Symbol:
KCNB1
Name:
potassium voltage-gated channel subfamily B member 1
RGD ID:
13845113
Description:
ENCODES a protein that exhibits delayed rectifier potassium channel activity (ortholog); outward rectifier potassium channel activity (ortholog); protein heterodimerization activity (ortholog); INVOLVED IN action potential (ortholog); cellular response to calcium ion (ortholog); cellular response to glucose stimulus (ortholog); PARTICIPATES IN insulin secretion pathway; ASSOCIATED WITH developmental and epileptic encephalopathy (ortholog); developmental and epileptic encephalopathy 26 (ortholog); Diaphragmatic Hernia (ortholog); FOUND IN apical plasma membrane (ortholog); axon (ortholog); cell surface (ortholog)
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
delayed rectifier potassium channel 1; delayed rectifier potassium channel Kv2.1; DRK1; voltage-gated potassium channel subunit Kv2.1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
Sscrofa11.1 - Pig Sscrofa11.1 Assembly
Position:
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 17 51,039,987 - 51,142,644 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 17 51,032,163 - 51,152,566 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 17 57,354,303 - 57,464,782 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Biological Process
action potential (IBA,IEA,ISS) cellular response to calcium ion (ISO) cellular response to glucose stimulus (IEA,ISS) cellular response to nutrient levels (ISS) clustering of voltage-gated potassium channels (ISO) exocytosis (IEA) glucose homeostasis (IEA,ISS) glutamate receptor signaling pathway (ISS) monoatomic ion transmembrane transport (IEA) monoatomic ion transport (IEA) negative regulation of insulin secretion (IEA,ISS) positive regulation of calcium ion-dependent exocytosis (ISS) positive regulation of catecholamine secretion (ISS) positive regulation of long-term synaptic depression (IEA,ISS) positive regulation of norepinephrine secretion (ISS) positive regulation of protein targeting to membrane (IEA,ISS) potassium ion export across plasma membrane (ISO) potassium ion transmembrane transport (IBA,IEA,ISS) potassium ion transport (IEA,ISO,ISS) protein homooligomerization (IEA) protein localization to plasma membrane (ISS) regulation of action potential (IEA,ISS) regulation of motor neuron apoptotic process (ISS) response to axon injury (ISO) response to L-glutamate (ISO) transmembrane transport (IEA) vesicle docking involved in exocytosis (ISS)
Cellular Component
apical plasma membrane (ISO) axon (IBA,IEA,ISS) cell projection (IEA) cell surface (ISO) cholinergic synapse (ISO) dendrite (IEA,ISO,ISS) dendrite membrane (IBA,ISO) lateral plasma membrane (IEA,ISO) membrane (IEA) monoatomic ion channel complex (IEA) neuron projection (IEA) neuronal cell body (ISO) neuronal cell body membrane (IBA,IEA,ISO,ISS) perikaryon (IEA,ISS) perinuclear region of cytoplasm (ISO) plasma membrane (IEA,ISS) postsynaptic membrane (IBA,IEA,ISO) postsynaptic specialization membrane (ISO) proximal dendrite (ISO) sarcolemma (IEA) synapse (IEA) voltage-gated potassium channel complex (IBA,IEA,ISS)
KCNB1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 17 51,039,987 - 51,142,644 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 17 51,032,163 - 51,152,566 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 17 57,354,303 - 57,464,782 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
KCNB1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 20 49,363,877 - 49,483,362 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 20 49,293,394 - 49,484,297 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 20 47,980,414 - 48,099,205 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 20 47,421,912 - 47,532,588 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 20 47,421,911 - 47,532,588 NCBI Celera 20 44,693,122 - 44,803,814 (-) NCBI Celera Cytogenetic Map 20 q13.13 NCBI HuRef 20 44,737,067 - 44,847,754 (-) NCBI HuRef CHM1_1 20 47,892,894 - 48,003,606 (-) NCBI CHM1_1 T2T-CHM13v2.0 20 51,133,489 - 51,253,649 (-) NCBI T2T-CHM13v2.0
Kcnb1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 166,937,889 - 167,032,088 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 166,937,889 - 167,032,075 (-) Ensembl GRCm39 Ensembl GRCm38 2 167,095,969 - 167,190,072 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 167,095,969 - 167,190,155 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 166,928,878 - 167,014,299 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 166,794,583 - 166,880,004 (-) NCBI MGSCv36 mm8 Celera 2 173,043,474 - 173,128,977 (-) NCBI Celera Cytogenetic Map 2 H3 NCBI cM Map 2 87.22 NCBI
