Symbol:
Kcnb1
Name:
potassium voltage-gated channel subfamily B member 1
RGD ID:
2954
Description:
Enables several functions, including protein heterodimerization activity; transmembrane transporter binding activity; and voltage-gated potassium channel activity. Involved in several processes, including clustering of voltage-gated potassium channels; positive regulation of secretion by cell; and potassium ion export across plasma membrane. Acts upstream of or within potassium ion transport. Located in several cellular components, including dendrite; lateral plasma membrane; and neuronal cell body membrane. Part of voltage-gated potassium channel complex. Is active in cholinergic synapse and postsynaptic specialization membrane. Human ortholog(s) of this gene implicated in developmental and epileptic encephalopathy 26 and epilepsy. Orthologous to human KCNB1 (potassium voltage-gated channel subfamily B member 1); PARTICIPATES IN insulin secretion pathway; INTERACTS WITH (5Z,8Z,11Z,13E)-15-HETE; 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
delayed rectifier potassium channel 1; DRK1; DRK1PC; Kcr1-1; Kv2.1; potassium channel Kv2.1; potassium channel, voltage gated Shab-related subfamily B, member 1; potassium voltage gated channel, Shab-related subfamily, member 1; Shab; voltage-gated potassium channel subunit Kv2.1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
KCNB1 (potassium voltage-gated channel subfamily B member 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB
Mus musculus (house mouse):
Kcnb1 (potassium voltage gated channel, Shab-related subfamily, member 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Kcnb1 (potassium voltage-gated channel subfamily B member 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
KCNB1 (potassium voltage-gated channel subfamily B member 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
KCNB1 (potassium voltage-gated channel subfamily B member 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Kcnb1 (potassium voltage-gated channel subfamily B member 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
KCNB1 (potassium voltage-gated channel subfamily B member 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
KCNB1 (potassium voltage-gated channel subfamily B member 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Kcnb1 (potassium voltage-gated channel subfamily B member 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
KCNB1 (potassium voltage-gated channel subfamily B member 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Kcnb1 (potassium voltage gated channel, Shab-related subfamily, member 1)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
kcnb1 (potassium voltage-gated channel, Shab-related subfamily, member 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
C32C4.1
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoFinder|OrthoInspector|PANTHER)
Caenorhabditis elegans (roundworm):
exp-2
Alliance
DIOPT (InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
Shab
Alliance
DIOPT (OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
kvs-1
Alliance
DIOPT (InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
kvs-4
Alliance
DIOPT (InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
kvs-5
Alliance
DIOPT (InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
kcnb1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Candidate Gene For:
Niddm39 Eau4
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 176,239,285 - 176,332,408 (-) NCBI GRCr8 mRatBN7.2 3 155,820,255 - 155,913,383 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 155,822,963 - 155,916,194 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 159,621,853 - 159,714,946 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 168,120,826 - 168,213,919 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 165,862,536 - 165,955,629 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 163,850,785 - 163,935,610 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 163,850,785 - 163,935,617 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 170,010,756 - 170,094,507 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 158,250,001 - 158,345,927 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 158,156,036 - 158,248,459 (-) NCBI Celera 3 154,408,682 - 154,493,576 (-) NCBI Celera RH 3.4 Map 3 1476.0 RGD Cytogenetic Map 3 q42 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Kcnb1 Rat (5Z,8Z,11Z,13E)-15-HETE affects activity EXP 6480464 15-hydroxy-5 more ... CTD PMID:18984061 Kcnb1 Rat 1,2-dimethylhydrazine increases expression ISO Kcnb1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of KCNB1 mRNA CTD PMID:22206623 Kcnb1 Rat 17beta-estradiol increases expression ISO Kcnb1 (Mus musculus) 6480464 Estradiol results in increased expression of KCNB1 mRNA CTD PMID:39298647 Kcnb1 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO KCNB1 (Homo sapiens) 6480464 2 more ... CTD PMID:19095052 Kcnb1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO KCNB1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of KCNB1 mRNA CTD PMID:22298810 Kcnb1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of KCNB1 mRNA CTD PMID:33387578 Kcnb1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO KCNB1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of KCNB1 mRNA CTD PMID:20106945 and PMID:26159488 Kcnb1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO KCNB1 (Homo sapiens) 6480464 Endosulfan inhibits the reaction [Tetrachlorodibenzodioxin results in decreased expression of KCNB1 mRNA] CTD PMID:26159488 Kcnb1 Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO Kcnb1 (Mus