Glo1 (glyoxalase 1) - Rat Genome Database

Name: Glo1
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes Projects (beta) QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Glo1 (glyoxalase 1) Rattus norvegicus

Analyze

Symbol:

Glo1

Name:

glyoxalase 1

RGD ID:

2702

Description:

Enables lactoylglutathione lyase activity. Involved in glutathione metabolic process and methylglyoxal metabolic process. Predicted to be located in cytosol; nucleoplasm; and plasma membrane. Human ortholog(s) of this gene implicated in autistic disorder; diabetic retinopathy; end stage renal disease; type 2 diabetes mellitus; and vascular disease. Orthologous to human GLO1 (glyoxalase I); PARTICIPATES IN glyoxalase metabolic pathway; Leigh disease pathway; primary hyperoxaluria type 2 pathway; INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; 3-chloropropane-1,2-diol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

aldoketomutase; glx I; glyoxalase I; glyoxylase 1; ketone-aldehyde mutase; lactoylglutathione lyase; methylglyoxalase; S-D-lactoylglutathione methylglyoxal lyase

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GLO1 (glyoxalase I)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Glo1 (glyoxalase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Glo1 (glyoxalase I)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GLO1 (glyoxalase I)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GLO1 (glyoxalase I)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Glo1 (glyoxalase I)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GLO1 (glyoxalase I)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GLO1 (glyoxalase I)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Glo1 (glyoxalase I)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	SERPINB1 (serpin family B member 1)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Glo1 (glyoxalase 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	GLO1 (glyoxalase I)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	glo1 (glyoxalase 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	GLO1	Alliance	DIOPT (OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Glo1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	glo1	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	20	8,663,617 - 8,681,661 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	8,662,801 - 8,681,649 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	20	9,355,240 - 9,374,295 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	8,716,413 - 8,735,468 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	9,192,465 - 9,211,480 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	9,273,589 - 9,291,608 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	9,273,594 - 9,291,610 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	20	11,461,655 - 11,479,690 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	20	8,900,984 - 8,919,001 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	20	8,901,210 - 8,919,228 (-)	NCBI
Celera	20	10,191,302 - 10,209,289 (-)	NCBI		Celera
Cytogenetic Map	20	p12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

anxiety disorder (ISO)

autistic disorder (ISO)

depressive disorder (ISO)

Diabetes Complications (ISO)

Diabetic Nephropathies (ISO)

diabetic retinopathy (ISO)

end stage renal disease (ISO)

esophagus squamous cell carcinoma (ISO)

genetic disease (ISO)

Kidney Reperfusion Injury (IMP)

melanoma (ISO)

type 2 diabetes mellitus (ISO)

vascular disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-trans-(S)-allethrin (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (EXP,ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

3,4-dihydroxybenzaldehyde (ISO)

3,4-dihydroxybenzoic acid (ISO)

3-chloropropane-1,2-diol (EXP)

3H-1,2-dithiole-3-thione (ISO)

4,4'-sulfonyldiphenol (EXP)

4-hydroxycoumarin (ISO)

acemetacin (ISO)

aflatoxin B1 (ISO)

aldehydo-D-glucose (EXP,ISO)

all-trans-retinoic acid (ISO)

alpha-D-galactose (ISO)

AM-251 (EXP)

aminoguanidine (EXP,ISO)

antirheumatic drug (ISO)

apocynin (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

Benoxacor (ISO)

benzo[a]pyrene (EXP,ISO)

benzo[b]fluoranthene (ISO)

Bergenin (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (EXP)

cadmium dichloride (EXP)

CGP 52608 (ISO)

chlordecone (ISO)

chloropicrin (ISO)

chlorpyrifos (ISO)

clobetasol (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

crocin-1 (ISO)

CU-O LINKAGE (ISO)

Cuprizon (ISO)

curcumin (ISO)

cyclosporin A (ISO)

D-glucose (EXP,ISO)

desferrioxamine B (ISO)

diarsenic trioxide (ISO)

dicrotophos (ISO)

dihydroxyacetone (ISO)

dioxygen (ISO)

diuron (ISO)

doxorubicin (ISO)

enzyme inhibitor (ISO)

ethanol (ISO)

ferric ammonium citrate (ISO)

fluoxetine (ISO)

galactose (ISO)

galangin (ISO)

gliclazide (EXP)

glucose (EXP,ISO)

glycolaldehyde (EXP)

haloperidol (ISO)

Honokiol (ISO)

indometacin (ISO)

inulin (ISO)

ivermectin (ISO)

L-ascorbic acid (ISO)

