Cpe (carboxypeptidase E) - Rat Genome Database

Name: Cpe
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) RatMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Cpe (carboxypeptidase E) Rattus norvegicus

Analyze

Symbol:

Cpe

Name:

carboxypeptidase E

RGD ID:

2394

Description:

Enables carboxypeptidase activity; cobalt ion binding activity; and protein domain specific binding activity. Involved in negative regulation of branching morphogenesis of a nerve; peptide catabolic process; and peptide hormone processing. Located in several cellular components, including perikaryon; secretory granule; and synaptic membrane. Human ortholog(s) of this gene implicated in type 2 diabetes mellitus. Orthologous to human CPE (carboxypeptidase E); PARTICIPATES IN melanocortin system pathway; type 1 diabetes mellitus pathway; INTERACTS WITH 17alpha-ethynylestradiol; 2,2',5,5'-tetrachlorobiphenyl; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

CARBE; carboxypeptidase H; Cph; enkephalin convertase; MGC93638; prohormone-processing carboxypeptidase

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CPE (carboxypeptidase E)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):	Cpe (carboxypeptidase E)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Cpe (carboxypeptidase E)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CPE (carboxypeptidase E)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CPE (carboxypeptidase E)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Cpe (carboxypeptidase E)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CPE (carboxypeptidase E)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CPE (carboxypeptidase E)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Cpe (carboxypeptidase E)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	CPE (carboxypeptidase E)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Cpe (carboxypeptidase E)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cpe (carboxypeptidase E)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	egl-21	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	cpd-2	Alliance	DIOPT (Ensembl Compara\|OMA\|PANTHER)

Candidate Gene For:

Niddm38

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	16	25,030,276 - 25,142,231 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	25,030,276 - 25,142,233 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	16	28,395,455 - 28,506,245 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	16	31,829,813 - 31,940,599 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	16	27,784,887 - 27,896,603 (+)	NCBI	Rnor_WKY
Rnor_6.0	16	26,906,716 - 27,014,811 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	26,906,716 - 27,014,813 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	26,785,642 - 26,888,882 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.1	16	26,748,589 - 26,748,986 (+)	NCBI
Celera	16	25,114,655 - 25,226,598 (+)	NCBI		Celera
RH 3.4 Map	16	298.1	RGD
Cytogenetic Map	16	p13	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

BDV Syndrome (ISO)

endocrine system disease (ISO)

Insulin Resistance (ISO)

Lung Neoplasms (ISO)

Memory Disorders (ISO)

morbid obesity (ISO)

obesity (ISO)

type 2 diabetes mellitus (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,2',5,5'-tetrachlorobiphenyl (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3,7-dihydropurine-6-thione (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxynon-2-enal (ISO)

4-hydroxyphenyl retinamide (ISO)

5-azacytidine (ISO)

5-fluorouracil (ISO)

aflatoxin B1 (ISO)

alendronic acid (EXP)

all-trans-retinoic acid (ISO)

aristolochic acid (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

beta-naphthoflavone (EXP)

bisphenol A (EXP,ISO)

cadmium atom (ISO)

cadmium dichloride (EXP,ISO)

carbon nanotube (ISO)

casticin (ISO)

chlordecone (ISO)

chromium atom (ISO)

cisplatin (EXP,ISO)

clobetasol (ISO)

copper atom (EXP,ISO)

copper(0) (EXP,ISO)

copper(II) sulfate (ISO)

coumestrol (ISO)

cyclosporin A (ISO)

cylindrospermopsin (ISO)