musculus) 6480464 tetrabromobisphenol A results in decreased expression of KCNB1 mRNA CTD PMID:25172293 Kcnb1 Rat 3,4-methylenedioxymethamphetamine increases expression ISO Kcnb1 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of KCNB1 mRNA CTD PMID:20188158 Kcnb1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO KCNB1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in increased expression of KCNB1 mRNA CTD PMID:28628672 Kcnb1 Rat 4,4'-sulfonyldiphenol affects methylation ISO Kcnb1 (Mus musculus) 6480464 bisphenol S affects the methylation of KCNB1 exon and bisphenol S affects the methylation of KCNB1 gene CTD PMID:31683443 and PMID:33297965 Kcnb1 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of KCNB1 mRNA CTD PMID:30047161 Kcnb1 Rat aflatoxin B1 decreases methylation ISO KCNB1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of KCNB1 gene CTD PMID:27153756 Kcnb1 Rat aflatoxin B1 decreases expression ISO KCNB1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of KCNB1 mRNA CTD PMID:27153756 Kcnb1 Rat all-trans-retinoic acid multiple interactions ISO KCNB1 (Homo sapiens) 6480464 [Tretinoin co-treated with Ascorbic Acid] results in increased expression of KCNB1 mRNA CTD PMID:16443354 Kcnb1 Rat all-trans-retinoic acid decreases expression ISO KCNB1 (Homo sapiens) 6480464 Tretinoin results in decreased expression of KCNB1 mRNA CTD PMID:21934132 Kcnb1 Rat amiodarone decreases expression ISO Kcnb1 (Mus musculus) 6480464 Amiodarone results in decreased expression of KCNB1 mRNA CTD PMID:15520326 Kcnb1 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of KCNB1 mRNA CTD PMID:30047161 Kcnb1 Rat amphotericin B decreases expression ISO KCNB1 (Homo sapiens) 6480464 Amphotericin B analog results in decreased expression of KCNB1 mRNA CTD PMID:28534445 Kcnb1 Rat anthra[1,9-cd]pyrazol-6(2H)-one multiple interactions EXP 6480464 pyrazolanthrone inhibits the reaction [Methamphetamine results in increased expression of KCNB1 protein] CTD PMID:29297590 Kcnb1 Rat antirheumatic drug increases expression ISO KCNB1 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of KCNB1 mRNA CTD PMID:24449571 Kcnb1 Rat aristolochic acid A increases expression ISO KCNB1 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of KCNB1 mRNA CTD PMID:33212167 Kcnb1 Rat arsane affects methylation ISO KCNB1 (Homo sapiens) 6480464 Arsenic affects the methylation of KCNB1 gene CTD PMID:25304211 Kcnb1 Rat arsenic atom affects methylation ISO KCNB1 (Homo sapiens) 6480464 Arsenic affects the methylation of KCNB1 gene CTD PMID:25304211 Kcnb1 Rat arsenous acid decreases expression ISO Kcnb1 (Mus musculus) 6480464 Arsenic Trioxide results in decreased expression of KCNB1 mRNA CTD PMID:35676786 Kcnb1 Rat atrazine decreases expression ISO KCNB1 (Homo sapiens) 6480464 Atrazine results in decreased expression of KCNB1 mRNA CTD PMID:22378314 Kcnb1 Rat benzo[a]pyrene decreases expression ISO KCNB1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of KCNB1 mRNA CTD PMID:20106945 Kcnb1 Rat benzo[a]pyrene decreases methylation ISO KCNB1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of KCNB1 3' UTR CTD PMID:27901495 Kcnb1 Rat benzo[a]pyrene increases methylation ISO KCNB1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of KCNB1 promoter CTD PMID:27901495 Kcnb1 Rat benzo[a]pyrene increases expression ISO Kcnb1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of KCNB1 mRNA CTD PMID:21964900 Kcnb1 Rat benzo[b]fluoranthene increases expression ISO Kcnb1 (Mus musculus) 6480464 benzo(b)fluoranthene results in increased expression of KCNB1 mRNA CTD PMID:26377693 Kcnb1 Rat bis(2-chloroethyl) sulfide increases expression ISO Kcnb1 (Mus musculus) 6480464 Mustard Gas results in increased expression of KCNB1 mRNA CTD PMID:15674843 Kcnb1 Rat bis(2-ethylhexyl) phthalate decreases expression ISO KCNB1 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in decreased expression of KCNB1 mRNA CTD PMID:31163220 Kcnb1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of KCNB1 mRNA CTD PMID:25181051 Kcnb1 Rat bisphenol A increases expression ISO Kcnb1 (Mus musculus) 6480464 bisphenol A results in increased expression of KCNB1 mRNA CTD PMID:32156529 Kcnb1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of KCNB1 mRNA CTD PMID:33296240 Kcnb1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of KCNB1 mRNA CTD PMID:30816183 Kcnb1 Rat bisphenol A decreases methylation ISO Kcnb1 (Mus musculus) 6480464 bisphenol A results in decreased methylation of KCNB1 promoter CTD PMID:27312807 Kcnb1 Rat cadmium dichloride increases expression ISO KCNB1 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of KCNB1 mRNA CTD PMID:38382870 Kcnb1 Rat cantharidin decreases expression ISO Kcnb1 (Mus musculus) 6480464 Cantharidin results in decreased expression of KCNB1 mRNA CTD PMID:36907384 Kcnb1 Rat carbon nanotube decreases expression ISO Kcnb1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Kcnb1 Rat CGP 52608 multiple interactions ISO KCNB1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to KCNB1 gene] CTD PMID:28238834 Kcnb1 Rat chlorpyrifos increases expression ISO Kcnb1 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of KCNB1 mRNA CTD PMID:37019170 Kcnb1 Rat cisplatin multiple interactions ISO KCNB1 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of KCNB1 mRNA CTD PMID:27392435 Kcnb1 Rat cisplatin increases expression ISO KCNB1 (Homo sapiens) 6480464 Cisplatin results in increased expression of KCNB1 mRNA CTD PMID:27392435 Kcnb1 Rat cocaine multiple interactions ISO Kcnb1 (Mus musculus) 6480464 Cocaine affects the reaction [NTRK2 protein affects the expression of KCNB1 mRNA] CTD