L-methionine (ISO)

limonene (ISO)

lipopolysaccharide (ISO)

Magnolol (EXP)

mangiferin (EXP)

methamphetamine (EXP)

methidathion (ISO)

methylglyoxal (EXP,ISO)

monascin (ISO)

Morroniside (EXP)

N-methyl-4-phenylpyridinium (ISO)

N-nitrosodiethylamine (ISO)

nicotinamide (EXP)

okadaic acid (ISO)

oxaliplatin (EXP)

p-menthan-3-ol (ISO)

paracetamol (EXP,ISO)

perfluorooctane-1-sulfonic acid (ISO)

pirinixic acid (ISO)

pterostilbene (ISO)

quercetin (ISO)

resveratrol (EXP,ISO)

sarin (EXP)

silicon dioxide (ISO)

sodium arsenite (ISO)

sodium fluoride (ISO)

streptozocin (EXP)

sulforaphane (ISO)

sulindac (ISO)

temozolomide (ISO)

tetrachloromethane (ISO)

thapsigargin (ISO)

tolmetin (ISO)

topotecan (EXP)

trichloroethene (ISO)

troglitazone (EXP,ISO)

uranium atom (ISO)

valproic acid (ISO)

zomepirac (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

glutathione metabolic process (IDA)

methylglyoxal metabolic process (IDA)

negative regulation of apoptotic process (ISO,ISS)

osteoclast differentiation (ISO)

regulation of transcription by RNA polymerase II (ISO)

Cellular Component

cytosol (IEA,ISO)

nucleoplasm (IEA,ISO)

plasma membrane (IEA,ISO)

Molecular Function

lactoylglutathione lyase activity (IDA,ISO,ISS)

protein binding (ISO)

zinc ion binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

glyoxalase metabolic pathway (ISO)

Leigh disease pathway (ISO)

primary hyperoxaluria type 2 pathway (ISO)

pyruvate decarboxylase deficiency pathway (ISO)

pyruvate dehydrogenase E1 deficiency pathway (ISO)

pyruvate kinase deficiency of red cells pathway (ISO)

pyruvate metabolic pathway (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Distribution of glyoxalase I polymorphism among Zuni Indians: the Zuni Kidney Project.	Degaffe GH, etal., J Diabetes Complications. 2008 Jul-Aug;22(4):267-72. doi: 10.1016/j.jdiacomp.2007.06.010. Epub 2008 Apr 16.
2.	A419C (E111A) polymorphism of the glyoxalase I gene and vascular complications in chronic hemodialysis patients.	Kalousova M, etal., Ann N Y Acad Sci. 2008 Apr;1126:268-71. Epub 2007 Dec 13.
3.	Genetic predisposition to advanced glycation end products toxicity is related to prognosis of chronic hemodialysis patients.	Kalousova M, etal., Kidney Blood Press Res. 2010;33(1):30-6. doi: 10.1159/000285845. Epub 2010 Feb 23.
4.	Contents of D-lactate and its related metabolites as well as enzyme activities in the liver, muscle and blood plasma of aging rats.	Kawase M, etal., Mech Ageing Dev. 1995 Sep 29;84(1):55-63.
5.	Changes in concentrations of methylglyoxal, D-lactate and glyoxalase activities in liver and plasma of rats fed a 3'-methyl-4-dimethylaminoazobenzene-rich diet.	Kawase M, etal., Res Exp Med (Berl). 1996;196(4):251-9.
6.	Glyoxalase I overexpression ameliorates renal ischemia-reperfusion injury in rats.	Kumagai T, etal., Am J Physiol Renal Physiol. 2009 Apr;296(4):F912-21. doi: 10.1152/ajprenal.90575.2008. Epub 2009 Feb 11.
7.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
8.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
9.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
10.	GOA pipeline	RGD automated data pipeline
11.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
13.	Case-control and family-based association studies of candidate genes in autistic disorder and its endophenotypes: TPH2 and GLO1.	Sacco R, etal., BMC Med Genet. 2007 Mar 8;8:11.
14.	Maillard reactions in lens proteins: methylglyoxal-mediated modifications in the rat lens.	Shamsi FA, etal., Exp Eye Res. 2000 Mar;70(3):369-80.
15.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
16.	Association of two glyoxalase I gene polymorphisms with nephropathy and retinopathy in Type 2 diabetes.	Wu JC, etal., J Endocrinol Invest. 2011 Nov;34(10):e343-8. doi: 10.3275/7856. Epub 2011 Jul 7.

