Symbol:
Cpe
Name:
carboxypeptidase E
RGD ID:
2394
Description:
Enables carboxypeptidase activity; cobalt ion binding activity; and protein domain specific binding activity. Involved in several processes, including cellular response to dexamethasone stimulus; generation of neurons; and peptide hormone processing. Located in several cellular components, including dense core granule; perikaryon; and synaptic membrane. Human ortholog(s) of this gene implicated in alcohol dependence; coronary artery disease; obesity; and type 2 diabetes mellitus. Orthologous to human CPE (carboxypeptidase E); PARTICIPATES IN melanocortin system pathway; type 1 diabetes mellitus pathway; INTERACTS WITH 17alpha-ethynylestradiol; 2,2',5,5'-tetrachlorobiphenyl; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
CARBE; carboxypeptidase H; Cph; enkephalin convertase; MGC93638; prohormone-processing carboxypeptidase
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CPE (carboxypeptidase E) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):
Cpe (carboxypeptidase E) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Cpe (carboxypeptidase E) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CPE (carboxypeptidase E) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CPE (carboxypeptidase E) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Cpe (carboxypeptidase E) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CPE (carboxypeptidase E) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CPE (carboxypeptidase E) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Cpe (carboxypeptidase E) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
CPE (carboxypeptidase E)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Cpe (carboxypeptidase E)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
cpe (carboxypeptidase E)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
egl-21
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
cpd-2
Alliance
DIOPT (Ensembl Compara|OMA|PANTHER)
Xenopus tropicalis (tropical clawed frog):
cpe
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Candidate Gene For:
Niddm38
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 16 29,796,707 - 29,908,647 (+) NCBI GRCr8 mRatBN7.2 16 25,030,276 - 25,142,231 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 16 25,030,276 - 25,142,233 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 16 28,395,455 - 28,506,245 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 16 31,829,813 - 31,940,599 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 16 27,784,887 - 27,896,603 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 16 26,906,716 - 27,014,811 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 16 26,906,716 - 27,014,813 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 16 26,785,642 - 26,888,882 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.1 16 26,748,589 - 26,748,986 (+) NCBI Celera 16 25,114,655 - 25,226,598 (+) NCBI Celera RH 3.4 Map 16 298.1 RGD Cytogenetic Map 16 p13 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Cpe Rat (-)-epigallocatechin 3-gallate decreases expression ISO CPE (Homo sapiens) 6480464 epigallocatechin gallate results in decreased expression of CPE mRNA CTD PMID:16084531 Cpe Rat 1,2-dimethylhydrazine multiple interactions ISO Cpe (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in decreased expression of CPE mRNA] CTD PMID:22206623 Cpe Rat 17alpha-ethynylestradiol affects expression ISO Cpe (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of CPE mRNA CTD PMID:17555576 Cpe Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of CPE mRNA CTD PMID:12075121 more ... Cpe Rat 17alpha-ethynylestradiol affects expression EXP 6480464 Ethinyl Estradiol affects the expression of CPE mRNA CTD PMID:16079270 and PMID:17351261 Cpe Rat 17alpha-ethynylestradiol multiple interactions ISO Cpe (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in decreased expression of CPE mRNA CTD PMID:17942748 Cpe Rat 17alpha-ethynylestradiol decreases expression ISO Cpe (Mus musculus) 6480464 Ethinyl Estradiol results in decreased expression of CPE mRNA CTD PMID:16174780 and PMID:17942748 Cpe Rat 17beta-estradiol increases expression ISO CPE (Homo sapiens) 6480464 Estradiol results in increased expression of CPE mRNA CTD PMID:19619570 Cpe Rat 17beta-estradiol decreases expression ISO Cpe (Mus musculus) 6480464 Estradiol results in decreased expression of CPE mRNA CTD PMID:39298647 Cpe Rat 17beta-estradiol multiple interactions ISO CPE (Homo sapiens) 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in decreased expression of CPE mRNA CTD PMID:19619570 Cpe Rat 17beta-estradiol affects expression ISO CPE (Homo sapiens) 6480464 Estradiol affects the expression of CPE mRNA CTD PMID:14699072 Cpe Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Cpe (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Cpe Rat 2,2',5,5'-tetrachlorobiphenyl decreases expression EXP 6480464 2 more ... CTD PMID:23829299 Cpe Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO CPE (Homo sapiens) 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in decreased expression of CPE mRNA CTD PMID:19619570 Cpe Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of CPE mRNA CTD PMID:32109520 and PMID:34747641 Cpe Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Cpe (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in decreased expression of CPE mRNA CTD PMID:17942748 Cpe Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO CPE (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of CPE mRNA CTD PMID:19619570 Cpe Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Cpe (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Cpe Rat 3,7-dihydropurine-6-thione increases expression EXP 6480464 Mercaptopurine results in increased expression of CPE mRNA CTD PMID:23358152 Cpe Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO CPE (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of CPE mRNA CTD PMID:28628672 Cpe Rat 4,4'-sulfonyldiphenol multiple interactions ISO CPE (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of CPE mRNA CTD PMID:28628672 Cpe Rat 4-hydroxynon-2-enal decreases expression ISO CPE (Homo sapiens) 6480464 4-hydroxy-2-nonenal results in decreased expression of CPE mRNA CTD PMID:12419474 Cpe Rat 4-hydroxyphenyl retinamide increases expression ISO Cpe (Mus musculus) 6480464 Fenretinide results in increased