PMID:20947769 Kcnb1 Rat cocaine affects expression EXP 6480464 Cocaine affects the expression of KCNB1 mRNA CTD PMID:20187946 Kcnb1 Rat crocidolite asbestos increases expression ISO Kcnb1 (Mus musculus) 6480464 Asbestos and Crocidolite results in increased expression of KCNB1 mRNA CTD PMID:29279043 Kcnb1 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of KCNB1 mRNA CTD PMID:27523638 Kcnb1 Rat cyclosporin A decreases expression ISO KCNB1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of KCNB1 mRNA CTD PMID:20106945 Kcnb1 Rat dexamethasone multiple interactions EXP 6480464 Dexamethasone inhibits the reaction [nitrofen results in decreased expression of KCNB1 mRNA] and Dexamethasone inhibits the reaction [nitrofen results in decreased expression of KCNB1 protein] CTD PMID:15088113 Kcnb1 Rat dexamethasone multiple interactions ISO KCNB1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in increased expression of KCNB1 mRNA CTD PMID:28628672 Kcnb1 Rat dexamethasone increases expression ISO KCNB1 (Homo sapiens) 6480464 Dexamethasone results in increased expression of KCNB1 mRNA CTD PMID:25047013 Kcnb1 Rat diarsenic trioxide decreases expression ISO Kcnb1 (Mus musculus) 6480464 Arsenic Trioxide results in decreased expression of KCNB1 mRNA CTD PMID:35676786 Kcnb1 Rat dibenz[a,h]anthracene increases expression ISO Kcnb1 (Mus musculus) 6480464 1 more ... CTD PMID:26377693 Kcnb1 Rat dichlorine affects expression EXP 6480464 Chlorine affects the expression of KCNB1 mRNA CTD PMID:18636392 Kcnb1 Rat dichlorine multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] affects the expression of KCNB1 mRNA CTD PMID:18636392 Kcnb1 Rat dioxygen decreases expression EXP 6480464 Oxygen deficiency results in decreased expression of KCNB1 protein CTD PMID:31930969 Kcnb1 Rat dorsomorphin multiple interactions ISO KCNB1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Kcnb1 Rat doxorubicin decreases expression ISO KCNB1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of KCNB1 mRNA CTD PMID:29803840 Kcnb1 Rat endosulfan multiple interactions ISO KCNB1 (Homo sapiens) 6480464 Endosulfan inhibits the reaction [Tetrachlorodibenzodioxin results in decreased expression of KCNB1 mRNA] CTD PMID:26159488 Kcnb1 Rat ethanol increases expression ISO Kcnb1 (Mus musculus) 6480464 Ethanol results in increased expression of KCNB1 mRNA CTD PMID:30319688 Kcnb1 Rat ethanol multiple interactions ISO Kcnb1 (Mus musculus) 6480464 ferrostatin-1 inhibits the reaction [Ethanol results in decreased expression of KCNB1 mRNA] and ferrostatin-1 inhibits the reaction [Ethanol results in decreased expression of KCNB1 protein] CTD PMID:34864093 Kcnb1 Rat ethanol decreases expression ISO Kcnb1 (Mus musculus) 6480464 Ethanol results in decreased expression of KCNB1 mRNA and Ethanol results in decreased expression of KCNB1 protein CTD PMID:34864093 Kcnb1 Rat ferrostatin-1 multiple interactions ISO Kcnb1 (Mus musculus) 6480464 ferrostatin-1 inhibits the reaction [Ethanol results in decreased expression of KCNB1 mRNA] and ferrostatin-1 inhibits the reaction [Ethanol results in decreased expression of KCNB1 protein] CTD PMID:34864093 Kcnb1 Rat fipronil decreases expression EXP 6480464 fipronil results in decreased expression of KCNB1 mRNA CTD PMID:34044035 Kcnb1 Rat flavonoids increases expression EXP 6480464 Flavonoids results in increased expression of KCNB1 mRNA CTD PMID:18035473 Kcnb1 Rat formaldehyde decreases expression ISO KCNB1 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of KCNB1 mRNA CTD PMID:27905399 Kcnb1 Rat furan decreases expression EXP 6480464 furan results in decreased expression of KCNB1 mRNA CTD PMID:25539665 and PMID:26194646 Kcnb1 Rat genistein multiple interactions EXP 6480464 [Genistein co-treated with Methoxychlor] results in decreased expression of KCNB1 mRNA CTD PMID:21782745 Kcnb1 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of KCNB1 mRNA CTD PMID:33387578 Kcnb1 Rat indometacin multiple interactions ISO KCNB1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in increased expression of KCNB1 mRNA CTD PMID:28628672 Kcnb1 Rat isoprenaline decreases expression ISO Kcnb1 (Mus musculus) 6480464 Isoproterenol results in decreased expression of KCNB1 mRNA CTD PMID:20003209 Kcnb1 Rat L-ascorbic acid multiple interactions ISO KCNB1 (Homo sapiens) 6480464 [Tretinoin co-treated with Ascorbic Acid] results in increased expression of KCNB1 mRNA CTD PMID:16443354 Kcnb1 Rat lead diacetate decreases expression ISO KCNB1 (Homo sapiens) 6480464 lead acetate results in decreased expression of KCNB1 mRNA CTD PMID:38568856 Kcnb1 Rat Licochalcone B increases expression ISO KCNB1 (Homo sapiens) 6480464 licochalcone B results in increased expression of KCNB1 mRNA CTD PMID:33647349 Kcnb1 Rat medroxyprogesterone acetate increases expression ISO KCNB1 (Homo sapiens) 6480464 Medroxyprogesterone Acetate results in increased expression of KCNB1 mRNA CTD PMID:20843944 Kcnb1 Rat methamphetamine increases expression ISO Kcnb1 (Mus musculus) 6480464 Methamphetamine results in increased expression of KCNB1 mRNA CTD PMID:26307267 Kcnb1 Rat methamphetamine multiple interactions EXP 6480464 2-(4-morpholino)ethyl-1-phenylcyclohexane-1-carboxylate inhibits the reaction [Methamphetamine results in increased expression of KCNB1 protein] more ... CTD PMID:29297590 Kcnb1 Rat methamphetamine increases expression EXP 6480464 Methamphetamine results in increased expression of KCNB1 protein CTD PMID:29297590 Kcnb1 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of KCNB1 mRNA CTD PMID:30047161 Kcnb1 Rat methoxychlor multiple interactions EXP 6480464 [Genistein co-treated with