Symbol:
Clcn2
Name:
chloride voltage-gated channel 2
RGD ID:
2361
Description:
Enables voltage-gated chloride channel activity and volume-sensitive chloride channel activity. Involved in several processes, including cellular hypotonic response; positive regulation of oligodendrocyte differentiation; and positive regulation of voltage-gated chloride channel activity. Located in several cellular components, including axon initial segment; dendritic spine membrane; and perikaryon. Used to study cystic fibrosis. Human ortholog(s) of this gene implicated in primary hyperaldosteronism. Orthologous to human CLCN2 (chloride voltage-gated channel 2); INTERACTS WITH (+)-pilocarpine; (+)-schisandrin B; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
chloride channel 2; chloride channel protein 2; chloride channel, voltage-sensitive 2; ClC-2; LOC108348101
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CLCN2 (chloride voltage-gated channel 2) HGNC
Ensembl, HomoloGene, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Clcn2 (chloride channel, voltage-sensitive 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Clcn2 (chloride voltage-gated channel 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CLCN2 (chloride voltage-gated channel 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CLCN2 (chloride voltage-gated channel 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Clcn2 (chloride voltage-gated channel 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CLCN2 (chloride voltage-gated channel 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CLCN2 (chloride voltage-gated channel 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Clcn2 (chloride voltage-gated channel 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
CLCN2 (chloride voltage-gated channel 2)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Clcn2 (chloride channel, voltage-sensitive 2)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
clcn2b (chloride channel, voltage-sensitive 2b)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
clcn2a (chloride channel, voltage-sensitive 2a)
Alliance
DIOPT (InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
ClC-a
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
clh-3
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
clh-1
Alliance
DIOPT (OMA|OrthoFinder|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
clh-2
Alliance
DIOPT (OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
clh-4
Alliance
DIOPT (OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
clcn2
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 11 93,702,382 - 93,716,059 (+) NCBI GRCr8 mRatBN7.2 11 80,197,741 - 80,211,657 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 11 80,198,153 - 80,211,657 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 11 88,920,899 - 88,934,364 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 11 81,574,316 - 81,587,781 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 11 80,635,378 - 80,648,843 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 11 82,862,664 - 82,876,165 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 11 83,883,879 - 83,897,394 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 11 86,935,748 - 86,969,314 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 11 82,427,792 - 82,441,293 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 11 82,485,379 - 82,498,880 (+) NCBI Celera 11 79,037,893 - 79,051,394 (+) NCBI Celera Cytogenetic Map 11 q23 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Clcn2 Rat (+)-pilocarpine affects expression EXP 6480464 Pilocarpine affects the expression of CLCN2 protein CTD PMID:16930566 Clcn2 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of CLCN2 mRNA] CTD PMID:31150632 Clcn2 Rat 1,2-dimethylhydrazine multiple interactions ISO Clcn2 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of CLCN2 mRNA CTD PMID:22206623 Clcn2 Rat 17beta-estradiol multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in increased expression of CLCN2 mRNA CTD PMID:26496021 Clcn2 Rat 