Additional References at PubMed

PMID:566476	PMID:910130	PMID:1914521	PMID:7323947	PMID:7333654	PMID:7444718	PMID:9705294	PMID:10807791	PMID:11489834	PMID:15489334	PMID:17670746	PMID:18695250
PMID:19056867	PMID:22171037	PMID:22859292	PMID:22893478	PMID:23376485	PMID:23533145	PMID:23717693	PMID:24498315	PMID:27296676	PMID:28231326	PMID:28241483	PMID:31420161
PMID:31505169

Genomics

Comparative Map Data

Glo1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	20	8,663,617 - 8,681,661 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	8,662,801 - 8,681,649 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	20	9,355,240 - 9,374,295 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	8,716,413 - 8,735,468 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	9,192,465 - 9,211,480 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	9,273,589 - 9,291,608 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	9,273,594 - 9,291,610 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	20	11,461,655 - 11,479,690 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	20	8,900,984 - 8,919,001 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	20	8,901,210 - 8,919,228 (-)	NCBI
Celera	20	10,191,302 - 10,209,289 (-)	NCBI		Celera
Cytogenetic Map	20	p12	NCBI

GLO1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	38,675,925 - 38,703,145 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	38,675,925 - 38,703,145 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	38,643,701 - 38,670,921 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	38,751,679 - 38,778,930 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	6	38,751,697 - 38,778,895	NCBI
Celera	6	40,197,188 - 40,224,451 (-)	NCBI		Celera
Cytogenetic Map	6	p21.2	NCBI
HuRef	6	38,361,494 - 38,388,795 (-)	NCBI		HuRef
CHM1_1	6	38,645,758 - 38,673,043 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	6	38,500,476 - 38,527,717 (-)	NCBI		T2T-CHM13v2.0

Glo1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	30,811,835 - 30,831,633 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	17	30,803,910 - 30,845,845 (-)	Ensembl		GRCm39 Ensembl
GRCm38	17	30,592,861 - 30,612,659 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	30,584,936 - 30,626,871 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	17	30,729,806 - 30,749,604 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	17	29,807,695 - 29,826,707 (-)	NCBI		MGSCv36	mm8
MGSCv36	17	30,319,873 - 30,339,606 (-)	NCBI		MGSCv36	mm8
Celera	2	35,035,059 - 35,036,311 (+)	NCBI		Celera
Cytogenetic Map	17	A3.3	NCBI
cM Map	17	15.69	NCBI

Glo1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955437	4,728,709 - 4,749,834 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955437	4,728,709 - 4,749,834 (+)	NCBI	ChiLan1.0	ChiLan1.0

GLO1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	6	49,025,050 - 49,052,295 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	38,247,881 - 38,275,098 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	39,434,750 - 39,461,971 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	39,434,746 - 39,461,971 (-)	Ensembl	panpan1.1		panPan2

GLO1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	12	7,584,141 - 7,609,615 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	12	7,585,531 - 7,609,550 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	12	7,600,020 - 7,625,500 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	12	8,048,947 - 8,078,703 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	12	8,049,266 - 8,078,652 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	12	7,587,392 - 7,612,855 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	12	7,664,812 - 7,690,339 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	12	7,770,412 - 7,795,893 (-)	NCBI		UU_Cfam_GSD_1.0