Methoxychlor] results in decreased expression of KCNB1 mRNA CTD PMID:21782745 Kcnb1 Rat methylmercury chloride decreases expression ISO KCNB1 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of KCNB1 mRNA CTD PMID:28001369 Kcnb1 Rat mono(2-ethylhexyl) phthalate decreases expression ISO KCNB1 (Homo sapiens) 6480464 mono-(2-ethylhexyl)phthalate results in decreased expression of KCNB1 mRNA CTD PMID:36695872 Kcnb1 Rat monocrotaline decreases expression EXP 6480464 Monocrotaline results in decreased expression of KCNB1 mRNA CTD PMID:25460361 Kcnb1 Rat nickel atom decreases expression ISO KCNB1 (Homo sapiens) 6480464 Nickel results in decreased expression of KCNB1 mRNA CTD PMID:25583101 Kcnb1 Rat nitrofen multiple interactions EXP 6480464 Dexamethasone inhibits the reaction [nitrofen results in decreased expression of KCNB1 mRNA] and Dexamethasone inhibits the reaction [nitrofen results in decreased expression of KCNB1 protein] CTD PMID:15088113 Kcnb1 Rat nitrofen decreases expression EXP 6480464 nitrofen results in decreased expression of KCNB1 mRNA and nitrofen results in decreased expression of KCNB1 protein CTD PMID:15088113 Kcnb1 Rat ozone multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] affects the expression of KCNB1 mRNA CTD PMID:18636392 Kcnb1 Rat ozone multiple interactions ISO Kcnb1 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of KCNB1 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in increased expression of KCNB1 mRNA CTD PMID:34911549 Kcnb1 Rat paracetamol affects expression ISO Kcnb1 (Mus musculus) 6480464 Acetaminophen affects the expression of KCNB1 mRNA CTD PMID:17562736 Kcnb1 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of KCNB1 mRNA CTD PMID:33387578 Kcnb1 Rat phenylmercury acetate decreases expression ISO KCNB1 (Homo sapiens) 6480464 Phenylmercuric Acetate results in decreased expression of KCNB1 mRNA CTD PMID:26272509 Kcnb1 Rat phenylmercury acetate multiple interactions ISO KCNB1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of KCNB1 mRNA CTD PMID:27188386 Kcnb1 Rat pioglitazone multiple interactions ISO Kcnb1 (Mus musculus) 6480464 [N-nitroso-tris-chloroethylurea co-treated with pioglitazone] results in decreased expression of KCNB1 mRNA CTD PMID:27935865 Kcnb1 Rat pirinixic acid decreases expression ISO Kcnb1 (Mus musculus) 6480464 pirinixic acid results in decreased expression of KCNB1 mRNA CTD PMID:18445702 Kcnb1 Rat pregnenolone 16alpha-carbonitrile increases expression ISO Kcnb1 (Mus musculus) 6480464 Pregnenolone Carbonitrile results in increased expression of KCNB1 mRNA CTD PMID:28903501 Kcnb1 Rat pregnenolone 16alpha-carbonitrile decreases expression EXP 6480464 Pregnenolone Carbonitrile results in decreased expression of KCNB1 mRNA CTD PMID:30047161 Kcnb1 Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of KCNB1 mRNA CTD PMID:28374803 Kcnb1 Rat SB 203580 multiple interactions EXP 6480464 SB 203580 inhibits the reaction [Methamphetamine results in increased expression of KCNB1 protein] CTD PMID:29297590 Kcnb1 Rat SB 431542 multiple interactions ISO KCNB1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Kcnb1 Rat scopolamine increases expression EXP 6480464 Scopolamine results in increased expression of KCNB1 mRNA CTD PMID:12579815 and PMID:15567561 Kcnb1 Rat silicon dioxide increases expression ISO KCNB1 (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of KCNB1 mRNA CTD PMID:25895662 Kcnb1 Rat sodium arsenate decreases expression ISO Kcnb1 (Mus musculus) 6480464 sodium arsenate results in decreased expression of KCNB1 mRNA CTD PMID:21795629 Kcnb1 Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of KCNB1 mRNA CTD PMID:30047161 Kcnb1 Rat titanium dioxide decreases methylation ISO Kcnb1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of KCNB1 gene CTD PMID:35295148 Kcnb1 Rat titanium dioxide increases methylation ISO Kcnb1 (Mus musculus) 6480464 titanium dioxide results in increased methylation of KCNB1 promoter CTD PMID:35295148 Kcnb1 Rat trichostatin A decreases expression ISO KCNB1 (Homo sapiens) 6480464 trichostatin A results in decreased expression of KCNB1 mRNA CTD PMID:24935251 Kcnb1 Rat triptonide increases expression ISO Kcnb1 (Mus musculus) 6480464 triptonide results in increased expression of KCNB1 mRNA CTD PMID:33045310 Kcnb1 Rat valproic acid increases methylation ISO KCNB1 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of KCNB1 gene CTD PMID:29154799 Kcnb1 Rat valproic acid multiple interactions ISO KCNB1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of KCNB1 mRNA CTD PMID:27188386 Kcnb1 Rat valproic acid increases expression ISO KCNB1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of KCNB1 mRNA CTD PMID:23179753 more ... Kcnb1 Rat valproic acid decreases expression ISO KCNB1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of KCNB1 mRNA CTD PMID:23179753 more ... Kcnb1 Rat valproic acid affects expression ISO KCNB1 (Homo sapiens) 6480464 Valproic Acid affects the expression of KCNB1 mRNA CTD PMID:25979313