expression of CPE mRNA CTD PMID:28973697 Cpe Rat 5-azacytidine increases expression ISO CPE (Homo sapiens) 6480464 Azacitidine results in increased expression of CPE mRNA CTD PMID:20823114 Cpe Rat 5-fluorouracil affects response to substance ISO CPE (Homo sapiens) 6480464 CPE protein affects the susceptibility to Fluorouracil CTD PMID:15352031 Cpe Rat 5-fluorouracil increases expression ISO CPE (Homo sapiens) 6480464 Fluorouracil results in increased expression of CPE protein CTD PMID:15352031 Cpe Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of CPE mRNA CTD PMID:30047161 Cpe Rat actinomycin D multiple interactions ISO CPE (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of CPE mRNA and [Dactinomycin co-treated with nutlin 3] results in increased secretion of CPE protein CTD PMID:38460933 Cpe Rat aflatoxin B1 increases methylation ISO CPE (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of CPE gene CTD PMID:27153756 Cpe Rat aldehydo-D-glucose multiple interactions ISO Cpe (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in decreased expression of CPE mRNA CTD PMID:37567420 Cpe Rat alendronic acid affects expression EXP 6480464 Alendronate affects the expression of CPE mRNA CTD PMID:16079270 Cpe Rat all-trans-retinoic acid increases expression ISO CPE (Homo sapiens) 6480464 Tretinoin results in increased expression of CPE mRNA CTD PMID:21934132 Cpe Rat all-trans-retinoic acid increases expression ISO Cpe (Mus musculus) 6480464 Tretinoin results in increased expression of CPE mRNA CTD PMID:16604517 Cpe Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of CPE mRNA CTD PMID:35163327 Cpe Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of CPE mRNA CTD PMID:30047161 Cpe Rat aristolochic acid A decreases expression ISO CPE (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of CPE mRNA CTD PMID:33212167 Cpe Rat arsane multiple interactions ISO CPE (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of CPE mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of CPE mRNA CTD PMID:32525701 and PMID:39836092 Cpe Rat arsenic atom multiple interactions ISO CPE (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of CPE mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of CPE mRNA CTD PMID:32525701 and PMID:39836092 Cpe Rat arsenous acid increases expression ISO CPE (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of CPE mRNA CTD PMID:22535156 Cpe Rat arsenous acid decreases expression ISO CPE (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of CPE mRNA CTD PMID:19128835 Cpe Rat atrazine increases expression EXP 6480464 Atrazine results in increased expression of CPE mRNA CTD PMID:36841081 Cpe Rat benzo[a]pyrene decreases expression ISO Cpe (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of CPE mRNA CTD PMID:19770486 and PMID:22610609 Cpe Rat benzo[a]pyrene diol epoxide I increases expression ISO CPE (Homo sapiens) 6480464 7 more ... CTD PMID:20382639 Cpe Rat beta-naphthoflavone multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of CPE mRNA CTD PMID:18164116 Cpe Rat bis(2-ethylhexyl) phthalate increases expression ISO Cpe (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of CPE mRNA CTD PMID:33754040 Cpe Rat bis(2-ethylhexyl) phthalate decreases expression ISO Cpe (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of CPE mRNA CTD PMID:34319233 Cpe Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of CPE mRNA CTD PMID:12075121 more ... Cpe Rat bisphenol A increases expression ISO CPE (Homo sapiens) 6480464 bisphenol A analog results in increased expression of CPE mRNA CTD PMID:32387340 Cpe Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of CPE mRNA CTD PMID:25181051 Cpe Rat bisphenol A increases expression ISO Cpe (Mus musculus) 6480464 bisphenol A results in increased expression of CPE mRNA CTD PMID:26063408 and PMID:35479511 Cpe Rat cadmium atom increases expression ISO Cpe (Mus musculus) 6480464 Cadmium results in increased expression of CPE mRNA CTD PMID:24067728 Cpe Rat cadmium atom multiple interactions ISO CPE (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of CPE mRNA CTD PMID:35301059 Cpe Rat cadmium dichloride decreases methylation EXP 6480464 Cadmium Chloride results in decreased methylation of CPE promoter CTD PMID:22457795 Cpe Rat cadmium dichloride multiple interactions ISO CPE (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of CPE mRNA CTD PMID:35301059 Cpe Rat camptothecin increases expression ISO CPE (Homo sapiens) 6480464 Camptothecin results in increased expression of CPE mRNA CTD PMID:38460933 Cpe Rat carbon nanotube decreases expression ISO Cpe (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Cpe Rat casticin increases expression ISO Cpe (Mus musculus) 6480464 casticin results in increased expression of CPE mRNA CTD PMID:28444820 Cpe Rat chitosan decreases expression ISO CPE (Homo sapiens) 6480464 Chitosan results in decreased expression of CPE mRNA and Chitosan results in decreased expression of CPE protein CTD PMID:36706893 Cpe Rat chitosan multiple interactions ISO CPE (Homo sapiens) 6480464 ARB2A protein affects the reaction [Chitosan results in decreased expression of CPE protein] CTD PMID:36706893 Cpe Rat chlordecone increases expression ISO Cpe (Mus musculus) 6480464 Chlordecone results in increased expression of CPE mRNA CTD PMID:33711761 Cpe Rat chromium atom decreases expression ISO CPE (Homo sapiens) 6480464 Chromium results in decreased expression of CPE mRNA CTD PMID:21437242 Cpe Rat cisplatin decreases expression EXP 6480464 Cisplatin results in decreased expression of CPE mRNA CTD PMID:22023808 Cpe Rat cisplatin increases expression ISO CPE (Homo sapiens) 6480464 Cisplatin results in increased expression of CPE mRNA CTD PMID:27392435 Cpe Rat cisplatin multiple interactions ISO CPE (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of CPE mRNA CTD PMID:27392435 Cpe Rat clobetasol increases expression ISO Cpe (Mus musculus) 6480464 Clobetasol results in increased expression of CPE mRNA CTD PMID:27462272 Cpe Rat copper atom multiple interactions ISO Cpe (Mus musculus) 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in increased expression of CPE mRNA CTD PMID:15467011 Cpe Rat copper atom increases expression EXP 6480464 Copper results in increased expression of CPE mRNA CTD PMID:30556269 Cpe Rat copper(0) multiple interactions ISO Cpe (Mus musculus) 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in