
Predicted Target Of
Count of predictions: 685 Count of miRNA genes: 291 Interacting mature miRNAs: 391 Transcripts: ENSRNOT00000007335 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
10401810 Kidm53 Kidney mass QTL 53 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 3 8227194 47233430 Rat 2298542 Neuinf11 Neuroinflammation QTL 11 3.9 nervous system integrity trait (VT:0010566) spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126) 3 15005422 76927699 Rat 1358362 Srcrt2 Stress Responsive Cort QTL 2 2.78 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 3 38192233 133483320 Rat 631832 Sach1 Saccharin preference QTL 1 2.7 0.02 consumption behavior trait (VT:0002069) calculated saccharin drink intake volume (CMO:0001600) 3 27494621 44188411 Rat 737818 Hcar12 Hepatocarcinoma resistance QTL 12 2.6 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 3 29463235 118376539 Rat 9590286 Uminl1 Urine mineral level QTL 1 3.5 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 3 28249687 73249687 Rat 10450816 Scl75 Serum cholesterol level QTL 75 4.4 0.001 blood LDL cholesterol amount (VT:0000181) blood low density lipoprotein cholesterol level (CMO:0000053) 3 38192233 50749747 Rat 2313093 Bmd77 Bone mineral density QTL 77 2.2 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 3 27494621 50302886 Rat 12879852 Cm93 Cardiac mass QTL 93 0.001 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 3 18311454 47233430 Rat 12879853 Am5 Aortic mass QTL 5 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 3 18311454 47233430 Rat 12879854 Kidm63 Kidney mass QTL 63 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 3 18311454 47233430 Rat 61356 Bp37 Blood pressure QTL 37 3 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 3 30684642 75684642 Rat 1358905 Hrtrt17 Heart rate QTL 17 5.9 0.000014 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 3 10861912 89878372 Rat 12879849 Bw180 Body weight QTL 180 0.037 body mass (VT:0001259) body weight (CMO:0000012) 3 18311454 47233430 Rat 70191 BpQTLcluster4 Blood pressure QTL cluster 4 3 arterial blood pressure trait (VT:2000000) absolute change in systolic blood pressure (CMO:0000607) 3 10778704 50302886 Rat 12879850 Cm91 Cardiac mass QTL 91 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 3 18311454 47233430 Rat 2313101 Bmd76 Bone mineral density QTL 76 3.6 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 3 27494621 50302886 Rat 731172 Bp151 Blood pressure QTL 151 0.04 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 18311454 47233430 Rat 12879851 Cm92 Cardiac mass QTL 92 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 3 18311454 47233430 Rat 8694196 Abfw2 Abdominal fat weight QTL 2 16.58 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 3 28249687 73249687 Rat 1358885 Bp251 Blood pressure QTL 251 3.8 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat 2290452 Scl56 Serum cholesterol level QTL 56 2.26 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 3 1 91609953 Rat 12879868 Am6 Aortic mass QTL 6 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 3 31426403 70668733 Rat 11565451 Bw177 Body weight QTL 177 0.002 body mass (VT:0001259) body weight (CMO:0000012) 3 31426403 70668733 Rat 10450852 Stl33 Serum triglyceride level QTL 33 3.4 0.05 blood LDL triglyceride amount (VT:0010699) blood lipoprotein triglyceride level (CMO:0002685) 3 38192233 50749747 Rat 1358888 Bp264 Blood pressure QTL 264 4.43 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat 11565452 Kidm57 Kidney mass QTL 57 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 3 31426403 70668733 Rat 4889975 Bmd81 Bone mineral density QTL 81 4.3 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 3 38710365 50302886 Rat 12879866 Cm94 Cardiac mass QTL 94 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 3 31426403 70668733 Rat 12879867 Cm95 Cardiac mass