(5Z,8Z,11Z,13E)-15-HETE (EXP) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) amiodarone (ISO) amitrole (EXP) amphotericin B (ISO) anthra[1,9-cd]pyrazol-6(2H)-one (EXP) antirheumatic drug (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) atrazine (ISO) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) bis(2-chloroethyl) sulfide (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) cadmium dichloride (ISO) cantharidin (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chlorpyrifos (ISO) cisplatin (ISO) cocaine (EXP,ISO) crocidolite asbestos (ISO) Cuprizon (EXP) cyclosporin A (ISO) dexamethasone (EXP,ISO) diarsenic trioxide (ISO) dibenz[a,h]anthracene (ISO) dichlorine (EXP) dioxygen (EXP) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (ISO) ethanol (ISO) ferrostatin-1 (ISO) fipronil (EXP) flavonoids (EXP) formaldehyde (ISO) furan (EXP) genistein (EXP) gentamycin (EXP) indometacin (ISO) isoprenaline (ISO) L-ascorbic acid (ISO) lead diacetate (ISO) Licochalcone B (ISO) medroxyprogesterone acetate (ISO) methamphetamine (EXP,ISO) methimazole (EXP) methoxychlor (EXP) methylmercury chloride (ISO) mono(2-ethylhexyl) phthalate (ISO) monocrotaline (EXP) nickel atom (ISO) nitrofen (EXP) ozone (EXP,ISO) paracetamol (EXP,ISO) phenylmercury acetate (ISO) pioglitazone (ISO) pirinixic acid (ISO) pregnenolone 16alpha-carbonitrile (EXP,ISO) rotenone (EXP) SB 203580 (EXP) SB 431542 (ISO) scopolamine (EXP) silicon dioxide (ISO) sodium arsenate (ISO) sulfadimethoxine (EXP) titanium dioxide (ISO) trichostatin A (ISO) triptonide (ISO) valproic acid (ISO)
Biological Process
action potential (IBA,IDA,IEA,ISO,ISS) cellular response to calcium ion (IDA) cellular response to glucose stimulus (IEA,ISO,ISS) cellular response to nutrient levels (IDA) clustering of voltage-gated potassium channels (IDA) exocytosis (IEA) glucose homeostasis (IEA,ISO,ISS) glutamate receptor signaling pathway (IDA) monoatomic ion transmembrane transport (IEA) monoatomic ion transport (IEA) negative regulation of insulin secretion (IEA,ISO,ISS) positive regulation of calcium ion-dependent exocytosis (IDA) positive regulation of catecholamine secretion (IDA) positive regulation of long-term synaptic depression (IEA,ISO,ISS) positive regulation of norepinephrine secretion (IDA) positive regulation of protein targeting to membrane (IDA,IEA,ISO) potassium ion export across plasma membrane (IMP) potassium ion transmembrane transport (IBA,IDA,IEA,ISO) potassium ion transport (IDA,IEA,IMP) protein homooligomerization (IEA) protein localization to plasma membrane (IDA) regulation of action potential (IEA,ISO,ISS) regulation of motor neuron apoptotic process (IDA) response to axon injury (IEP) response to L-glutamate (IEP) transmembrane transport (IEA) vesicle docking involved in exocytosis (IDA)
Cellular Component
apical plasma membrane (IMP) axon (IBA,IDA,IEA) cell projection (IEA) cell surface (IDA) cholinergic synapse (IDA) dendrite (IDA,IEA,ISO) dendrite membrane (IBA,IDA) lateral plasma membrane (IDA,IEA) membrane (IEA) monoatomic ion channel complex (IEA) neuron projection (IEA) neuronal cell body (IDA) neuronal cell body membrane (IBA,IDA,IEA,ISO) perikaryon (IDA,IEA) perinuclear region of cytoplasm (IDA) plasma membrane (IDA,IEA,ISO) postsynaptic membrane (IBA,IDA,IEA) postsynaptic specialization membrane (IDA) proximal dendrite (IDA) sarcolemma (IEA) synapse (IEA) voltage-gated potassium channel complex (IBA,IDA,IEA,ISO)
1.
Developmental and epilepsy spectrum of KCNB1 encephalopathy with long-term outcome.
Bar C, etal., Epilepsia. 2020 Nov;61(11):2461-2473. doi: 10.1111/epi.16679. Epub 2020 Sep 21.
2.
Neurodevelopmental Disorders Caused by De Novo Variants in KCNB1 Genotypes and Phenotypes.
de Kovel CGF, etal., JAMA Neurol. 2017 Oct 1;74(10):1228-1236. doi: 10.1001/jamaneurol.2017.1714.
3.
Kv2.1 cell surface clusters are insertion platforms for ion channel delivery to the plasma membrane.
Deutsch E, etal., Mol Biol Cell. 2012 Aug;23(15):2917-29. doi: 10.1091/mbc.E12-01-0047. Epub 2012 May 30.
4.
Distinct spatial and temporal expression patterns of K+ channel mRNAs from different subfamilies.
Drewe JA, etal., J Neurosci 1992 Feb;12(2):538-48.
5.
Novel tarantula toxins for subtypes of voltage-dependent potassium channels in the Kv2 and Kv4 subfamilies.
Escoubas P, etal., Mol Pharmacol. 2002 Jul;62(1):48-57. doi: 10.1124/mol.62.1.48.
6.
Non-conducting function of the Kv2.1 channel enables it to recruit vesicles for release in neuroendocrine and nerve cells.
Feinshreiber L, etal., J Cell Sci. 2010 Jun 1;123(Pt 11):1940-7. doi: 10.1242/jcs.063719.
7.
Reduced sensory synaptic excitation impairs motor neuron function via Kv2.1 in spinal muscular atrophy.
Fletcher EV, etal., Nat Neurosci. 2017 Jul;20(7):905-916. doi: 10.1038/nn.4561. Epub 2017 May 15.
8.
A novel potassium channel with delayed rectifier properties isolated from rat brain by expression cloning.
Frech GC, etal., Nature 1989 Aug 24;340(6235):642-5.
9.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
10.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
11.
Epilepsy and neurobehavioral abnormalities in mice with a dominant-negative KCNB1 pathogenic variant.
Hawkins NA, etal., Neurobiol Dis. 2021 Jan;147:105141. doi: 10.1016/j.nbd.2020.105141. Epub 2020 Oct 22.
12.
Modulation of Kv2.1 channel gating and TEA sensitivity by distinct domains of SNAP-25.
He Y, etal., Biochem J. 2006 Jun 1;396(2):363-9.
13.
Contrasting immunohistochemical localizations in rat brain of two novel K+ channels of the Shab subfamily.
Hwang PM, etal., J Neurosci. 1993 Apr;13(4):1569-76.
14.
The Roles of N- and C-terminal determinants in the activation of the Kv2.1 potassium channel.
Ju M, etal., J Biol Chem. 2003 Apr 11;278(15):12769-78. doi: 10.1074/jbc.M212973200. Epub 2003 Jan 29.
15.
KCNE1 and KCNE2 provide a checkpoint governing voltage-gated potassium channel a-subunit composition.
Kanda VA, etal., Biophys J. 2011 Sep 21;101(6):1364-75. doi: 10.1016/j.bpj.2011.08.014. Epub 2011 Sep 20.
16.
Formation of heteromeric Kv2 channels in mammalian brain neurons.
Kihira Y, etal., J Biol Chem. 2010 May 14;285(20):15048-55. doi: 10.1074/jbc.M109.074260. Epub 2010 Mar 4.
17.
Inactivation of Kv2.1 potassium channels.
Klemic KG, etal., Biophys J. 1998 Apr;74(4):1779-89.