DDT (EXP)

dexamethasone (EXP,ISO)

diarsenic trioxide (ISO)

dibenz[a,h]anthracene (ISO)

dibutyl phthalate (EXP,ISO)

dioxygen (ISO)

diuron (EXP)

dorsomorphin (ISO)

doxorubicin (ISO)

ethanol (ISO)

flavonoids (EXP)

folic acid (ISO)

fonofos (ISO)

fulvestrant (ISO)

furan (EXP)

genistein (EXP,ISO)

gentamycin (EXP)

hydroquinone O-beta-D-glucopyranoside (ISO)

indometacin (ISO)

irinotecan (ISO)

kojic acid (ISO)

lead(0) (ISO)

lead(2+) (ISO)

mercaptopurine (EXP)

mercury dibromide (ISO)

methacholine chloride (ISO)

methylmercury chloride (ISO)

mifepristone (EXP)

morphine (ISO)

N-acetyl-L-cysteine (ISO)

N-nitrosodiethylamine (EXP)

nickel atom (ISO)

nickel sulfate (ISO)

organophosphorus compound (ISO)

oxaliplatin (EXP)

ozone (ISO)

panobinostat (ISO)

paracetamol (EXP)

parathion (ISO)

PCB138 (EXP)

phenobarbital (ISO)

phenylmercury acetate (ISO)

potassium chromate (ISO)

propiconazole (ISO)

purine-6-thiol (EXP)

raloxifene (EXP)

reserpine (EXP)

rotenone (EXP)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium arsenate (ISO)

sotorasib (ISO)

sunitinib (ISO)

tamoxifen (ISO)

temozolomide (ISO)

terbufos (ISO)

tert-butyl hydroperoxide (ISO)

testosterone (EXP)

tetrachloromethane (ISO)

titanium dioxide (ISO)

topotecan (EXP)

trametinib (ISO)

trichostatin A (ISO)

trovafloxacin (ISO)

tunicamycin (ISO)

valproic acid (ISO)

vancomycin (ISO)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cardiac left ventricle morphogenesis (IEA,ISO)

enkephalin processing (IDA)

insulin processing (IDA,IEA,ISO)

negative regulation of branching morphogenesis of a nerve (IMP)

peptide catabolic process (IDA)

peptide hormone processing (TAS)

peptide hormone secretion (IEA,ISO)

peptide metabolic process (IBA,IDA)

protein localization to membrane (IEA,ISO)

protein localization to secretory granule (IEA,ISO)

protein processing (IBA,IDA)

Wnt signaling pathway (IEA,ISO)

Cellular Component

dendrite (IDA)

dense core granule (IDA)

extracellular region (IDA)

extracellular space (IBA,IDA)

Golgi apparatus (IDA,IEA,ISO)

membrane raft (IDA)

neuronal cell body (IDA)

perikaryon (IDA)

secretory granule (IDA,ISO)

secretory granule membrane (IDA,IEA,ISO,TAS)

synaptic membrane (IDA)

transport vesicle membrane (IEA)

Molecular Function

carboxypeptidase activity (IDA,ISO)

cell adhesion molecule binding (IEA,ISO)

cobalt ion binding (IMP)

metallocarboxypeptidase activity (IBA,IEA,ISO)

molecular function activator activity (IEA,ISO)

neurexin family protein binding (IEA,ISO)

protein binding (IPI,ISO)

protein domain specific binding (IDA)

zinc ion binding (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

melanocortin system pathway (ISS)