increased expression of CPE mRNA CTD PMID:15467011 Cpe Rat copper(0) increases expression EXP 6480464 Copper results in increased expression of CPE mRNA CTD PMID:30556269 Cpe Rat copper(II) sulfate decreases expression ISO CPE (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of CPE mRNA CTD PMID:19549813 Cpe Rat coumestrol decreases expression ISO CPE (Homo sapiens) 6480464 Coumestrol results in decreased expression of CPE mRNA CTD PMID:19167446 Cpe Rat cyclosporin A decreases expression ISO CPE (Homo sapiens) 6480464 Cyclosporine results in decreased expression of CPE mRNA CTD PMID:25562108 and PMID:27989131 Cpe Rat cylindrospermopsin decreases expression ISO CPE (Homo sapiens) 6480464 cylindrospermopsin results in decreased expression of CPE mRNA CTD PMID:24921660 Cpe Rat D-glucose multiple interactions ISO Cpe (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in decreased expression of CPE mRNA CTD PMID:37567420 Cpe Rat DDE decreases expression ISO CPE (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of CPE mRNA CTD PMID:38568856 Cpe Rat DDT decreases expression EXP 6480464 DDT results in decreased expression of CPE mRNA CTD PMID:30207508 Cpe Rat dexamethasone increases expression EXP 405650601 dexamethasone increases expression of CPE mRNA in rat hippocampal neurons RGD Cpe Rat dexamethasone multiple interactions ISO CPE (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of CPE mRNA CTD PMID:28628672 Cpe Rat dexamethasone multiple interactions EXP 6480464 Testosterone inhibits the reaction [Dexamethasone results in decreased expression of CPE mRNA] CTD PMID:20032058 Cpe Rat dexamethasone decreases expression EXP 6480464 Dexamethasone results in decreased expression of CPE mRNA CTD PMID:20032058 Cpe Rat dexamethasone increases expression ISO Cpe (Mus musculus) 6480464 Dexamethasone results in increased expression of CPE mRNA alternative form CTD PMID:25426952 Cpe Rat diarsenic trioxide decreases expression ISO CPE (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of CPE mRNA CTD PMID:19128835 Cpe Rat diarsenic trioxide increases expression ISO CPE (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of CPE mRNA CTD PMID:22535156 Cpe Rat dibenz[a,h]anthracene increases expression ISO Cpe (Mus musculus) 6480464 1 more ... CTD PMID:26377693 Cpe Rat dibutyl phthalate increases expression ISO Cpe (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of CPE mRNA CTD PMID:21266533 Cpe Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of CPE mRNA CTD PMID:21266533 Cpe Rat dioxygen multiple interactions ISO CPE (Homo sapiens) 6480464 Oxygen deficiency inhibits the reaction [darinaparsin results in increased expression of CPE mRNA] CTD PMID:22535156 Cpe Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of CPE mRNA CTD PMID:21551480 Cpe Rat dorsomorphin multiple interactions ISO CPE (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Cpe Rat doxorubicin increases expression ISO CPE (Homo sapiens) 6480464 Doxorubicin results in increased expression of CPE mRNA CTD PMID:29803840 Cpe Rat ethanol multiple interactions ISO Cpe (Mus musculus) 6480464 [Carbon Tetrachloride co-treated with Ethanol] results in increased expression of CPE mRNA CTD PMID:30517762 Cpe Rat ethanol affects splicing ISO Cpe (Mus musculus) 6480464 Ethanol affects the splicing of CPE mRNA CTD PMID:30319688 Cpe Rat ethanol affects expression ISO Cpe (Mus musculus) 6480464 Ethanol affects the expression of CPE mRNA CTD PMID:30319688 Cpe Rat ethanol increases expression ISO Cpe (Mus musculus) 6480464 Ethanol results in increased expression of CPE mRNA CTD PMID:30319688 Cpe Rat ethanol decreases expression ISO CPE (Homo sapiens) 6480464 Ethanol results in decreased expression of CPE mRNA CTD PMID:28986285 Cpe Rat flavonoids increases expression EXP 6480464 Flavonoids results in increased expression of CPE mRNA CTD PMID:18035473 Cpe Rat folic acid multiple interactions ISO Cpe (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in decreased expression of CPE mRNA] CTD PMID:22206623 Cpe Rat fonofos increases methylation ISO CPE (Homo sapiens) 6480464 Fonofos results in increased methylation of CPE promoter CTD PMID:22847954 Cpe Rat fructose multiple interactions ISO Cpe (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in decreased expression of CPE mRNA CTD PMID:37567420 Cpe Rat fulvestrant increases methylation ISO CPE (Homo sapiens) 6480464 Fulvestrant results in increased methylation of CPE gene CTD PMID:31601247 Cpe Rat furan decreases methylation EXP 6480464 furan results in decreased methylation of CPE gene CTD PMID:27387713 Cpe Rat furan increases expression EXP 6480464 furan results in increased expression of CPE mRNA CTD PMID:27387713 Cpe Rat genistein decreases expression EXP 6480464 Genistein results in decreased expression of CPE mRNA CTD PMID:12075121 Cpe Rat genistein increases expression ISO Cpe (Mus musculus) 6480464 Genistein results in increased expression of CPE mRNA CTD PMID:32186404 Cpe Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of CPE mRNA CTD PMID:33387578 Cpe Rat glucose multiple interactions ISO Cpe (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in decreased expression of CPE mRNA CTD PMID:37567420 Cpe Rat hydroquinone O-beta-D-glucopyranoside increases expression ISO CPE (Homo sapiens) 6480464 Arbutin results in increased expression of CPE mRNA CTD PMID:17103032 Cpe Rat indometacin multiple interactions ISO CPE (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of CPE mRNA CTD PMID:28628672 Cpe Rat irinotecan increases expression ISO CPE (Homo sapiens) 6480464 Irinotecan analog results in increased expression of CPE mRNA CTD PMID:18927307 Cpe Rat kojic acid increases expression ISO CPE (Homo sapiens) 6480464 kojic acid results in increased expression of CPE mRNA CTD PMID:16595896 Cpe Rat lead(0) affects expression ISO CPE (Homo sapiens) 6480464 Lead affects the expression of CPE mRNA CTD PMID:28903495 Cpe Rat mercaptopurine increases expression EXP 6480464 Mercaptopurine results in increased expression of CPE mRNA CTD PMID:23358152 Cpe Rat mercury dibromide increases expression ISO CPE (Homo sapiens) 6480464 mercuric bromide results in increased expression of CPE mRNA CTD PMID:26272509 Cpe Rat mercury dibromide multiple interactions ISO CPE (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CPE mRNA CTD PMID:27188386 Cpe Rat methacholine