17beta-estradiol decreases expression ISO Clcn2 (Mus musculus) 6480464 Estradiol results in decreased expression of CLCN2 mRNA CTD PMID:39298647 Clcn2 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Clcn2 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with decitabine] results in increased expression of CLCN2 mRNA CTD PMID:15251184 Clcn2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO CLCN2 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of CLCN2 mRNA CTD PMID:27913140 Clcn2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Clcn2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of CLCN2 mRNA CTD PMID:21570461 Clcn2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of CLCN2 mRNA CTD PMID:21215274 Clcn2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of CLCN2 mRNA CTD PMID:22298810 Clcn2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Clcn2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of CLCN2 mRNA CTD PMID:19770486 Clcn2 Rat 4,4'-sulfonyldiphenol increases expression ISO Clcn2 (Mus musculus) 6480464 bisphenol S results in increased expression of CLCN2 mRNA CTD PMID:30951980 Clcn2 Rat 4,4'-sulfonyldiphenol decreases expression ISO Clcn2 (Mus musculus) 6480464 bisphenol S results in decreased expression of CLCN2 mRNA CTD PMID:39298647 Clcn2 Rat 5-aza-2'-deoxycytidine multiple interactions ISO Clcn2 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Decitabine] results in increased expression of CLCN2 mRNA CTD PMID:15251184 Clcn2 Rat 5-aza-2'-deoxycytidine increases expression ISO Clcn2 (Mus musculus) 6480464 Decitabine results in increased expression of CLCN2 mRNA CTD PMID:15251184 Clcn2 Rat acrylamide increases expression ISO CLCN2 (Homo sapiens) 6480464 Acrylamide results in increased expression of CLCN2 mRNA CTD PMID:32763439 Clcn2 Rat all-trans-retinoic acid decreases expression ISO CLCN2 (Homo sapiens) 6480464 Tretinoin results in decreased expression of CLCN2 mRNA CTD PMID:33167477 Clcn2 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of CLCN2 mRNA CTD PMID:16483693 Clcn2 Rat Azoxymethane multiple interactions ISO Clcn2 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of CLCN2 mRNA CTD PMID:29950665 Clcn2 Rat benzo[a]pyrene decreases expression ISO Clcn2 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of CLCN2 mRNA CTD PMID:19770486 Clcn2 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in increased expression of CLCN2 mRNA CTD PMID:26496021 Clcn2 Rat bisphenol A increases expression ISO Clcn2 (Mus musculus) 6480464 bisphenol A results in increased expression of CLCN2 mRNA CTD PMID:33221593 and PMID:37894381 Clcn2 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of CLCN2 gene CTD PMID:28505145 Clcn2 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of CLCN2 mRNA CTD PMID:25181051 Clcn2 Rat butanal decreases expression ISO CLCN2 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of CLCN2 mRNA CTD PMID:26079696 Clcn2 Rat cadmium dichloride increases response to substance ISO CLCN2 (Homo sapiens) 6480464 CLCN2 protein results in increased susceptibility to Cadmium Chloride CTD PMID:12843258 Clcn2 Rat cadmium dichloride decreases expression ISO CLCN2 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of CLCN2 mRNA CTD PMID:38568856 Clcn2 Rat carbon nanotube decreases expression ISO Clcn2 (Mus musculus) 6480464 Nanotubes and Carbon results in decreased expression of CLCN2 mRNA CTD PMID:25620056 Clcn2 Rat clofibrate decreases expression ISO Clcn2 (Mus musculus) 6480464 Clofibrate results in decreased expression of CLCN2 mRNA CTD PMID:23811191 Clcn2 Rat copper(II) sulfate decreases expression ISO CLCN2 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of CLCN2 mRNA CTD PMID:19549813 Clcn2 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of CLCN2 mRNA CTD PMID:26577399 Clcn2 Rat cyclosporin A decreases expression ISO Clcn2 (Mus musculus) 6480464 Cyclosporine results in decreased expression of CLCN2 mRNA CTD PMID:19770486 Clcn2 Rat cyclosporin A decreases expression ISO CLCN2 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of