type 1 diabetes mellitus pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Immunohistochemical expression and colocalization of somatostatin, carboxypeptidase-E and prohormone convertases 1 and 2 in rat brain.	Billova S, etal., Neuroscience. 2007 Jun 29;147(2):403-18. Epub 2007 Jun 1.
2.	NOS1AP regulates dendrite patterning of hippocampal neurons through a carboxypeptidase E-mediated pathway.	Carrel D, etal., J Neurosci. 2009 Jun 24;29(25):8248-58.
3.	Missense polymorphism in the human carboxypeptidase E gene alters enzymatic activity.	Chen H, etal., Hum Mutat. 2001 Aug;18(2):120-31.
4.	The insulin-secretory-granule carboxypeptidase H. Purification and demonstration of involvement in proinsulin processing.	Davidson HW and Hutton JC, Biochem J. 1987 Jul 15;245(2):575-82.
5.	Isolation and sequence analysis of cDNA for rat carboxypeptidase E [EC 3.4.17.10], a neuropeptide processing enzyme.	Fricker LD, etal., Mol Endocrinol 1989 Apr;3(4):666-73.
6.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
7.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
8.	Carboxypeptidase B-like converting enzyme activity in secretory granules of rat pituitary.	Hook VY and Loh YP, Proc Natl Acad Sci U S A. 1984 May;81(9):2776-80.
9.	Secretogranin III binds to cholesterol in the secretory granule membrane as an adapter for chromogranin A.	Hosaka M, etal., J Biol Chem. 2004 Jan 30;279(5):3627-34. Epub 2003 Nov 3.
10.	Interaction between secretogranin III and carboxypeptidase E facilitates prohormone sorting within secretory granules.	Hosaka M, etal., J Cell Sci. 2005 Oct 15;118(Pt 20):4785-95.
11.	Structural characterization of the rat carboxypeptidase-E gene.	Jung YK, etal., Mol Endocrinol 1991 Sep;5(9):1257-68.
12.	High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.	Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
13.	Human carboxypeptidase E. Isolation and characterization of the cDNA, sequence conservation, expression and processing in vitro.	Manser E, etal., Biochem J 1990 Apr 15;267(2):517-25.
14.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
15.	Mouse Genome Database (MGD)	Mouse Genome Database (MGD)
16.	Hyperproinsulinaemia in obese fat/fat mice associated with a carboxypeptidase E mutation which reduces enzyme activity.	Naggert JK, etal., Nat Genet. 1995 Jun;10(2):135-42.
17.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
18.	Contactin-associated protein (Caspr) 2 interacts with carboxypeptidase E in the CNS.	Oiso S, etal., J Neurochem. 2009 Apr;109(1):158-67. Epub 2009 Jan 23.
19.	A PC12 variant lacking regulated secretory organelles: aberrant protein targeting and evidence for a factor inhibiting neuroendocrine gene expression.	Pance A, etal., J Neurochem. 1999 Jul;73(1):21-30.
20.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
21.	Pro-opiomelanocortin processing in the hypothalamus: impact on melanocortin signalling and obesity.	Pritchard LE, etal., J Endocrinol 2002 Mar;172(3):411-21.
22.	Glu300 of rat carboxypeptidase E is essential for enzymatic activity but not substrate binding or routing to the regulated secretory pathway.	Qian Y, etal., J Biol Chem. 1999 Apr 23;274(17):11582-6.
23.	GOA pipeline	RGD automated data pipeline
24.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
25.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
26.	Rat preprocarboxypeptidase H. Cloning, characterization, and sequence of the cDNA and regulation of the mRNA by corticotropin-releasing factor.	Rodriguez C, etal., J Biol Chem 1989 Apr 5;264(10):5988-95.
27.	The pro region is not required for the expression or intracellular routeing of carboxypeptidase E.	Song L and Fricker LD, Biochem J. 1997 Apr 1;323 ( Pt 1):265-71.
28.	Organization of the human carboxypeptidase E gene and molecular scanning for mutations in Japanese subjects with NIDDM or obesity.	Utsunomiya N, etal., Diabetologia. 1998 Jun;41(6):701-5.
29.	The C-terminal region of carboxypeptidase E involved in membrane binding is distinct from the region involved with intracellular routing.	Varlamov O and Fricker LD, J Biol Chem. 1996 Mar 15;271(11):6077-83.
30.	Absence of carboxypeptidase E leads to adult hippocampal neuronal degeneration and memory deficits.	Woronowicz A, etal., Hippocampus. 2008;18(10):1051-63.
31.	Membrane-bound carboxypeptidase E facilitates the entry of eosinophil cationic protein into neuroendocrine cells.	Wu CM, etal., Biochem J. 2004 Sep 15;382(Pt 3):841-8.
32.	Regulation of dopamine transporter activity by carboxypeptidase E.	Zhang H, etal., Mol Brain. 2009 May 6;2:10.
33.	The developmental expression in rat of proteases furin, PC1, PC2, and carboxypeptidase E: implications for early maturation of proteolytic processing capacity.	Zheng M, etal., J Neurosci. 1994 Aug;14(8):4656-73.