Glo1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	43,029,925 - 43,049,491 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936476	20,910,629 - 20,930,295 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936476	20,910,696 - 20,928,583 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GLO1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	34,157,535 - 34,183,528 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	7	34,156,194 - 34,183,560 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	39,244,145 - 39,271,510 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GLO1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	17	33,446,134 - 33,472,240 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	17	33,446,145 - 33,473,699 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666044	38,633,681 - 38,659,829 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Glo1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624754	19,533,719 - 19,551,794 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624754	19,533,730 - 19,549,483 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Glo1
134 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	46
Count of miRNA genes:	37
Interacting mature miRNAs:	44
Transcripts:	ENSRNOT00000000650
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354642	Despr15	Despair related QTL 15		0.0027	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	20	1	24159021	Rat
1600382	Edcs3	Endometrial carcinoma susceptibility QTL3	3.5	0.003	uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	20	1	25159026	Rat
2317851	Alcrsp22	Alcohol response QTL 22	3.2	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27339237	Rat
1641893	Alcrsp7	Alcohol response QTL 7			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27339237	Rat
8694189	Bw153	Body weight QTL 153	3.13	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	20	1	29191651	Rat
9590275	Scort15	Serum corticosterone level QTL 15	3.48	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	29191651	Rat
7411650	Foco23	Food consumption QTL 23	20.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	29191651	Rat
9590109	Sffal8	Serum free fatty acids level QTL 8	5.32	0.01	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	20	1	29191651	Rat
9589155	Insul32	Insulin level QTL 32	6.38	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	20	1	29191651	Rat
6893685	Bw111	Body weight QTL 111	2.7	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	20	1	32578807	Rat
7411668	Foco32	Food consumption QTL 32	8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	36600972	Rat
9590252	Scort12	Serum corticosterone level QTL 12	20.46	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	36600972	Rat
2305926	Iddm37	Insulin dependent diabetes mellitus QTL 37	6		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	20	1527842	46527842	Rat
1641915	Colcr9	Colorectal carcinoma resistance QTL 9	2.97	0.0024	intestine integrity trait (VT:0010554)	benign colorectal tumor number (CMO:0001795)	20	1530655	46530655	Rat
1598816	Memor12	Memory QTL 12	2.4		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	20	2606836	47606836	Rat
2317057	Aia27	Adjuvant induced arthritis QTL 27	2.83		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	20	2892597	26381954	Rat
1300152	Bp195	Blood pressure QTL 195	3.46		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	20	3621649	9243559	Rat
1331772	Cdexp2	CD45RC expression in CD8 T cells QTL 2	5.7		CD8-positive T cell quantity (VT:0008077)	blood CD45RC(high) CD8 T cell count to CD45RC(low) CD8 T cell count ratio (CMO:0001990)	20	3621649	10078919	Rat
61432	Cia1	Collagen induced arthritis QTL 1			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	20	3621656	14101050	Rat
4889857	Pur27	Proteinuria QTL 27	12.2	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	20	4606607	17617956	Rat
1558640	Prcs2	Prostate cancer susceptibility QTL 2	3.3		prostate integrity trait (VT:0010571)	percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943)	20	4606607	17617956	Rat
70154	Insul2	Insulin level QTL 2	3.75		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	20	6691706	17489458	Rat
1581577	Pur15	Proteinuria QTL 15	4.38	0.0002	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	20	8042410	17617956	Rat
4889870	Pur30	Proteinuria QTL 30	19	0.005	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	20	8042410	29322208	Rat

Markers in Region

RH133855

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	8,663,915 - 8,664,100 (+)	MAPPER	mRatBN7.2
Rnor_6.0	20	9,273,888 - 9,274,072	NCBI	Rnor6.0
Rnor_5.0	20	11,461,954 - 11,462,138	UniSTS	Rnor5.0
RGSC_v3.4	20	8,901,283 - 8,901,467	UniSTS	RGSC3.4
Celera	20	10,191,601 - 10,191,785	UniSTS
RH 3.4 Map	20	112.4	UniSTS
Cytogenetic Map	20	p12	UniSTS

RH138820

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	8,678,463 - 8,678,655 (+)	MAPPER	mRatBN7.2
Rnor_6.0	20	9,288,427 - 9,288,618	NCBI	Rnor6.0
Rnor_5.0	20	11,476,493 - 11,476,684	UniSTS	Rnor5.0
RGSC_v3.4	20	8,915,821 - 8,916,012	UniSTS	RGSC3.4
Celera	20	10,206,109 - 10,206,300	UniSTS
RH 3.4 Map	20	110.9	UniSTS
Cytogenetic Map	20	p12	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	43	57	41	19	41	8	11	74	35	41	11	8
Low
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_207594	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039098541	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC061570	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473988	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ210595	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220772	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000324	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000000650 ⟹ ENSRNOP00000000650

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	20	8,662,801 - 8,681,649 (-)	Ensembl
Rnor_6.0 Ensembl	20	9,273,594 - 9,291,610 (-)	Ensembl

RefSeq Acc Id:

NM_207594 ⟹ NP_997477

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	20	8,663,617 - 8,681,645 (-)	NCBI
Rnor_6.0	20	9,273,589 - 9,291,608 (-)	NCBI
Rnor_5.0	20	11,461,655 - 11,479,690 (-)	NCBI
RGSC_v3.4	20	8,900,984 - 8,919,001 (-)	RGD
Celera	20	10,191,302 - 10,209,289 (-)	RGD