CLCN2 mRNA CTD PMID:25562108 Clcn2 Rat dextran sulfate multiple interactions ISO Clcn2 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of CLCN2 mRNA CTD PMID:29950665 Clcn2 Rat dibenz[a,h]anthracene increases expression ISO Clcn2 (Mus musculus) 6480464 1 more ... CTD PMID:26377693 Clcn2 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of CLCN2 mRNA CTD PMID:21266533 Clcn2 Rat flavonoids increases expression EXP 6480464 Flavonoids results in increased expression of CLCN2 mRNA CTD PMID:18035473 Clcn2 Rat folic acid multiple interactions ISO Clcn2 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of CLCN2 mRNA CTD PMID:22206623 Clcn2 Rat folic acid decreases expression ISO Clcn2 (Mus musculus) 6480464 Folic Acid results in decreased expression of CLCN2 mRNA CTD PMID:25629700 Clcn2 Rat genistein decreases expression ISO Clcn2 (Mus musculus) 6480464 Genistein results in decreased expression of CLCN2 mRNA CTD PMID:32186404 Clcn2 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of CLCN2 mRNA CTD PMID:33387578 Clcn2 Rat hexane decreases methylation EXP 6480464 n-hexane results in decreased methylation of CLCN2 promoter CTD PMID:23740543 Clcn2 Rat inulin multiple interactions ISO Clcn2 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of CLCN2 mRNA CTD PMID:36331819 Clcn2 Rat N-nitrosodiethylamine decreases expression ISO Clcn2 (Mus musculus) 6480464 Diethylnitrosamine results in decreased expression of CLCN2 mRNA CTD PMID:24535843 Clcn2 Rat nitrofen decreases expression EXP 6480464 nitrofen results in decreased expression of CLCN2 protein CTD PMID:19652985 Clcn2 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of CLCN2 mRNA CTD PMID:25729387 Clcn2 Rat paracetamol affects expression ISO Clcn2 (Mus musculus) 6480464 Acetaminophen affects the expression of CLCN2 mRNA CTD PMID:17562736 Clcn2 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Clcn2 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of CLCN2 mRNA CTD PMID:36331819 Clcn2 Rat phenobarbital multiple interactions ISO Clcn2 (Mus musculus) 6480464 NR1I3 protein affects the reaction [Phenobarbital results in decreased expression of CLCN2 mRNA] CTD PMID:19482888 Clcn2 Rat phenobarbital decreases expression ISO Clcn2 (Mus musculus) 6480464 Phenobarbital results in decreased expression of CLCN2 mRNA CTD PMID:19482888 Clcn2 Rat pirinixic acid multiple interactions ISO Clcn2 (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of CLCN2 mRNA and [pirinixic acid co-treated with PPARA] results in decreased expression of CLCN2 mRNA CTD PMID:19710929 and PMID:20813756 Clcn2 Rat pirinixic acid decreases expression ISO Clcn2 (Mus musculus) 6480464 pirinixic acid results in decreased expression of CLCN2 mRNA CTD PMID:20813756 and PMID:23811191 Clcn2 Rat propiconazole decreases expression ISO Clcn2 (Mus musculus) 6480464 propiconazole results in decreased expression of CLCN2 mRNA CTD PMID:21278054 Clcn2 Rat sodium arsenite affects expression ISO Clcn2 (Mus musculus) 6480464 sodium arsenite affects the expression of CLCN2 mRNA CTD PMID:26674514 Clcn2 Rat sunitinib decreases expression ISO CLCN2 (Homo sapiens) 6480464 Sunitinib results in decreased expression of CLCN2 mRNA CTD PMID:31533062 Clcn2 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of CLCN2 mRNA CTD PMID:16644059 Clcn2 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of CLCN2 mRNA] CTD PMID:31150632 Clcn2 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of CLCN2 mRNA CTD PMID:31150632 Clcn2 Rat tetrachloromethane decreases expression ISO Clcn2 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of CLCN2 mRNA CTD PMID:27339419 and PMID:31919559 Clcn2 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of CLCN2 mRNA CTD PMID:34492290 Clcn2 Rat titanium dioxide increases expression ISO Clcn2 (Mus musculus) 6480464 titanium dioxide results in increased expression of CLCN2 mRNA CTD PMID:23557971 Clcn2 Rat titanium dioxide decreases methylation ISO Clcn2 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of CLCN2 gene and titanium dioxide results