QTL 95 0.047 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 3 31426403 70668733 Rat 2302055 Pia30 Pristane induced arthritis QTL 30 3.5 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111) 3 27936919 72936919 Rat 634317 Bw117 Body weight QTL 117 3.58 abdominal fat pad mass (VT:1000711) abdominal fat pad weight to body weight ratio (CMO:0000095) 3 39454637 53296578 Rat 1331795 Rf30 Renal function QTL 30 3.708 urine potassium amount (VT:0010539) urine potassium level (CMO:0000128) 3 39454637 89115240 Rat 70216 Cm14 Cardiac mass QTL 14 2.1 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 31172320 163586636 Rat 1354589 Bw31 Body weight QTL 31 3.3 body mass (VT:0001259) body weight (CMO:0000012) 3 33703347 78196190 Rat 2303593 Gluco46 Glucose level QTL 46 3 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 28468571 73468571 Rat 1354590 Despr11 Despair related QTL 11 0.000031 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 3 28468571 73468571 Rat 2313079 Bss73 Bone structure and strength QTL 73 1.5 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 3 27494621 50302886 Rat 1331777 Bw24 Body weight QTL 24 3.503 body mass (VT:0001259) body weight (CMO:0000012) 3 39454637 89115240 Rat 631647 Bp122 Blood pressure QTL 122 6.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 30684642 75684642 Rat 2313076 Bss74 Bone structure and strength QTL 74 2 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 3 27494621 50302886 Rat 1300169 Bp177 Blood pressure QTL 177 2.96 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 3 33703347 61017857 Rat 10450813 Scl74 Serum cholesterol level QTL 74 5.8 0.001 blood LDL cholesterol amount (VT:0000181) blood low density lipoprotein cholesterol level (CMO:0000053) 3 38192233 50749747 Rat 2302276 Bw82 Body weight QTL 82 4.32 body mass (VT:0001259) body weight (CMO:0000012) 3 39454637 62951183 Rat 738019 Anxrr10 Anxiety related response QTL 10 3.9 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 3 38517803 83517803 Rat 9590136 Scort3 Serum corticosterone level QTL 3 23.37 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 3 28249687 73249687 Rat 10450804 Scl70 Serum cholesterol level QTL 70 4.7 0.001 blood LDL cholesterol amount (VT:0000181) blood low density lipoprotein cholesterol level (CMO:0000053) 3 20714090 65714090 Rat 61419 Cia11 Collagen induced arthritis QTL 11 5.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 3 30356773 98535386 Rat 8552950 Pigfal12 Plasma insulin-like growth factor 1 level QTL 12 7.3 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 3 28249687 73249687 Rat 631676 Cm8 Cardiac mass QTL 8 7.03 0.0001 aorta mass (VT:0002845) aorta weight (CMO:0000076) 3 16954708 61954708 Rat 10450794 Scl69 Serum cholesterol level QTL 69 6.3 0.001 blood LDL cholesterol amount (VT:0000181) blood low density lipoprotein cholesterol level (CMO:0000053) 3 20714090 65714090 Rat 8694386 Bw159 Body weight QTL 159 4.52 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 3 28249687 73249687 Rat 1354604 Bw36 Body weight QTL 36 2.9 body mass (VT:0001259) body weight (CMO:0000012) 3 33703347 104104347 Rat 2313049 Bss72 Bone structure and strength QTL 72 2.6 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 3 27494621 50302886 Rat 2301400 Cm68 Cardiac mass QTL 68 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 3 31426403 70668733 Rat
RH142429
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 40,105,812 - 40,106,021 (+) MAPPER mRatBN7.2 Rnor_6.0 3 41,180,237 - 41,180,445 NCBI Rnor6.0 Rnor_5.0 3 46,263,904 - 46,264,112 UniSTS Rnor5.0 RGSC_v3.4 3 37,256,157 - 37,256,365 UniSTS RGSC3.4 Celera 3 38,220,000 - 38,220,208 UniSTS RH 3.4 Map 3 507.0 UniSTS Cytogenetic Map 3 q31-q35 UniSTS
Kcnj3