18.
Modulation of potassium channel gating by coexpression of Kv2.1 with regulatory Kv5.1 or Kv6.1 alpha-subunits.
Kramer JW, etal., Am J Physiol. 1998 Jun;274(6):C1501-10. doi: 10.1152/ajpcell.1998.274.6.C1501.
19.
High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.
Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
20.
Internal Na+ and Mg2+ blockade of DRK1 (Kv2.1) potassium channels expressed in Xenopus oocytes. Inward rectification of a delayed rectifier.
Lopatin AN and Nichols CG, J Gen Physiol. 1994 Feb;103(2):203-16.
21.
Contributions of Kv1.2, Kv1.5 and Kv2.1 subunits to the native delayed rectifier K(+) current in rat mesenteric artery smooth muscle cells.
Lu Y, etal., Life Sci. 2002 Aug 9;71(12):1465-73.
22.
Rearrangements in the relative orientation of cytoplasmic domains induced by a membrane-anchored protein mediate modulations in Kv channel gating.
Lvov A, etal., J Biol Chem. 2009 Oct 9;284(41):28276-91. doi: 10.1074/jbc.M109.028761. Epub 2009 Aug 18.
23.
Voltage-dependent K(+) channels in pancreatic beta cells: role, regulation and potential as therapeutic targets.
MacDonald PE and Wheeler MB, Diabetologia. 2003 Aug;46(8):1046-62. Epub 2003 Jun 27.
24.
Regulation of the Kv2.1 potassium channel by MinK and MiRP1.
McCrossan ZA, etal., J Membr Biol. 2009 Mar;228(1):1-14. doi: 10.1007/s00232-009-9154-8. Epub 2009 Feb 14.
25.
MinK-related peptide 2 modulates Kv2.1 and Kv3.1 potassium channels in mammalian brain.
McCrossan ZA, etal., J Neurosci. 2003 Sep 3;23(22):8077-91.
26.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
27.
Focal aggregation of voltage-gated, Kv2.1 subunit-containing, potassium channels at synaptic sites in rat spinal motoneurones.
Muennich EA and Fyffe RE, J Physiol. 2004 Feb 1;554(Pt 3):673-85. Epub 2003 Nov 7.
28.
Phosphorylation of the Kv2.1 K+ channel alters voltage-dependent activation.
Murakoshi H, etal., Mol Pharmacol. 1997 Nov;52(5):821-8. doi: 10.1124/mol.52.5.821.
29.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
30.
Kv2.1/Kv9.3, a novel ATP-dependent delayed-rectifier K+ channel in oxygen-sensitive pulmonary artery myocytes.
Patel AJ, etal., EMBO J 1997 Nov 17;16(22):6615-25.
31.
Kv2.1 and electrically silent Kv6.1 potassium channel subunits combine and express a novel current.
Post MA, etal., FEBS Lett. 1996 Dec 9;399(1-2):177-82.
32.
GOA pipeline
RGD automated data pipeline
33.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
34.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
35.
Redistribution of Kv2.1 ion channels on spinal motoneurons following peripheral nerve injury.
Romer SH, etal., Brain Res. 2014 Feb 14;1547:1-15. doi: 10.1016/j.brainres.2013.12.012. Epub 2013 Dec 16.
36.
New modulatory alpha subunits for mammalian Shab K+ channels.
Salinas M, etal., J Biol Chem 1997 Sep 26;272(39):24371-9.
37.
The Kv2.1 K+ channel targets to the axon initial segment of hippocampal and cortical neurons in culture and in situ.
Sarmiere PD, etal., BMC Neurosci. 2008 Nov 13;9:112. doi: 10.1186/1471-2202-9-112.
38.
Identification of a cytoplasmic domain important in the polarized expression and clustering of the Kv2.1 K+ channel.
Scannevin RH, etal., J Cell Biol. 1996 Dec;135(6 Pt 1):1619-32. doi: 10.1083/jcb.135.6.1619.
39.
Properties of Kv2.1 K+ channels expressed in transfected mammalian cells.
Shi G, etal., J Biol Chem. 1994 Sep 16;269(37):23204-11.
40.
K+ channel facilitation of exocytosis by dynamic interaction with syntaxin.
Singer-Lahat D, etal., J Neurosci. 2007 Feb 14;27(7):1651-8.
41.
Direct interaction of endogenous Kv channels with syntaxin enhances exocytosis by neuroendocrine cells.
Singer-Lahat D, etal., PLoS One. 2008 Jan 2;3(1):e1381. doi: 10.1371/journal.pone.0001381.
42.
Deletion of the Kv2.1 delayed rectifier potassium channel leads to neuronal and behavioral hyperexcitability.
Speca DJ, etal., Genes Brain Behav. 2014 Apr;13(4):394-408. doi: 10.1111/gbb.12120. Epub 2014 Mar 7.
43.
An inhibitor of the Kv2.1 potassium channel isolated from the venom of a Chilean tarantula.
Swartz KJ and MacKinnon R, Neuron. 1995 Oct;15(4):941-9. doi: 10.1016/0896-6273(95)90184-1.
44.
Patterns of internal and external tetraethylammonium block in four homologous K+ channels.
Taglialatela M, etal., Mol Pharmacol. 1991 Aug;40(2):299-307.
45.
Alteration and restoration of K+ channel function by deletions at the N- and C-termini.
VanDongen AM, etal., Neuron. 1990 Oct;5(4):433-43. doi: 10.1016/0896-6273(90)90082-q.
46.
Modification of Kv2.1 K+ currents by the silent Kv10 subunits.
Vega-Saenz de Miera EC Brain Res Mol Brain Res. 2004 Apr 7;123(1-2):91-103.
47.
Cloning and expression of a novel K+ channel regulatory protein, KChAP.
Wible BA, etal., J Biol Chem 1998 May 8;273(19):11745-51.
48.
The Kv2.1 channels mediate neuronal apoptosis induced by excitotoxicity.
Yao H, etal., J Neurochem. 2009 Feb;108(4):909-19. doi: 10.1111/j.1471-4159.2008.05834.x. Epub 2008 Dec 10.