Additional References at PubMed

PMID:1955501	PMID:12477932	PMID:14661109	PMID:14715715	PMID:15181368	PMID:18573344	PMID:19428990	PMID:19593212	PMID:22824791	PMID:23376485	PMID:23533145	PMID:23941827
PMID:24006456	PMID:25426952	PMID:34266900

Genomics

Comparative Map Data

Cpe
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	16	25,030,276 - 25,142,231 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	25,030,276 - 25,142,233 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	16	28,395,455 - 28,506,245 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	16	31,829,813 - 31,940,599 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	16	27,784,887 - 27,896,603 (+)	NCBI	Rnor_WKY
Rnor_6.0	16	26,906,716 - 27,014,811 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	26,906,716 - 27,014,813 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	26,785,642 - 26,888,882 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.1	16	26,748,589 - 26,748,986 (+)	NCBI
Celera	16	25,114,655 - 25,226,598 (+)	NCBI		Celera
RH 3.4 Map	16	298.1	RGD
Cytogenetic Map	16	p13	NCBI

CPE
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	165,379,008 - 165,498,547 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	4	165,361,194 - 165,498,547 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	4	166,300,160 - 166,419,699 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	166,519,538 - 166,638,926 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	4	166,657,698 - 166,777,081	NCBI
Celera	4	163,635,528 - 163,754,911 (+)	NCBI		Celera
Cytogenetic Map	4	q32.3	NCBI
HuRef	4	162,051,907 - 162,171,495 (+)	NCBI		HuRef
CHM1_1	4	166,276,542 - 166,396,001 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	4	168,724,998 - 168,844,639 (+)	NCBI		T2T-CHM13v2.0

Cpe
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	65,045,576 - 65,146,143 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	65,045,576 - 65,146,088 (-)	Ensembl		GRCm39 Ensembl
GRCm38	8	64,592,542 - 64,693,109 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	64,592,542 - 64,693,054 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	67,071,339 - 67,171,837 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	67,484,734 - 67,585,232 (-)	NCBI		MGSCv36	mm8
Celera	8	67,161,674 - 67,256,578 (-)	NCBI		Celera
Cytogenetic Map	8	B3.1	NCBI
cM Map	8	32.3	NCBI

Cpe
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955403	39,862,191 - 39,971,902 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955403	39,862,893 - 39,971,902 (-)	NCBI	ChiLan1.0	ChiLan1.0

CPE
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	4	169,658,534 - 169,781,449 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	4	169,659,007 - 169,780,739 (+)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	4	157,575,157 - 157,705,173 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

CPE
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	15	61,321,588 - 61,422,608 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	15	61,321,227 - 61,414,789 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	15	61,629,383 - 61,730,508 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	15	62,182,343 - 62,284,386 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	15	62,182,273 - 62,285,019 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	15	61,363,671 - 61,466,350 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	15	61,406,929 - 61,508,661 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	15	61,801,266 - 61,902,997 (+)	NCBI		UU_Cfam_GSD_1.0