in decreased methylation of CLCN2 promoter alternative form CTD PMID:35295148 Clcn2 Rat titanium dioxide multiple interactions ISO Clcn2 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of CLCN2 mRNA CTD PMID:29950665 Clcn2 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of CLCN2 mRNA CTD PMID:25729387 Clcn2 Rat topotecan decreases expression EXP 6480464 Topotecan results in decreased expression of CLCN2 mRNA CTD PMID:25729387 Clcn2 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of CLCN2 mRNA CTD PMID:33387578 Clcn2 Rat trichostatin A decreases expression ISO CLCN2 (Homo sapiens) 6480464 trichostatin A results in decreased expression of CLCN2 mRNA CTD PMID:24935251 Clcn2 Rat trimellitic anhydride decreases expression ISO Clcn2 (Mus musculus) 6480464 trimellitic anhydride results in decreased expression of CLCN2 mRNA CTD PMID:19042947 Clcn2 Rat triptonide affects expression ISO Clcn2 (Mus musculus) 6480464 triptonide affects the expression of CLCN2 mRNA CTD PMID:33045310
(+)-pilocarpine (EXP) (+)-schisandrin B (EXP) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 4,4'-sulfonyldiphenol (ISO) 5-aza-2'-deoxycytidine (ISO) acrylamide (ISO) all-trans-retinoic acid (ISO) ammonium chloride (EXP) Azoxymethane (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) butanal (ISO) cadmium dichloride (ISO) carbon nanotube (ISO) clofibrate (ISO) copper(II) sulfate (ISO) Cuprizon (EXP) cyclosporin A (ISO) dextran sulfate (ISO) dibenz[a,h]anthracene (ISO) dibutyl phthalate (EXP) flavonoids (EXP) folic acid (ISO) genistein (ISO) gentamycin (EXP) hexane (EXP) inulin (ISO) N-nitrosodiethylamine (ISO) nitrofen (EXP) oxaliplatin (EXP) paracetamol (ISO) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) pirinixic acid (ISO) propiconazole (ISO) sodium arsenite (ISO) sunitinib (ISO) tetrachloromethane (EXP,ISO) thioacetamide (EXP) titanium dioxide (ISO) topotecan (EXP) trichloroethene (EXP) trichostatin A (ISO) trimellitic anhydride (ISO) triptonide (ISO)
Biological Process
acinar cell differentiation (IEA,ISO) cell differentiation involved in salivary gland development (IEA,ISO) cellular hypotonic response (IMP) chloride transmembrane transport (IEA) chloride transport (IBA,IDA,IEA,ISO) lung development (IMP) monoatomic anion transmembrane transport (IEA) monoatomic ion transmembrane transport (IEA) monoatomic ion transport (IEA) phagocytosis, engulfment (IEA,ISO) positive regulation of oligodendrocyte differentiation (IMP) positive regulation of voltage-gated chloride channel activity (IMP) regulation of aldosterone biosynthetic process (IEA,ISO,ISS) regulation of membrane depolarization during action potential (IMP) regulation of resting membrane potential (IEA,ISO) retina development in camera-type eye (IEA,ISO) stabilization of membrane potential (IEA,ISO) transmembrane transport (IEA)
1.
Inhibition of CLC-2 chloride channel expression interrupts expansion of fetal lung cysts.
Blaisdell CJ, etal., Am J Physiol Lung Cell Mol Physiol 2004 Feb;286(2):L420-6.
2.
Alternative mRNA splice variants of the rat ClC-2 chloride channel gene are expressed in lung: genomic sequence and organization of ClC-2.
Chu S and Zeitlin PL, Nucleic Acids Res 1997 Oct 15;25(20):4153-9.
3.
A short CIC-2 mRNA transcript is produced by exon skipping.
Chu S, etal., Nucleic Acids Res 1996 Sep 1;24(17):3453-7.
4.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
6.
Regions involved in the opening of CIC-2 chloride channel by voltage and cell volume.
Gründer S, etal., Nature. 1992 Dec 24-31;360(6406):759-62. doi: 10.1038/360759a0.
7.
Cell type-specific differences in chloride-regulatory mechanisms and GABA(A) receptor-mediated inhibition in rat substantia nigra.
Gulacsi A, etal., J Neurosci. 2003 Sep 10;23(23):8237-46.
8.
CLC-2 is a positive modulator of oligodendrocyte precursor cell differentiation and myelination.
Hou X, etal., Mol Med Rep. 2018 Mar;17(3):4515-4523. doi: 10.3892/mmr.2018.8439. Epub 2018 Jan 17.
9.
GlialCAM, a protein defective in a leukodystrophy, serves as a ClC-2 Cl(-) channel auxiliary subunit.