Sequence:

show sequence

CTATAGCAAAGGCGGCCCACGGTCCTTTCGGAGCGTGTCGCCGGCTTGTTTGCTTGCAGCGATT
CTCCAGGGCAGCCATGGCAGAGCCACAGCCAGCGTCCAGTGGTCTTACTGATGAGGCCGCCCTC
AGTTGCTGCTCTGACCCGGATCCAAGCACCAAGGATTTTCTACTGCAGCAAACGATGCTGAGAA
TTAAGGACCCTAAGAAGTCCCTGGATTTTTATACGAGGGTTCTTGGACTGACGCTTCTCCAGAA
GCTTGACTTCCCTTCTATGAAGTTCTCGCTCTATTTCTTAGCGTACGAGGATAAGAACGATATC
CCCAAGGACAAGACGGAGAGGACAGCGTGGGCTTTTTCCAGAAAGGCTACCCTGGAGCTCACAC
ACAACTGGGGCACTGAAGATGACGAGACGCAGAGTTACCACAACGGCAACTCGGACCCTCGGGG
ATTTGGCCACATTGGGATTGCTGTTCCTGATGTCTACGAGGCCTGTAAGAGATTTGAAGAACTA
GGTGTCAAGTTTGTGAAGAAGCCTGATGATGGGAAAATGAAAGGTCTGGCGTTCGTTCAAGATC
CTGATGGCTACTGGATTGAAATTCTGAATCCTAACAAAATGGCAACAATTATTTAGTTCCGTGA
TGGAGACAGCGGGGACAAGAAACATCGTGATTCGAGATGCTGAGATGCTGAAGCACCAGAAGTG
TTGGGGGACTGATGGGTCTTTGCTCCAGTTCAAGCCATTCTGAAATCCTTTTCATTGTCCTGAT
TCAGTGGGTTTAAAAAATCTCCCCTCTGTTAAGCCAACCTAGTTTTCAAGTAGCAATTTATCTT
ACGACCTTGACAAAGTTGTGTGAGTTTACTTTTAAGATAATAATTAGAACTGTTCTCCTGAGAG
ACCACATGTGCTGCTGCCTGCCTCTTAAAGACTACTCCAGTCTGTTTCTGATTCATCATTTAAG
ATTGCGTTTCAAACGTTTCTTTTTGGGGTCTGCTACCTTCTGGGCTTTCGGTTCCTCAGAGATA
AGTTTTCATAAAGGGAAGCAGAGAACAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039098541 ⟹ XP_038954469

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	20	8,668,003 - 8,681,661 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_997477	(Get FASTA)	NCBI Sequence Viewer
	XP_038954469	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH61570	(Get FASTA)	NCBI Sequence Viewer
	EDL96989	(Get FASTA)	NCBI Sequence Viewer
	Q6P7Q4	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_997477 ⟸ NM_207594
- UniProtKB:	Q6P7Q4 (UniProtKB/Swiss-Prot), A6JJX3 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAEPQPASSGLTDEAALSCCSDPDPSTKDFLLQQTMLRIKDPKKSLDFYTRVLGLTLLQKLDFP SMKFSLYFLAYEDKNDIPKDKTERTAWAFSRKATLELTHNWGTEDDETQSYHNGNSDPRGFGHI GIAVPDVYEACKRFEELGVKFVKKPDDGKMKGLAFVQDPDGYWIEILNPNKMATII hide sequence

RefSeq Acc Id:

ENSRNOP00000000650 ⟸ ENSRNOT00000000650

RefSeq Acc Id:	XP_038954469 ⟸ XM_039098541
- Peptide Label:	isoform X1

Protein Domains

VOC

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6P7Q4-F1-model_v2	AlphaFold	Q6P7Q4	1-184	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2702	AgrOrtholog
BioCyc Gene	G2FUF-4345	BioCyc
Ensembl Genes	ENSRNOG00000000541	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Protein	ENSRNOP00000000650	ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000000650	ENTREZGENE, UniProtKB/Swiss-Prot
Gene3D-CATH	2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1	UniProtKB/TrEMBL, UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:6918143	IMAGE-MGC_LOAD
InterPro	Glyas_Bleomycin-R_OHBP_Dase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Glyas_Fos-R_dOase_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Glyoxalase_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Glyoxalase_1_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	VOC	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:294320	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72954	IMAGE-MGC_LOAD
NCBI Gene	294320	ENTREZGENE
PANTHER	LACTOYLGLUTATHIONE LYASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	LACTOYLGLUTATHIONE LYASE GLYOXALASE I	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Glyoxalase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Glo1	PhenoGen
PROSITE	GLYOXALASE_I_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GLYOXALASE_I_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	VOC	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase	UniProtKB/TrEMBL, UniProtKB/Swiss-Prot
UniProt	A6JJX3	ENTREZGENE, UniProtKB/TrEMBL
	LGUL_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-02-15	Glo1	glyoxalase 1	Glo1	glyoxylase 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-06-10	Glo1	Glyoxalase 1			Symbol and Name status set to approved	70586	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)