Cpe
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404943	17,928,608 - 18,038,671 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936555	530,307 - 641,905 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936555	531,842 - 641,905 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CPE
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	8	43,565,054 - 43,696,268 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	8	43,568,744 - 43,695,475 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	8	45,475,586 - 45,592,181 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CPE
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	7	111,747,265 - 111,867,548 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	7	111,747,172 - 111,868,754 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666037	91,600,315 - 91,727,319 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cpe
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624758	11,463,012 - 11,604,224 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624758	11,464,418 - 11,603,660 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Cpe
795 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	384
Count of miRNA genes:	216
Interacting mature miRNAs:	268
Transcripts:	ENSRNOT00000064297
Prediction methods:	Microtar, Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631830	Alc7	Alcohol consumption QTL 7	2.9		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	16	1	26727669	Rat
634355	Rends4	Renal damage susceptibility QTL 4		0.05	kidney blood vessel morphology trait (VT:0000530)	organ lesion measurement (CMO:0000677)	16	1	26727669	Rat
1582235	Insul8	Insulin level QTL 8	3.3	0.0063	blood insulin amount (VT:0001560)	calculated serum insulin level (CMO:0000359)	16	1	26727669	Rat
9590151	Scort8	Serum corticosterone level QTL 8	8.45	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	16	1	30836262	Rat
2302380	Slep6	Serum leptin concentration QTL 6	3.36		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	16	1	32139025	Rat
2307172	Activ4	Activity QTL 4	3.71	0.00023	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	16	1	33418960	Rat
1354584	Despr6	Despair related QTL 6	3.1	0.0067	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	16	1	39533930	Rat
2303566	Bw90	Body weight QTL 90	2		body mass (VT:0001259)	body weight (CMO:0000012)	16	1	39533930	Rat
631561	Hcuc2	Hepatic copper content QTL 2	2.8		liver copper amount (VT:0003065)	liver total copper weight (CMO:0001507)	16	1	39533949	Rat
6903319	Bw114	Body weight QTL 114	2.7	0.0037	body mass (VT:0001259)	body weight (CMO:0000012)	16	1	43534949	Rat
7411664	Foco30	Food consumption QTL 30	11	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	16	1	44588133	Rat
1354625	Despr7	Despair related QTL 7	3.16	0.016	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	16	1	44977551	Rat
1600378	Arunc4	Aerobic running capacity QTL 4		0.03	exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	16	380245	80345693	Rat
2293343	Glom16	Glomerulus QTL 16	7.4		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	16	832236	46053497	Rat
2312660	Bw95	Body weight QTL 95		0.05	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	16	832236	59492508	Rat
2312663	Slep9	Serum leptin concentration QTL 9		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	16	832236	59492508	Rat
2312666	Insul16	Insulin level QTL 16		0.01	blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	16	832236	59492508	Rat
2312669	Stl23	Serum triglyceride level QTL 23		0.01	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	16	832236	59492508	Rat
2306902	Bp339	Blood pressure QTL 339		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	16	3380150	43025077	Rat
70183	BpQTLcluster13	Blood pressure QTL cluster 13	3.654		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	16	4227609	43025077	Rat
70183	BpQTLcluster13	Blood pressure QTL cluster 13	3.654		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	16	4227609	43025077	Rat
70183	BpQTLcluster13	Blood pressure QTL cluster 13	3.654		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	16	4227609	43025077	Rat
737819	Hcas4	Hepatocarcinoma susceptibility QTL 4	4.43		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	16	4227609	46975965	Rat
61405	Niddm6	Non-insulin dependent diabetes mellitus QTL 6	3.66	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	16	4227609	48972724	Rat
61338	Bp23	Blood pressure QTL 23	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	16	4227609	49227609	Rat
737826	Alc11	Alcohol consumption QTL 11	3.2		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	16	4227609	60252231	Rat
70205	Gcr3	Gastric cancer resistance QTL 3	2.3		stomach morphology trait (VT:0000470)	stomach tumor depth of invasion (CMO:0001888)	16	17696791	82635055	Rat
70205	Gcr3	Gastric cancer resistance QTL 3	2.3		stomach morphology trait (VT:0000470)	stomach tumor depth of invasion (CMO:0001888)	16	17696791	82635055	Rat
70205	Gcr3	Gastric cancer resistance QTL 3	2.3		stomach morphology trait (VT:0000470)	stomach tumor diameter (CMO:0001889)	16	17696791	82635055	Rat
70205	Gcr3	Gastric cancer resistance QTL 3	2.3		stomach morphology trait (VT:0000470)	stomach tumor diameter (CMO:0001889)	16	17696791	82635055	Rat
70215	Niddm29	Non-insulin dependent diabetes mellitus QTL 29	3.54		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	16	19004435	75226532	Rat
2302057	Pia29	Pristane induced arthritis QTL 29	3.6	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111)	16	21735975	66735975	Rat
8694453	Bw172	Body weight QTL 172	8.33	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	16	24325513	69325513	Rat