chloride increases response to substance ISO Cpe (Mus musculus) 6480464 CPE gene mutant form results in increased susceptibility to Methacholine Chloride CTD PMID:16002559 Cpe Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of CPE mRNA CTD PMID:30047161 Cpe Rat methylmercury chloride increases expression ISO CPE (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of CPE mRNA CTD PMID:28001369 Cpe Rat mifepristone decreases expression EXP 6480464 Mifepristone results in decreased expression of CPE mRNA CTD PMID:25972201 Cpe Rat morphine increases expression ISO Cpe (Mus musculus) 6480464 Morphine results in increased expression of CPE mRNA CTD PMID:20144693 Cpe Rat N-acetyl-L-cysteine decreases expression ISO CPE (Homo sapiens) 6480464 Acetylcysteine results in decreased expression of CPE mRNA CTD PMID:16084531 Cpe Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of CPE mRNA CTD PMID:18164116 Cpe Rat nickel atom decreases expression ISO CPE (Homo sapiens) 6480464 Nickel results in decreased expression of CPE mRNA CTD PMID:24768652 and PMID:25583101 Cpe Rat nickel sulfate decreases expression ISO CPE (Homo sapiens) 6480464 nickel sulfate results in decreased expression of CPE mRNA CTD PMID:22714537 Cpe Rat Nutlin-3 multiple interactions ISO CPE (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of CPE mRNA and [Dactinomycin co-treated with nutlin 3] results in increased secretion of CPE protein CTD PMID:38460933 Cpe Rat organophosphorus compound decreases activity ISO CPE (Homo sapiens) 6480464 Organophosphorus Compounds results in decreased activity of CPE protein CTD PMID:17955620 Cpe Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of CPE mRNA CTD PMID:25729387 Cpe Rat oxaliplatin increases expression EXP 6480464 oxaliplatin results in increased expression of CPE mRNA CTD PMID:25729387 Cpe Rat ozone decreases expression ISO Cpe (Mus musculus) 6480464 Ozone results in decreased expression of CPE mRNA CTD PMID:12763052 Cpe Rat ozone multiple interactions ISO Cpe (Mus musculus) 6480464 [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of CPE mRNA more ... CTD PMID:16002559 more ... Cpe Rat ozone affects response to substance ISO Cpe (Mus musculus) 6480464 CPE affects the susceptibility to Ozone CTD PMID:23434795 Cpe Rat ozone increases response to substance ISO Cpe (Mus musculus) 6480464 CPE gene mutant form results in increased susceptibility to Ozone CTD PMID:16002559 Cpe Rat panobinostat increases expression ISO CPE (Homo sapiens) 6480464 panobinostat results in increased expression of CPE mRNA CTD PMID:26272509 Cpe Rat panobinostat multiple interactions ISO CPE (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CPE mRNA CTD PMID:27188386 Cpe Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of CPE mRNA CTD PMID:33387578 Cpe Rat parathion increases methylation ISO CPE (Homo sapiens) 6480464 Parathion results in increased methylation of CPE promoter CTD PMID:22847954 Cpe Rat PCB138 decreases expression EXP 6480464 2 more ... CTD PMID:23829299 Cpe Rat perfluorohexanesulfonic acid increases expression ISO Cpe (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of CPE mRNA CTD PMID:37995155 Cpe Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of CPE mRNA CTD PMID:35163327 Cpe Rat phenobarbital multiple interactions ISO Cpe (Mus musculus) 6480464 NR1I3 protein affects the reaction [Phenobarbital results in increased expression of CPE mRNA] CTD PMID:19482888 Cpe Rat phenobarbital increases expression ISO Cpe (Mus musculus) 6480464 Phenobarbital results in increased expression of CPE mRNA CTD PMID:19482888 and PMID:23091169 Cpe Rat phenylmercury acetate increases expression ISO CPE (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of CPE mRNA CTD PMID:26272509 Cpe Rat phenylmercury acetate multiple interactions ISO CPE (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CPE mRNA CTD PMID:27188386 Cpe Rat potassium chromate decreases expression ISO CPE (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of CPE mRNA CTD PMID:22714537 Cpe Rat propiconazole increases expression ISO Cpe (Mus musculus) 6480464 propiconazole results in increased expression of CPE mRNA CTD PMID:21278054 Cpe Rat purine-6-thiol increases expression EXP 6480464 Mercaptopurine results in increased expression of CPE mRNA CTD PMID:23358152 Cpe Rat raloxifene affects expression EXP 6480464 Raloxifene Hydrochloride affects the expression of CPE mRNA CTD PMID:16079270 Cpe Rat reserpine increases expression EXP 6480464 Reserpine results in increased expression of CPE mRNA CTD PMID:8189248 Cpe Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of CPE protein CTD PMID:35544339 Cpe Rat SB 431542 multiple interactions ISO CPE (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Cpe Rat silicon dioxide decreases expression ISO CPE (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of CPE mRNA and Silicon Dioxide results in decreased expression of CPE mRNA CTD PMID:25351596 and PMID:25895662 Cpe Rat silicon dioxide increases expression ISO CPE (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of CPE mRNA CTD PMID:23806026 Cpe Rat sodium arsenate multiple interactions ISO CPE (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of CPE mRNA CTD PMID:32525701 Cpe Rat sodium arsenite increases expression ISO CPE (Homo sapiens) 6480464 sodium arsenite results in increased expression of CPE mRNA CTD PMID:38568856 Cpe Rat sodium arsenite multiple interactions ISO CPE (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of CPE mRNA CTD PMID:39836092 Cpe Rat sotorasib multiple interactions ISO CPE (Homo sapiens) 6480464 [sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in increased expression of CPE mRNA CTD PMID:36139627 Cpe Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of CPE mRNA CTD PMID:30047161 Cpe Rat sunitinib decreases expression ISO CPE (Homo sapiens) 6480464 Sunitinib results in decreased expression of CPE mRNA CTD PMID:31533062 Cpe Rat tamoxifen affects expression ISO CPE (Homo sapiens) 6480464 Tamoxifen affects the expression of CPE mRNA CTD PMID:14699072 Cpe Rat tamoxifen affects expression ISO Cpe (Mus musculus) 6480464 Tamoxifen affects the expression of CPE mRNA CTD PMID:17555576 Cpe Rat temozolomide decreases expression ISO CPE (Homo sapiens) 6480464 Temozolomide results in decreased expression of CPE mRNA CTD PMID:31758290 Cpe Rat terbufos increases methylation ISO CPE (Homo