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 40,106,155 - 40,106,342 (+) MAPPER mRatBN7.2 Rnor_6.0 3 41,180,580 - 41,180,766 NCBI Rnor6.0 Rnor_5.0 3 46,264,247 - 46,264,433 UniSTS Rnor5.0 RGSC_v3.4 3 37,256,500 - 37,256,686 UniSTS RGSC3.4 Celera 3 38,220,343 - 38,220,529 UniSTS Cytogenetic Map 3 q31-q35 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
10
49
113
69
68
38
20
38
6
191
91
93
45
52
30
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000007335 ⟹ ENSRNOP00000007335
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 39,945,363 - 40,106,098 (+) Ensembl Rnor_6.0 Ensembl 3 41,019,898 - 41,181,070 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000116585 ⟹ ENSRNOP00000082842
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 39,945,351 - 40,109,124 (+) Ensembl
RefSeq Acc Id:
NM_031610 ⟹ NP_113798
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 60,354,287 - 60,515,600 (+) NCBI mRatBN7.2 3 39,945,305 - 40,106,646 (+) NCBI Rnor_6.0 3 41,019,898 - 41,181,070 (+) NCBI Rnor_5.0 3 46,103,695 - 46,264,737 (+) NCBI RGSC_v3.4 3 37,068,672 - 37,256,990 (+) RGD Celera 3 38,059,571 - 38,220,833 (+) RGD
Sequence:
CAGCGCTTGGCTCCTGCGCCTCCGCTTCGTGTTTGAATCTGGATCTCCCCTCCGTATTATGTCTGCACTCCGAAGGAAATTTGGGGACGATTACCAGGTAGTGACCACTTCGTCCAGCGGTTCGGGCT
hide sequence
RefSeq Acc Id:
XM_039105731 ⟹ XP_038961659
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 60,353,990 - 60,514,975 (+) NCBI mRatBN7.2 3 39,944,908 - 40,105,912 (+) NCBI
RefSeq Acc Id:
XM_039105732 ⟹ XP_038961660
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 60,353,990 - 60,514,829 (+) NCBI mRatBN7.2 3 39,944,910 - 40,042,681 (+) NCBI
RefSeq Acc Id:
XM_039105733 ⟹ XP_038961661
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 60,353,990 - 60,364,114 (+) NCBI mRatBN7.2 3 39,944,896 - 39,955,141 (+) NCBI
RefSeq Acc Id:
XM_039105734 ⟹ XP_038961662
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 60,353,990 - 60,518,110 (+) NCBI mRatBN7.2 3 39,944,904 - 40,106,078 (+) NCBI
RefSeq Acc Id:
NP_113798 ⟸ NM_031610
- UniProtKB:
P63251 (UniProtKB/Swiss-Prot), A6JF43 (UniProtKB/TrEMBL)
- Sequence:
MSALRRKFGDDYQVVTTSSSGSGLQPQGPGQGPQQQLVPKKKRQRFVDKNGRCNVQHGNLGSETSRYLSDLFTTLVDLKWRWNLFIFILTYTVAWLFMASMWWVIAYTRGDLNKAHVGNYTPCVANVY
hide sequence
Ensembl Acc Id:
ENSRNOP00000007335 ⟸ ENSRNOT00000007335
RefSeq Acc Id:
XP_038961661 ⟸ XM_039105733
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_038961662 ⟸ XM_039105734
- Peptide Label:
isoform X4
- UniProtKB:
A0A8L2Q345 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038961659 ⟸ XM_039105731
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_038961660 ⟸ XM_039105732
- Peptide Label:
isoform X2
- UniProtKB:
A6JF44 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000082842 ⟸ ENSRNOT00000116585
RGD ID: 13692081 Promoter ID: EPDNEW_R2606 Type: single initiation site Name: Kcnj3_1 Description: potassium voltage-gated channel subfamily J member 3 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 3 41,019,905 - 41,019,965 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2019-07-19
Kcnj3
potassium inwardly-rectifying channel, subfamily J, member 3
Kcnj3
potassium voltage-gated channel subfamily J member 3
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2016-02-11
Kcnj3
potassium voltage-gated channel subfamily J member 3
Kcnj3
potassium channel, inwardly rectifying subfamily J, member 3
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2015-01-26
Kcnj3
potassium channel, inwardly rectifying subfamily J, member 3
Kcnj3
potassium inwardly-rectifying channel, subfamily J, member 3
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2001-10-23
Kcnj3
Potassium inwardly-rectifying channel, subfamily J, member 3
Name updated to reflect Human and Mouse nomenclature
68913 APPROVED
2001-10-23
Kcnj3
Potassium channel, inwarding rectifying channel, subfamily J, member 3
Name updated to reflect Human and Mouse nomenclature
68913 APPROVED
Note Type
Note
Reference
gene_process
involved in regulating the heartbeat
729292