Markers in Region

D16Arb6

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	16	25,029,330 - 25,029,518 (+)	MAPPER	mRatBN7.2
Rnor_6.0	16	26,905,771 - 26,905,958	NCBI	Rnor6.0
Rnor_5.0	16	26,784,697 - 26,784,884	UniSTS	Rnor5.0
RGSC_v3.4	16	26,747,646 - 26,747,834	RGD	RGSC3.4
RGSC_v3.4	16	26,747,647 - 26,747,834	UniSTS	RGSC3.4
RGSC_v3.1	16	26,747,644 - 26,747,832	RGD
Celera	16	25,113,710 - 25,113,897	UniSTS
FHH x ACI Map	16	15.4998	UniSTS
FHH x ACI Map	16	15.4998	RGD
Cytogenetic Map	16	p13	UniSTS

RH94584

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	16	25,142,035 - 25,142,185 (+)	MAPPER	mRatBN7.2
Rnor_6.0	16	27,014,616 - 27,014,765	NCBI	Rnor6.0
Rnor_5.0	16	26,888,687 - 26,888,836	UniSTS	Rnor5.0
Celera	16	25,226,403 - 25,226,552	UniSTS
RH 3.4 Map	16	298.1	UniSTS
Cytogenetic Map	16	p13	UniSTS

RH94773

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	16	25,141,951 - 25,142,211 (+)	MAPPER	mRatBN7.2
Rnor_6.0	16	27,014,532 - 27,014,791	NCBI	Rnor6.0
Rnor_5.0	16	26,888,603 - 26,888,862	UniSTS	Rnor5.0
Celera	16	25,226,319 - 25,226,578	UniSTS
Cytogenetic Map	16	p13	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High									15
Medium	3	43	8				8	11	59	27	34	11	8
Low			42	34	19	34				8	7
Below cutoff			7	7		7

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_013128	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AH002150	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC085762	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474045	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	J04625	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000279	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M31602	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X51406	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000064297 ⟹ ENSRNOP00000061172

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	16	25,030,276 - 25,142,233 (+)	Ensembl
Rnor_6.0 Ensembl	16	26,906,716 - 27,014,813 (+)	Ensembl

RefSeq Acc Id:

NM_013128 ⟹ NP_037260

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	16	25,030,276 - 25,142,231 (+)	NCBI
Rnor_6.0	16	26,906,716 - 27,014,811 (+)	NCBI
Rnor_5.0	16	26,785,642 - 26,888,882 (+)	NCBI
Celera	16	25,114,655 - 25,226,598 (+)	RGD