sapiens) 6480464 terbufos results in increased methylation of CPE promoter CTD PMID:22847954 Cpe Rat tert-butyl hydroperoxide decreases expression ISO CPE (Homo sapiens) 6480464 tert-Butylhydroperoxide results in decreased expression of CPE mRNA CTD PMID:12419474 Cpe Rat tert-butyl hydroperoxide increases expression ISO CPE (Homo sapiens) 6480464 tert-Butylhydroperoxide results in increased expression of CPE mRNA CTD PMID:15336504 Cpe Rat testosterone multiple interactions EXP 6480464 Testosterone inhibits the reaction [Dexamethasone results in decreased expression of CPE mRNA] CTD PMID:20032058 Cpe Rat tetrachloromethane increases expression ISO Cpe (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of CPE mRNA CTD PMID:17484886 more ... Cpe Rat tetrachloromethane multiple interactions ISO Cpe (Mus musculus) 6480464 [Carbon Tetrachloride co-treated with Ethanol] results in increased expression of CPE mRNA CTD PMID:30517762 Cpe Rat titanium dioxide decreases expression ISO Cpe (Mus musculus) 6480464 titanium dioxide results in decreased expression of CPE mRNA CTD PMID:23557971 Cpe Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of CPE mRNA CTD PMID:25729387 Cpe Rat topotecan increases expression EXP 6480464 Topotecan results in increased expression of CPE mRNA CTD PMID:25729387 Cpe Rat trametinib multiple interactions ISO CPE (Homo sapiens) 6480464 [sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in increased expression of CPE mRNA CTD PMID:36139627 Cpe Rat trichostatin A increases expression ISO CPE (Homo sapiens) 6480464 trichostatin A results in increased expression of CPE mRNA CTD PMID:24935251 and PMID:26272509 Cpe Rat trichostatin A multiple interactions ISO CPE (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CPE mRNA CTD PMID:27188386 Cpe Rat trovafloxacin increases expression ISO Cpe (Mus musculus) 6480464 trovafloxacin results in increased expression of CPE mRNA CTD PMID:35537566 Cpe Rat tunicamycin increases expression ISO CPE (Homo sapiens) 6480464 Tunicamycin results in increased expression of CPE mRNA CTD PMID:29453283 Cpe Rat valproic acid affects expression ISO CPE (Homo sapiens) 6480464 Valproic Acid affects the expression of CPE mRNA CTD PMID:25979313 Cpe Rat valproic acid increases expression ISO CPE (Homo sapiens) 6480464 Valproic Acid results in increased expression of CPE mRNA CTD PMID:23179753 more ... Cpe Rat valproic acid multiple interactions ISO CPE (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CPE mRNA CTD PMID:27188386 Cpe Rat vancomycin decreases expression ISO Cpe (Mus musculus) 6480464 Vancomycin results in decreased expression of CPE mRNA CTD PMID:18930951 Cpe Rat vorinostat multiple interactions ISO CPE (Homo sapiens) 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CPE mRNA CTD PMID:27188386 Cpe Rat vorinostat increases expression ISO CPE (Homo sapiens) 6480464 vorinostat results in increased expression of CPE mRNA CTD PMID:26272509
Imported Annotations - KEGG (archival)
(-)-epigallocatechin 3-gallate (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,2',5,5'-tetrachlorobiphenyl (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 3,7-dihydropurine-6-thione (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxynon-2-enal (ISO) 4-hydroxyphenyl retinamide (ISO) 5-azacytidine (ISO) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) actinomycin D (ISO) aflatoxin B1 (ISO) aldehydo-D-glucose (ISO) alendronic acid (EXP) all-trans-retinoic acid (ISO) alpha-Zearalanol (EXP) amitrole (EXP) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) atrazine (EXP) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) beta-naphthoflavone (EXP) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) cadmium atom (ISO) cadmium dichloride (EXP,ISO) camptothecin (ISO) carbon nanotube (ISO) casticin (ISO) chitosan (ISO) chlordecone (ISO) chromium atom (ISO) cisplatin (EXP,ISO) clobetasol (ISO) copper atom (EXP,ISO) copper(0) (EXP,ISO) copper(II) sulfate (ISO) coumestrol (ISO) cyclosporin A (ISO) cylindrospermopsin (ISO) D-glucose (ISO) DDE (ISO) DDT (EXP) dexamethasone (EXP,ISO) diarsenic trioxide (ISO) dibenz[a,h]anthracene (ISO) dibutyl phthalate (EXP,ISO) dioxygen (ISO) diuron (EXP) dorsomorphin (ISO) doxorubicin (ISO) ethanol (ISO) flavonoids (EXP) folic acid (ISO) fonofos (ISO) fructose (ISO) fulvestrant (ISO) furan (EXP) genistein (EXP,ISO) gentamycin (EXP) glucose (ISO) hydroquinone O-beta-D-glucopyranoside (ISO) indometacin (ISO) irinotecan (ISO) kojic acid (ISO) lead(0) (ISO) mercaptopurine (EXP) mercury dibromide (ISO) methacholine chloride (ISO) methimazole (EXP) methylmercury chloride (ISO) mifepristone (EXP) morphine (ISO) N-acetyl-L-cysteine (ISO) N-nitrosodiethylamine (EXP) nickel atom (ISO) nickel sulfate (ISO) Nutlin-3 (ISO) organophosphorus compound (ISO) oxaliplatin (EXP) ozone (ISO) panobinostat (ISO) paracetamol (EXP) parathion (ISO) PCB138 (EXP) perfluorohexanesulfonic acid (ISO) perfluorooctanoic acid (EXP) phenobarbital (ISO) phenylmercury acetate (ISO) potassium chromate (ISO) propiconazole (ISO) purine-6-thiol (EXP) raloxifene (EXP) reserpine (EXP) rotenone (EXP) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenate (ISO) sodium arsenite (ISO) sotorasib (ISO) sulfadimethoxine (EXP) sunitinib (ISO) tamoxifen (ISO) temozolomide (ISO) terbufos (ISO) tert-butyl hydroperoxide (ISO) testosterone (EXP) tetrachloromethane (ISO) titanium dioxide (ISO) topotecan (EXP) trametinib (ISO) trichostatin A (ISO) trovafloxacin (ISO) tunicamycin (ISO) valproic acid (ISO) vancomycin (ISO) vorinostat (ISO)
Biological Process
cardiac left ventricle morphogenesis (IEA,ISO) cellular response to dexamethasone stimulus (IMP) cellular response to hydrogen peroxide (IMP) cellular response to staurosporine (IMP) enkephalin processing (IDA) insulin processing (IDA,IEA,IMP,ISO) insulin secretion involved in cellular response to glucose stimulus (IMP) negative regulation of branching morphogenesis of a nerve (IMP) negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway (IMP) neuron migration (IMP) neuron projection arborization (IMP) peptide catabolic process (IDA) peptide hormone processing (TAS) peptide hormone secretion (IEA,ISO) peptide metabolic process (IBA,IDA) protein localization to membrane (IEA,ISO) protein localization to secretory granule (IEA,ISO) protein processing (IBA,IDA) proteolysis (IEA) Wnt signaling pathway (IEA,ISO)
1.