Kcnb1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 176,239,285 - 176,332,408 (-) NCBI GRCr8 mRatBN7.2 3 155,820,255 - 155,913,383 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 155,822,963 - 155,916,194 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 159,621,853 - 159,714,946 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 168,120,826 - 168,213,919 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 165,862,536 - 165,955,629 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 163,850,785 - 163,935,610 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 163,850,785 - 163,935,617 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 170,010,756 - 170,094,507 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 158,250,001 - 158,345,927 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 158,156,036 - 158,248,459 (-) NCBI Celera 3 154,408,682 - 154,493,576 (-) NCBI Celera RH 3.4 Map 3 1476.0 RGD Cytogenetic Map 3 q42 NCBI
Kcnb1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955445 8,680,965 - 8,774,110 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955445 8,680,979 - 8,779,662 (+) NCBI ChiLan1.0 ChiLan1.0
KCNB1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 21 55,039,862 - 55,225,053 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 20 55,032,968 - 55,218,159 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 20 45,636,371 - 45,821,536 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 20 46,761,428 - 46,885,521 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 20 46,776,274 - 46,885,521 (-) Ensembl panpan1.1 panPan2
KCNB1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 24 36,016,800 - 36,118,873 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 24 36,025,472 - 36,117,934 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 24 35,259,329 - 35,359,756 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 24 36,721,821 - 36,822,593 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 24 36,729,609 - 36,823,404 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 24 35,962,506 - 36,063,208 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 24 36,096,677 - 36,197,268 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 24 36,638,300 - 36,739,394 (-) NCBI UU_Cfam_GSD_1.0
Kcnb1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 189,373,582 - 189,447,939 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936514 4,827,127 - 4,900,707 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936514 4,827,156 - 4,902,271 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
KCNB1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 2 14,510,176 - 14,623,054 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 2 14,510,464 - 14,619,023 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666050 62,995,224 - 63,111,025 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Kcnb1
.
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
10
2
23
3
4
10
10
23
1
6
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSSSCT00000037438 ⟹ ENSSSCP00000032335
Type:
CODING
Position:
Pig Assembly Chr Position (strand) Source Sscrofa11.1 Ensembl 17 51,039,987 - 51,142,644 (-) Ensembl
RefSeq Acc Id:
NM_214218 ⟹ NP_999383
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Pig Assembly Chr Position (strand) Source Sscrofa11.1 17 51,040,871 - 51,142,636 (-) NCBI
Sequence:
ATGCCGGCGGGCATGACGAAGCATGGCTCCCGCTCCACCAGCTCGCTGCCACCCGAGCCCATGGAGATTGTGCGCAGCAAGGCGTGCTCCAGGCGCGTCCGCCTCAACGTTGGGGGGTTGGCGCACGA
hide sequence
RefSeq Acc Id:
XM_021077287 ⟹ XP_020932946
Type:
CODING
Position:
Pig Assembly Chr Position (strand) Source Sscrofa11.1 17 51,032,163 - 51,152,566 (-) NCBI
Sequence:
AAAAAGTTGACATTCAACACAGCAGATATTTATTTATGTCTCATGCAGACACATGAGACCAGAG
hide sequence
RefSeq Acc Id:
XM_021077288 ⟹ XP_020932947
Type:
CODING
Position:
Pig Assembly Chr Position (strand) Source Sscrofa11.1 17 51,039,983 - 51,143,574 (-) NCBI
Sequence:
GGAGGGCGGACCAGGTGGATCCCCGGGAATCTGTGCGCCCCTCCTGTCGTGGGGTAGGGGGCGC
hide sequence
RefSeq Acc Id:
XP_020932946 ⟸ XM_021077287
- Peptide Label:
isoform X1
- UniProtKB:
A0A4X1UHF7 (UniProtKB/TrEMBL), F1SBE6 (UniProtKB/TrEMBL)
- Sequence:
MPAGMTKHGSRSTSSLPPEPMEIVRSKACSRRVRLNVGGLAHEVLWRTLDRLPRTRLGKLRDCNTHDSLLEVCDDYSLDDNEYFFDRHPGAFTSILNFYRTGRLHMMEEMCALSFSQELDYWGIDEIY
hide sequence
RefSeq Acc Id:
XP_020932947 ⟸ XM_021077288
- Peptide Label:
isoform X1
- UniProtKB:
A0A4X1UHF7 (UniProtKB/TrEMBL), F1SBE6 (UniProtKB/TrEMBL)
- Sequence:
MPAGMTKHGSRSTSSLPPEPMEIVRSKACSRRVRLNVGGLAHEVLWRTLDRLPRTRLGKLRDCNTHDSLLEVCDDYSLDDNEYFFDRHPGAFTSILNFYRTGRLHMMEEMCALSFSQELDYWGIDEIY
hide sequence
RefSeq Acc Id:
NP_999383 ⟸ NM_214218
- UniProtKB:
O18868 (UniProtKB/Swiss-Prot)
- Sequence:
MPAGMTKHGSRSTSSLPPEPMEIVRSKACSRRVRLNVGGLAHEVLWRTLDRLPRTRLGKLRDCNTHDSLLEVCDDYSLDDNEYFFDRHPGAFTSILNFYRTGRLHMMEEMCALSFSQELDYWGIDEIY
hide sequence
Ensembl Acc Id:
ENSSSCP00000032335 ⟸ ENSSSCT00000037438