Sequence:

show sequence

AGACGAGAGGAGGCTGGTGCTGAGCTCGCCAACTCCACCCGGGCCCGGGCAGACAAAAGAGACC
GGCGGTACAGCTCGCGGGGACGCGATGGCCGGGCGCGGAGGACGGGTGCTGCTGGCGCTGTGTG
CCGCGCTGGTGGCCGGCGGGTGGCTGTTAGCGGCTGAAGCCCAGGAGCCCGGGGCGCCAGCGGC
TGGCATGCGGCGGCGCCGGCGGCTGCAGCAGGAGGACGGCATCTCCTTCGAGTACCACCGCTAT
CCCGAGCTGCGCGAGGCGCTGGTGTCGGTATGGCTGCAGTGCACCGCCATCAGCAGGATCTACA
CGGTGGGGCGCAGCTTCGAGGGCCGGGAGCTCCTGGTCATCGAGCTGTCTGACAACCCCGGGGT
CCATGAGCCCGGTGAACCTGAGTTTAAATACATTGGGAACATGCATGGTAATGAGGCGGTTGGA
CGGGAGCTGCTCATTTTCTTGGCCCAGTACCTGTGTAACGAATACCAGAGAGGGAATGAGACAA
TTGTCAACCTGATCCACAGCACACGAATCCATATCATGCCCTCCTTGAACCCCGATGGCTTTGA
GAAAGCAGCATCTCAGCCCGGTGAGCTGAAGGACTGGTTCGTGGGCCGCAGCAATGCCCAGGGA
ATAGATCTGAACCGGAACTTCCCAGACTTGGATAGGATCGTGTATGTTAATGAGAAAGAAGGCG
GTCCCAACAACCACCTGCTGAAGAATCTGAAGAAAATTGTGGACCAAAATTCAAAGCTTGCCCC
CGAGACCAAGGCTGTCATTCACTGGATCATGGACATCCCATTTGTGCTCTCTGCCAACCTGCAC
GGAGGAGACCTCGTGGCTAATTACCCGTATGATGAGACGCGGAGTGGTACTGCTCACGAATACA
GTTCCTGCCCTGATGACGCAATTTTCCAAAGCTTGGCTCGCGCATACTCTTCTTTCAACCCAGT
CATGTCTGACCCCAATCGACCTCCCTGTCGCAAGAATGATGATGACAGTAGCTTTGTAGATGGA
ACAACCAATGGTGGTGCATGGTACAGCGTCCCCGGTGGAATGCAAGACTTCAATTACCTGAGCA
GCAACTGCTTTGAGATCACTGTGGAGCTTAGCTGTGAGAAGTTCCCACCTGAAGAGACTCTCAA
AAGCTACTGGGAAGATAACAAAAACTCCCTCATCAACTACCTGGAGCAGATACACCGAGGTGTT
AAAGGGTTTGTCCGTGACCTTCAAGGTAATCCGATTGCCAACGCAACCATTTCCGTGGATGGGA
TAGACCATGATGTCACCTCGGCTAAGGATGGGGATTACTGGCGATTGCTTGCGCCTGGAAACTA
TAAACTTACAGCCTCAGCTCCCGGCTACCTGGCAATCACAAAGAAAGTGGCAGTTCCTTTCAGC
CCTGCTGTTGGGGTGGACTTTGAGCTGGAGTCTTTCTATGAAAGGAAGGAGGAGGAGAAGGAAG
AATTGATGGAGTGGTGGAAAATGATGTCAGAGACTTTGAATTTTTAAGAAAGGCTCCTAACTAA
TGGCTTTAATATATCCATAGACTATAGTAAGATGCAACGTGGCTCTTTTATTTTAGGTTGTGTG
CAGTTAATATTTAACATCGGTTTATTTTTGATCATTTAAGTAGTAGTTGCTAATCACTTAAATA
CACTTGGACAGAACCTGTAGTGTCTGGATCGACTTCATTCTTTCATGAACATTCGCTTTAAAAT
CTAGGAAGATCCTTTAACCTAGTTGGTGACAATGTCACATGACAGATGCCATGAAAAAGTCAAC
CGATGTAGCTTGGATCTGTGAGCACTGTGTGTATGGCGAGAATCACATAGTTCCATATAAGTTG
TCCTTAGTCTCTTGTGCTGATCCACTGTATAAGCATGATCCTGTTAATGCGCTTCTGAGGGAAG
GAAAACGTACGTGCTTTGCAAAGGGGCTCTGAGCAGAAGGAAAACCTAGTTCTTGCGTGTACTT
TGAAGAACAGAACTGTATTAGTCAGCCTGTTAGTGCAACTTCAGAGTTTGGGGTTTTGTCTTGA
TTGCAGATTGGCCCAGAATTGCATTCTAAATGAATAAAGGATTA