Immunohistochemical expression and colocalization of somatostatin, carboxypeptidase-E and prohormone convertases 1 and 2 in rat brain.
Billova S, etal., Neuroscience. 2007 Jun 29;147(2):403-18. Epub 2007 Jun 1.
2.
BDV Syndrome: An Emerging Syndrome With Profound Obesity and Neurodevelopmental Delay Resembling Prader-Willi Syndrome.
Bosch E, etal., J Clin Endocrinol Metab. 2021 Nov 19;106(12):3413-3427. doi: 10.1210/clinem/dgab592.
3.
NOS1AP regulates dendrite patterning of hippocampal neurons through a carboxypeptidase E-mediated pathway.
Carrel D, etal., J Neurosci. 2009 Jun 24;29(25):8248-58.
4.
An association study revealed substantial effects of dominance, epistasis and substance dependence co-morbidity on alcohol dependence symptom count.
Chen G, etal., Addict Biol. 2017 Nov;22(6):1475-1485. doi: 10.1111/adb.12402. Epub 2016 May 5.
5.
Missense polymorphism in the human carboxypeptidase E gene alters enzymatic activity.
Chen H, etal., Hum Mutat. 2001 Aug;18(2):120-31.
6.
The insulin-secretory-granule carboxypeptidase H. Purification and demonstration of involvement in proinsulin processing.
Davidson HW and Hutton JC, Biochem J. 1987 Jul 15;245(2):575-82.
7.
Disruption of a receptor-mediated mechanism for intracellular sorting of proinsulin in familial hyperproinsulinemia.
Dhanvantari S, etal., Mol Endocrinol. 2003 Sep;17(9):1856-67. doi: 10.1210/me.2002-0380. Epub 2003 Jun 26.
8.
Genome-wide association study of alcohol dependence implicates a region on chromosome 11.
Edenberg HJ, etal., Alcohol Clin Exp Res. 2010 May;34(5):840-52. doi: 10.1111/j.1530-0277.2010.01156.x. Epub 2010 Mar 1.
9.
Isolation and sequence analysis of cDNA for rat carboxypeptidase E [EC 3.4.17.10], a neuropeptide processing enzyme.
Fricker LD, etal., Mol Endocrinol 1989 Apr;3(4):666-73.
10.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
11.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
12.
Carboxypeptidase B-like converting enzyme activity in secretory granules of rat pituitary.
Hook VY and Loh YP, Proc Natl Acad Sci U S A. 1984 May;81(9):2776-80.
13.
Secretogranin III binds to cholesterol in the secretory granule membrane as an adapter for chromogranin A.
Hosaka M, etal., J Biol Chem. 2004 Jan 30;279(5):3627-34. Epub 2003 Nov 3.
14.
Interaction between secretogranin III and carboxypeptidase E facilitates prohormone sorting within secretory granules.
Hosaka M, etal., J Cell Sci. 2005 Oct 15;118(Pt 20):4785-95.
15.
The "go or grow" potential of gliomas is linked to the neuropeptide processing enzyme carboxypeptidase E and mediated by metabolic stress.
Höring E, etal., Acta Neuropathol. 2012 Jul;124(1):83-97. doi: 10.1007/s00401-011-0940-x. Epub 2012 Jan 15.
16.
Association of the mutation for the human carboxypeptidase E gene exon 4 with the severity of coronary artery atherosclerosis.
Jia EZ, etal., Mol Biol Rep. 2009 Feb;36(2):245-54. doi: 10.1007/s11033-007-9173-4. Epub 2007 Dec 16.
17.
Structural characterization of the rat carboxypeptidase-E gene.
Jung YK, etal., Mol Endocrinol 1991 Sep;5(9):1257-68.
18.
High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.
Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
19.
Genetic associations of type 2 diabetes with islet amyloid polypeptide processing and degrading pathways in asian populations.
Lam VK, etal., PLoS One. 2013 Jun 11;8(6):e62378. doi: 10.1371/journal.pone.0062378. Print 2013.
20.
Genetic association analysis of 30 genes related to obesity in a European American population.
Li P, etal., Int J Obes (Lond). 2014 May;38(5):724-9. doi: 10.1038/ijo.2013.140. Epub 2013 Jul 31.
21.
Cortical Neuron Migration and Dendrite Morphology are Regulated by Carboxypeptidase E.
Liang C, etal., Cereb Cortex. 2019 Jul 5;29(7):2890-2903. doi: 10.1093/cercor/bhy155.
22.
Human carboxypeptidase E. Isolation and characterization of the cDNA, sequence conservation, expression and processing in vitro.
Manser E, etal., Biochem J 1990 Apr 15;267(2):517-25.
23.
Expression of energy metabolism related genes in the gastric tissue of obese individuals with non-alcoholic fatty liver disease.
Mehta R, etal., BMC Gastroenterol. 2014 Apr 9;14:72. doi: 10.1186/1471-230X-14-72.
24.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
25.
Mouse Genome Database (MGD)
Mouse Genome Database (MGD)
26.
Hyperproinsulinaemia in obese fat/fat mice associated with a carboxypeptidase E mutation which reduces enzyme activity.
Naggert JK, etal., Nat Genet. 1995 Jun;10(2):135-42.
27.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
28.
Contactin-associated protein (Caspr) 2 interacts with carboxypeptidase E in the CNS.
Oiso S, etal., J Neurochem. 2009 Apr;109(1):158-67. Epub 2009 Jan 23.
29.
A PC12 variant lacking regulated secretory organelles: aberrant protein targeting and evidence for a factor inhibiting neuroendocrine gene expression.
Pance A, etal., J Neurochem. 1999 Jul;73(1):21-30.
30.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
31.
Pro-opiomelanocortin processing in the hypothalamus: impact on melanocortin signalling and obesity.
Pritchard LE, etal., J Endocrinol 2002 Mar;172(3):411-21.
32.
Glu300 of rat carboxypeptidase E is essential for enzymatic activity but not substrate binding or routing to the regulated secretory pathway.
Qian Y, etal., J Biol Chem. 1999 Apr 23;274(17):11582-6.
33.
carboxypeptidase E-ΔN, a neuroprotein transiently expressed during development protects embryonic neurons against glutamate neurotoxicity.
Qin XY, etal., PLoS One. 2014 Nov 26;9(11):e112996. doi: 10.1371/journal.pone.0112996. eCollection 2014.
34.