Kcnb1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 176,239,285 - 176,332,408 (-) NCBI GRCr8 mRatBN7.2 3 155,820,255 - 155,913,383 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 155,822,963 - 155,916,194 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 159,621,853 - 159,714,946 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 168,120,826 - 168,213,919 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 165,862,536 - 165,955,629 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 163,850,785 - 163,935,610 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 163,850,785 - 163,935,617 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 170,010,756 - 170,094,507 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 158,250,001 - 158,345,927 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 158,156,036 - 158,248,459 (-) NCBI Celera 3 154,408,682 - 154,493,576 (-) NCBI Celera RH 3.4 Map 3 1476.0 RGD Cytogenetic Map 3 q42 NCBI
KCNB1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 20 49,363,877 - 49,483,362 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 20 49,293,394 - 49,484,297 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 20 47,980,414 - 48,099,205 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 20 47,421,912 - 47,532,588 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 20 47,421,911 - 47,532,588 NCBI Celera 20 44,693,122 - 44,803,814 (-) NCBI Celera Cytogenetic Map 20 q13.13 NCBI HuRef 20 44,737,067 - 44,847,754 (-) NCBI HuRef CHM1_1 20 47,892,894 - 48,003,606 (-) NCBI CHM1_1 T2T-CHM13v2.0 20 51,133,489 - 51,253,649 (-) NCBI T2T-CHM13v2.0
Kcnb1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 166,937,889 - 167,032,088 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 166,937,889 - 167,032,075 (-) Ensembl GRCm39 Ensembl GRCm38 2 167,095,969 - 167,190,072 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 167,095,969 - 167,190,155 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 166,928,878 - 167,014,299 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 166,794,583 - 166,880,004 (-) NCBI MGSCv36 mm8 Celera 2 173,043,474 - 173,128,977 (-) NCBI Celera Cytogenetic Map 2 H3 NCBI cM Map 2 87.22 NCBI
Kcnb1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955445 8,680,965 - 8,774,110 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955445 8,680,979 - 8,779,662 (+) NCBI ChiLan1.0 ChiLan1.0
KCNB1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 21 55,039,862 - 55,225,053 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 20 55,032,968 - 55,218,159 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 20 45,636,371 - 45,821,536 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 20 46,761,428 - 46,885,521 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 20 46,776,274 - 46,885,521 (-) Ensembl panpan1.1 panPan2
KCNB1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 24 36,016,800 - 36,118,873 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 24 36,025,472 - 36,117,934 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 24 35,259,329 - 35,359,756 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 24 36,721,821 - 36,822,593 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 24 36,729,609 - 36,823,404 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 24 35,962,506 - 36,063,208 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 24 36,096,677 - 36,197,268 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 24 36,638,300 - 36,739,394 (-) NCBI UU_Cfam_GSD_1.0
Kcnb1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 189,373,582 - 189,447,939 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936514 4,827,127 - 4,900,707 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936514 4,827,156 - 4,902,271 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
KCNB1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 17 51,039,987 - 51,142,644 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 17 51,032,163 - 51,152,566 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 17 57,354,303 - 57,464,782 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
KCNB1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 2 14,510,176 - 14,623,054 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 2 14,510,464 - 14,619,023 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666050 62,995,224 - 63,111,025 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Kcnb1
.
Assembly: Rnor_5.0 Assembly: Rnor_6.0
Predicted Target Of
Count of predictions: 109 Count of miRNA genes: 89 Interacting mature miRNAs: 96 Transcripts: ENSRNOT00000074023 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
12879876 Bw182 Body weight QTL 182 0.003 body mass (VT:0001259) body weight (CMO:0000012) 3 145925360 166177555 Rat 2301411 Bp320 Blood pressure QTL 320 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 145925360 166177555 Rat 2312673 Scl63 Serum cholesterol level QTL 63 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 3 98535255 168026850 Rat 1300113 Bp176 Blood pressure QTL 176 3.9 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 145956084 157309487 Rat 12879872 Cm97 Cardiac mass QTL 97 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 3 145925360 166177555 Rat 1598877 Bp285 Blood pressure QTL 285 1.5 0.03 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 120538241 165538241 Rat 1578653 Vnigr3 Vascular neointimal growth QTL 3 3.1 artery morphology trait (VT:0002191) artery neointimal hyperplastic lesion area (CMO:0001414) 3 130656562 169034231 Rat 12879873 Cm96 Cardiac mass QTL 96 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 3 145925360 166177555 Rat 2302373 Gluco39 Glucose level QTL 39 5.01 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 3 98535386 161695835 Rat 12879874 Cm98 Cardiac mass QTL 98 0.005 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 3 145925360 166177555 Rat 1298068 Bp167 Blood pressure QTL 167 0.004 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 141074471 169034231 Rat 12879875 Kidm64 Kidney mass QTL 64 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 3 145925360 166177555 Rat 70216 Cm14 Cardiac mass QTL 14 2.1 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 