hide sequence

Protein Sequences


Protein RefSeqs	NP_037260	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA40873	(Get FASTA)	NCBI Sequence Viewer
	AAA40875	(Get FASTA)	NCBI Sequence Viewer
	AAA40957	(Get FASTA)	NCBI Sequence Viewer
	AAH85762	(Get FASTA)	NCBI Sequence Viewer
	CAA35768	(Get FASTA)	NCBI Sequence Viewer
	EDL75985	(Get FASTA)	NCBI Sequence Viewer
	EDL75986	(Get FASTA)	NCBI Sequence Viewer
	EDL75987	(Get FASTA)	NCBI Sequence Viewer
	P15087	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_037260 ⟸ NM_013128
- Peptide Label:	precursor
- UniProtKB:	D4A8X4 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAGRGGRVLLALCAALVAGGWLLAAEAQEPGAPAAGMRRRRRLQQEDGISFEYHRYPELREALV SVWLQCTAISRIYTVGRSFEGRELLVIELSDNPGVHEPGEPEFKYIGNMHGNEAVGRELLIFLA QYLCNEYQRGNETIVNLIHSTRIHIMPSLNPDGFEKAASQPGELKDWFVGRSNAQGIDLNRNFP DLDRIVYVNEKEGGPNNHLLKNLKKIVDQNSKLAPETKAVIHWIMDIPFVLSANLHGGDLVANY PYDETRSGTAHEYSSCPDDAIFQSLARAYSSFNPVMSDPNRPPCRKNDDDSSFVDGTTNGGAWY SVPGGMQDFNYLSSNCFEITVELSCEKFPPEETLKSYWEDNKNSLINYLEQIHRGVKGFVRDLQ GNPIANATISVDGIDHDVTSAKDGDYWRLLAPGNYKLTASAPGYLAITKKVAVPFSPAVGVDFE LESFYERKEEEKEELMEWWKMMSETLNF hide sequence

RefSeq Acc Id:

ENSRNOP00000061172 ⟸ ENSRNOT00000064297

Protein Domains

Peptidase_M14

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P15087-F1-model_v2	AlphaFold	P15087	1-476	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13700068

Promoter ID:

EPDNEW_R10590

Type:

initiation region

Name:

Cpe_1

Description:

carboxypeptidase E

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	16	26,906,698 - 26,906,758	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2394	AgrOrtholog
BioCyc Gene	G2FUF-11626	BioCyc
Ensembl Genes	ENSRNOG00000043387	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000061172	ENTREZGENE
	ENSRNOP00000061172.4	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000064297	ENTREZGENE
	ENSRNOT00000064297.4	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7193151	IMAGE-MGC_LOAD
InterPro	CarboxyPept-like_regulatory	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	M14_CPE_CPD	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Peptidase_M14	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:25669	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:93638	IMAGE-MGC_LOAD
NCBI Gene	25669	ENTREZGENE
Pfam	Peptidase_M14	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Cpe	PhenoGen
PRINTS	CRBOXYPTASEA	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	CARBOXYPEPT_ZN_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	CARBOXYPEPT_ZN_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	Zn_pept	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF49464	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	CBPE_RAT	UniProtKB/Swiss-Prot
	D4A8X4	ENTREZGENE
	P15087	ENTREZGENE
	Q5U322_RAT	UniProtKB/TrEMBL
UniProt Secondary	D4A8X4	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2002-06-10	Cpe	Carboxypeptidase E			Symbol and Name status set to approved	70586	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)