GOA pipeline
RGD automated data pipeline
35.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
36.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
37.
Pro-opiomelanocortin and its Processing Enzymes Associate with Plaque Stability in Human Atherosclerosis - Tampere Vascular Study.
Rinne P, etal., Sci Rep. 2018 Oct 10;8(1):15078. doi: 10.1038/s41598-018-33523-7.
38.
Rat preprocarboxypeptidase H. Cloning, characterization, and sequence of the cDNA and regulation of the mRNA by corticotropin-releasing factor.
Rodriguez C, etal., J Biol Chem 1989 Apr 5;264(10):5988-95.
39.
The pro region is not required for the expression or intracellular routeing of carboxypeptidase E.
Song L and Fricker LD, Biochem J. 1997 Apr 1;323 ( Pt 1):265-71.
40.
A Pilot Study of Demographic and Dopaminergic Genetic Contributions to Weight Change in Kidney Transplant Recipients.
Stanfill A, etal., PLoS One. 2015 Sep 25;10(9):e0138885. doi: 10.1371/journal.pone.0138885. eCollection 2015.
41.
Organization of the human carboxypeptidase E gene and molecular scanning for mutations in Japanese subjects with NIDDM or obesity.
Utsunomiya N, etal., Diabetologia. 1998 Jun;41(6):701-5.
42.
The C-terminal region of carboxypeptidase E involved in membrane binding is distinct from the region involved with intracellular routing.
Varlamov O and Fricker LD, J Biol Chem. 1996 Mar 15;271(11):6077-83.
43.
Absence of carboxypeptidase E leads to adult hippocampal neuronal degeneration and memory deficits.
Woronowicz A, etal., Hippocampus. 2008;18(10):1051-63.
44.
Membrane-bound carboxypeptidase E facilitates the entry of eosinophil cationic protein into neuroendocrine cells.
Wu CM, etal., Biochem J. 2004 Sep 15;382(Pt 3):841-8.
45.
Regulation of dopamine transporter activity by carboxypeptidase E.
Zhang H, etal., Mol Brain. 2009 May 6;2:10.
46.
The developmental expression in rat of proteases furin, PC1, PC2, and carboxypeptidase E: implications for early maturation of proteolytic processing capacity.
Zheng M, etal., J Neurosci. 1994 Aug;14(8):4656-73.
Cpe Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 16 29,796,707 - 29,908,647 (+) NCBI GRCr8 mRatBN7.2 16 25,030,276 - 25,142,231 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 16 25,030,276 - 25,142,233 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 16 28,395,455 - 28,506,245 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 16 31,829,813 - 31,940,599 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 16 27,784,887 - 27,896,603 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 16 26,906,716 - 27,014,811 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 16 26,906,716 - 27,014,813 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 16 26,785,642 - 26,888,882 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.1 16 26,748,589 - 26,748,986 (+) NCBI Celera 16 25,114,655 - 25,226,598 (+) NCBI Celera RH 3.4 Map 16 298.1 RGD Cytogenetic Map 16 p13 NCBI
CPE Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 4 165,379,008 - 165,498,547 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 4 165,361,194 - 165,498,547 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 4 166,300,160 - 166,419,699 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 4 166,519,538 - 166,638,926 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 4 166,657,698 - 166,777,081 NCBI Celera 4 163,635,528 - 163,754,911 (+) NCBI Celera Cytogenetic Map 4 q32.3 NCBI HuRef 4 162,051,907 - 162,171,495 (+) NCBI HuRef CHM1_1 4 166,276,542 - 166,396,001 (+) NCBI CHM1_1 T2T-CHM13v2.0 4 168,724,998 - 168,844,639 (+) NCBI T2T-CHM13v2.0
Cpe Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 65,045,576 - 65,146,143 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 65,045,576 - 65,146,088 (-) Ensembl GRCm39 Ensembl GRCm38 8 64,592,542 - 64,693,109 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 64,592,542 - 64,693,054 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 67,071,339 - 67,171,837 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 67,484,734 - 67,585,232 (-) NCBI MGSCv36 mm8 Celera 8 67,161,674 - 67,256,578 (-) NCBI Celera Cytogenetic Map 8 B3.1 NCBI cM Map 8 32.3 NCBI
Cpe Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955403 39,862,191 - 39,971,902 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955403 39,862,893 - 39,971,902 (-) NCBI ChiLan1.0 ChiLan1.0
CPE Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 3 163,128,657 - 163,248,939 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 4 163,486,663 - 163,606,756 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 4 157,575,157 - 157,705,173 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 4 169,658,534 - 169,781,449 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 4 169,659,007 - 169,780,739 (+) Ensembl panpan1.1 panPan2
CPE Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 15 61,321,588 - 61,422,608 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 15 61,321,227 - 61,414,789 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 15 61,629,383 - 61,730,508 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 15 62,182,343 - 62,284,386 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 15 62,182,273 - 62,285,019 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 15 61,363,671 - 61,466,350 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 15 61,406,929 - 61,508,661 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 15 61,801,266 - 61,902,997 (+) NCBI UU_Cfam_GSD_1.0
Cpe
CPE Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 8 43,565,054 - 43,696,268 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 8 43,568,744 - 43,695,475 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 8 45,475,586 - 45,592,181 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CPE Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 7 111,747,265 - 111,867,548 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 7 111,747,172 - 111,868,754 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 91,600,315 - 91,727,319 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Cpe
.