31172320 163586636 Rat 2298477 Eau4 Experimental allergic uveoretinitis QTL 4 0.0011 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 3 137398739 169034231 Rat 8552791 Vie2 Viral induced encephalitis QTL 2 4.1 brain integrity trait (VT:0010579) encephalitis incidence/prevalence measurement (CMO:0002361) 3 145956084 169034231 Rat 1581568 Rf53 Renal function QTL 53 urine total protein amount (VT:0000032) urine protein excretion rate to body weight ratio (CMO:0001099) 3 56395968 161299569 Rat 2317883 Alcrsp26 Alcohol response QTL 26 1.8 0.63 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 3 145526770 169034231 Rat 1578754 Stresp16 Stress response QTL 16 4 0.001 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 3 112681431 157681431 Rat 1331726 Bp208 Blood pressure QTL 208 3.129 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 141339013 162184794 Rat 1598854 Memor10 Memory QTL 10 2 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 3 145956084 161299569 Rat 9589106 Insul23 Insulin level QTL 23 13.86 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 3 131635904 169034231 Rat 10755461 Coatc16 Coat color QTL 16 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 3 122438700 167438700 Rat 8662816 Vetf4 Vascular elastic tissue fragility QTL 4 4 renal artery integrity trait (VT:0010642) number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563) 3 59242096 157323038 Rat 1559282 Emca5 Estrogen-induced mammary cancer QTL 5 3.9 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 3 43827364 169034231 Rat 2303620 Vencon4 Ventilatory control QTL 4 3.9 respiration trait (VT:0001943) tidal volume (CMO:0000222) 3 127162703 168026850 Rat 631841 Niddm39 Non-insulin dependent diabetes mellitus QTL 39 3.36 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 94856903 159898684 Rat 1576306 Schws3 Schwannoma susceptibility QTL 3 0.001 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 3 118839124 163839124 Rat 1300159 Kidm4 Kidney mass QTL 4 3.83 kidney mass (VT:0002707) right kidney wet weight to body weight ratio (CMO:0001953) 3 121056165 157309487 Rat 2312659 Slep7 Serum leptin concentration QTL 7 0.001 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 3 98535255 168026850 Rat 631673 Iddm13 Insulin dependent diabetes mellitus QTL 13 1.3 0.663 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 3 130193298 161695983 Rat 1578666 Vnigr1 Vascular neointimal growth QTL 1 4.6 artery morphology trait (VT:0002191) artery lumen area (CMO:0001409) 3 149040888 168026850 Rat 1578656 Vnigr2 Vascular neointimal growth QTL 2 4.2 artery morphology trait (VT:0002191) lesioned artery residual lumen area (CMO:0001417) 3 130656562 169034231 Rat 8552952 Pigfal13 Plasma insulin-like growth factor 1 level QTL 13 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 3 138799500 169034231 Rat 12879871 Am7 Aortic mass QTL 7 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 3 145925360 166177555 Rat 631541 Bp81 Blood pressure QTL 81 4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 124122556 169034231 Rat 2312670 Bw94 Body weight QTL 94 0.01 inguinal fat pad mass (VT:0010424) inguinal fat pad weight to body weight ratio (CMO:0001253) 3 98535255 168026850 Rat
Kcnb1
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 3 176,247,928 - 176,248,040 (+) Marker Load Pipeline mRatBN7.2 3 155,828,898 - 155,829,009 (+) MAPPER mRatBN7.2 Rnor_6.0 3 163,851,935 - 163,852,045 NCBI Rnor6.0 Rnor_5.0 3 170,011,906 - 170,012,016 UniSTS Rnor5.0 Celera 3 154,409,832 - 154,409,942 UniSTS Cytogenetic Map 3 q42 UniSTS
RH131835
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 155,827,817 - 155,827,998 (+) MAPPER mRatBN7.2 Rnor_6.0 3 163,850,854 - 163,851,034 NCBI Rnor6.0 Rnor_5.0 3 170,010,825 - 170,011,005 UniSTS Rnor5.0 RGSC_v3.4 3 158,250,070 - 158,250,252 UniSTS RGSC3.4 Celera 3 154,408,751 - 154,408,931 UniSTS RH 3.4 Map 3 1473.5 UniSTS Cytogenetic Map 3 q42 UniSTS
RH94649
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 155,827,783 - 155,827,958 (+) MAPPER mRatBN7.2 Rnor_6.0 3 163,850,820 - 163,850,994 NCBI Rnor6.0 Rnor_5.0 3 170,010,791 - 170,010,965 UniSTS Rnor5.0 RGSC_v3.4 3 158,250,036 - 158,250,211 UniSTS RGSC3.4 Celera 3 154,408,717 - 154,408,891 UniSTS RH 3.4 Map 3 1476.0 UniSTS Cytogenetic Map 3 q42 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
72
71
40
25
40
6
199
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000074023 ⟹ ENSRNOP00000065961
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 155,822,963 - 155,916,194 (-) Ensembl Rnor_6.0 Ensembl 3 163,850,785 - 163,935,617 (-) Ensembl
RefSeq Acc Id:
NM_013186 ⟹ NP_037318
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 176,239,285 - 176,332,408 (-) NCBI mRatBN7.2 3 155,820,255 - 155,913,383 (-) NCBI Rnor_6.0 3 163,850,785 - 163,935,610 (-) NCBI Rnor_5.0 3 170,010,756 - 170,094,507 (-) NCBI RGSC_v3.4 3 158,250,001 - 158,345,927 (-) RGD Celera 3 154,408,682 - 154,493,576 (-) RGD
Sequence:
AATTCCGGTCGCTGGTCTGGCATGACGAAGCATGGCTCGCGCTCCACCAGCTCGCTGCCGCCCGAGCCCATGGAGATCGTGCGCAGCAAGGCGTGCTCGCGCCGGGTGCGCCTCAACGTCGGGGGCCT
hide sequence
RefSeq Acc Id:
XR_010064569
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 176,239,285 - 176,332,214 (-) NCBI
RefSeq Acc Id:
NP_037318 ⟸ NM_013186
- UniProtKB:
P15387 (UniProtKB/Swiss-Prot), A6JXI9 (UniProtKB/TrEMBL), A0A0H2UI34 (UniProtKB/TrEMBL)
- Sequence:
MTKHGSRSTSSLPPEPMEIVRSKACSRRVRLNVGGLAHEVLWRTLDRLPRTRLGKLRDCNTHDSLLQVCDDYSLEDNEYFFDRHPGAFTSILNFYRTGRLHMMEEMCALSFSQELDYWGIDEIYLESC
hide sequence
Ensembl Acc Id:
ENSRNOP00000065961 ⟸ ENSRNOT00000074023
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-02-11
Kcnb1
potassium voltage-gated channel subfamily B member 1
Kcnb1
potassium channel, voltage gated Shab-related subfamily B, member 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2015-01-26
Kcnb1
potassium channel, voltage gated Shab-related subfamily B, member 1
Kcnb1
potassium voltage gated channel, Shab-related subfamily, member 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-06-10
Kcnb1
Potassium voltage gated channel, Shab-related subfamily, member 1
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_product
member of the delayed rectifier class of channels
728957