Predicted Target Of
Count of predictions: 384 Count of miRNA genes: 216 Interacting mature miRNAs: 268 Transcripts: ENSRNOT00000064297 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
631561 Hcuc2 Hepatic copper content QTL 2 2.8 liver copper amount (VT:0003065) liver total copper weight (CMO:0001507) 16 1 39533949 Rat 1582235 Insul8 Insulin level QTL 8 3.3 0.0063 blood insulin amount (VT:0001560) calculated serum insulin level (CMO:0000359) 16 1 26727669 Rat 70215 Niddm29 Non-insulin dependent diabetes mellitus QTL 29 3.54 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 16 19004435 75226532 Rat 2307172 Activ4 Activity QTL 4 3.71 0.00023 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 16 1 33418960 Rat 2302057 Pia29 Pristane induced arthritis QTL 29 3.6 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111) 16 21735975 66735975 Rat 1354584 Despr6 Despair related QTL 6 3.1 0.0067 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 16 1 39533930 Rat 2302380 Slep6 Serum leptin concentration QTL 6 3.36 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 16 1 32139025 Rat 737819 Hcas4 Hepatocarcinoma susceptibility QTL 4 4.43 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 16 4227609 46975965 Rat 9590151 Scort8 Serum corticosterone level QTL 8 8.45 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 16 1 30836262 Rat 1354625 Despr7 Despair related QTL 7 3.16 0.016 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 16 1 44977551 Rat 61338 Bp23 Blood pressure QTL 23 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 16 4227609 49227609 Rat 61405 Niddm6 Non-insulin dependent diabetes mellitus QTL 6 3.66 0.001 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 16 4227609 48972724 Rat 631830 Alc7 Alcohol consumption QTL 7 2.9 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 16 1 26727669 Rat 7411664 Foco30 Food consumption QTL 30 11 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 16 1 44588133 Rat 1600378 Arunc4 Aerobic running capacity QTL 4 0.03 exercise endurance trait (VT:0002332) maximum distance run on treadmill (CMO:0001406) 16 380245 80345693 Rat 70183 BpQTLcluster13 Blood pressure QTL cluster 13 3.654 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 16 4227609 43025077 Rat 737826 Alc11 Alcohol consumption QTL 11 3.2 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 16 4227609 60252231 Rat 2303566 Bw90 Body weight QTL 90 2 body mass (VT:0001259) body weight (CMO:0000012) 16 1 39533930 Rat 8694453 Bw172 Body weight QTL 172 8.33 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 16 24325513 69325513 Rat 2312663 Slep9 Serum leptin concentration QTL 9 0.001 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 16 832236 59492508 Rat 2306902 Bp339 Blood pressure QTL 339 0.01 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 16 3380150 43025077 Rat 2312660 Bw95 Body weight QTL 95 0.05 inguinal fat pad mass (VT:0010424) inguinal fat pad weight to body weight ratio (CMO:0001253) 16 832236 59492508 Rat 2312666 Insul16 Insulin level QTL 16 0.01 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 16 832236 59492508 Rat 634355 Rends4 Renal damage susceptibility QTL 4 0.05 kidney blood vessel morphology trait (VT:0000530) organ lesion measurement (CMO:0000677) 16 1 26727669 Rat 70205 Gcr3 Gastric cancer resistance QTL 3 2.3 stomach morphology trait (VT:0000470) stomach tumor diameter (CMO:0001889) 16 17696791 82635055 Rat 2293343 Glom16 Glomerulus QTL 16 7.4 kidney glomerulus integrity trait (VT:0010546) kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269) 16 832236 46053497 Rat 6903319 Bw114 Body weight QTL 114 2.7 0.0037 body mass (VT:0001259) body weight (CMO:0000012) 16 1 43534949 Rat 2312669 Stl23 Serum triglyceride level QTL 23 0.01 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 16 832236 59492508 Rat
D16Arb6
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 16 25,029,330 - 25,029,518 (+) MAPPER mRatBN7.2 Rnor_6.0 16 26,905,771 - 26,905,958 NCBI Rnor6.0 Rnor_5.0 16 26,784,697 - 26,784,884 UniSTS Rnor5.0 RGSC_v3.4 16 26,747,646 - 26,747,834 RGD RGSC3.4 RGSC_v3.4 16 26,747,647 - 26,747,834 UniSTS RGSC3.4 RGSC_v3.1 16 26,747,644 - 26,747,832 RGD Celera 16 25,113,710 - 25,113,897 UniSTS FHH x ACI Map 16 15.4998 UniSTS FHH x ACI Map 16 15.4998 RGD Cytogenetic Map 16 p13 UniSTS
RH94584
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 16 25,142,035 - 25,142,185 (+) MAPPER mRatBN7.2 Rnor_6.0 16 27,014,616 - 27,014,765 NCBI Rnor6.0 Rnor_5.0 16 26,888,687 - 26,888,836 UniSTS Rnor5.0 Celera 16 25,226,403 - 25,226,552 UniSTS RH 3.4 Map 16 298.1 UniSTS Cytogenetic Map 16 p13 UniSTS
RH94773
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 16 25,141,951 - 25,142,211 (+) MAPPER mRatBN7.2 Rnor_6.0 16 27,014,532 - 27,014,791 NCBI Rnor6.0 Rnor_5.0 16 26,888,603 - 26,888,862 UniSTS Rnor5.0 Celera 16 25,226,319 - 25,226,578 UniSTS Cytogenetic Map 16 p13 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000064297 ⟹ ENSRNOP00000061172
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 16 25,030,276 - 25,142,233 (+) Ensembl Rnor_6.0 Ensembl 16 26,906,716 - 27,014,813 (+) Ensembl
RefSeq Acc Id:
NM_013128 ⟹ NP_037260
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 29,796,707 - 29,908,647 (+) NCBI mRatBN7.2 16 25,030,276 - 25,142,231 (+) NCBI Rnor_6.0 16 26,906,716 - 27,014,811 (+) NCBI Rnor_5.0 16 26,785,642 - 26,888,882 (+) NCBI Celera 16 25,114,655 - 25,226,598 (+) RGD
Sequence:
AGACGAGAGGAGGCTGGTGCTGAGCTCGCCAACTCCACCCGGGCCCGGGCAGACAAAAGAGACCGGCGGTACAGCTCGCGGGGACGCGATGGCCGGGCGCGGAGGACGGGTGCTGCTGGCGCTGTGTG
hide sequence
RefSeq Acc Id:
NP_037260 ⟸ NM_013128
- Peptide Label:
precursor
- UniProtKB:
P15087 (UniProtKB/Swiss-Prot), D4A8X4 (UniProtKB/TrEMBL), Q5U322 (UniProtKB/TrEMBL)
- Sequence:
MAGRGGRVLLALCAALVAGGWLLAAEAQEPGAPAAGMRRRRRLQQEDGISFEYHRYPELREALVSVWLQCTAISRIYTVGRSFEGRELLVIELSDNPGVHEPGEPEFKYIGNMHGNEAVGRELLIFLA
hide sequence
Ensembl Acc Id:
ENSRNOP00000061172 ⟸ ENSRNOT00000064297
RGD ID: 13700068 Promoter ID: EPDNEW_R10590 Type: initiation region Name: Cpe_1 Description: carboxypeptidase E SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 16 26,906,698 - 26,906,758 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-06-10
Cpe
Carboxypeptidase E
Symbol and Name status set to approved
70586 APPROVED