Jeworutzki E, etal., Neuron. 2012 Mar 8;73(5):951-61. doi: 10.1016/j.neuron.2011.12.039.
10.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
11.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
12.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
13.
Online Mendelian Inheritance in Man, OMIM (TM).
Online Mendelian Inheritance in Man, OMIM (TM).
14.
GOA pipeline
RGD automated data pipeline
15.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
16.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
17.
Alteration of GABAA receptor function following gene transfer of the CLC-2 chloride channel.
Staley K, etal., Neuron. 1996 Sep;17(3):543-51. doi: 10.1016/s0896-6273(00)80186-5.
18.
Distribution of chloride channel-2-immunoreactive neuronal and astrocytic processes in the hippocampus.
Sík A, etal., Neuroscience. 2000;101(1):51-65. doi: 10.1016/s0306-4522(00)00360-2.
19.
A chloride channel widely expressed in epithelial and non-epithelial cells.
Thiemann A, etal., Nature 1992 Mar 5;356(6364):57-60.
Clcn2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 11 93,702,382 - 93,716,059 (+) NCBI GRCr8 mRatBN7.2 11 80,197,741 - 80,211,657 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 11 80,198,153 - 80,211,657 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 11 88,920,899 - 88,934,364 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 11 81,574,316 - 81,587,781 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 11 80,635,378 - 80,648,843 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 11 82,862,664 - 82,876,165 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 11 83,883,879 - 83,897,394 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 11 86,935,748 - 86,969,314 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 11 82,427,792 - 82,441,293 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 11 82,485,379 - 82,498,880 (+) NCBI Celera 11 79,037,893 - 79,051,394 (+) NCBI Celera Cytogenetic Map 11 q23 NCBI
CLCN2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 184,346,185 - 184,361,605 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 184,346,185 - 184,361,650 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 184,063,973 - 184,079,393 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 185,547,034 - 185,562,085 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 3 185,547,095 - 185,561,969 NCBI Celera 3 182,504,875 - 182,520,290 (-) NCBI Celera Cytogenetic Map 3 q27.1 NCBI HuRef 3 181,470,404 - 181,485,871 (-) NCBI HuRef CHM1_1 3 184,028,432 - 184,043,898 (-) NCBI CHM1_1 T2T-CHM13v2.0 3 187,155,451 - 187,170,873 (-) NCBI T2T-CHM13v2.0
Clcn2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 16 20,521,185 - 20,536,496 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 16 20,521,714 - 20,536,496 (-) Ensembl GRCm39 Ensembl GRCm38 16 20,702,435 - 20,717,746 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 16 20,702,964 - 20,717,746 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 16 20,703,039 - 20,716,709 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 16 20,616,509 - 20,629,657 (-) NCBI MGSCv36 mm8 Celera 16 21,268,322 - 21,281,991 (-) NCBI Celera Cytogenetic Map 16 A3- B1 NCBI cM Map 16 12.5 NCBI
Clcn2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955420 23,138,605 - 23,152,311 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955420 23,138,558 - 23,152,462 (+) NCBI ChiLan1.0 ChiLan1.0
CLCN2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 182,219,532 - 182,235,030 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 182,223,590 - 182,239,652 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 181,383,608 - 181,399,200 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 189,865,627 - 189,881,049 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 3 189,862,489 - 189,881,049 (-) Ensembl panpan1.1 panPan2
CLCN2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 34 17,224,136 - 17,238,755 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 34 17,223,215 - 17,239,621 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 34 21,309,705 - 21,324,280 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 34 17,131,619 - 17,146,202 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 34 17,131,648 - 17,146,119 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 34 17,168,519 - 17,183,094 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 34 17,164,603 - 17,179,167 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 34 17,393,559 - 17,408,134 (-) NCBI UU_Cfam_GSD_1.0
Clcn2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 119,433,596 - 119,447,715 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936578 5,525,601 - 5,539,472 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936578 5,525,461 - 5,539,351 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CLCN2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 122,234,736 - 122,249,867 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 122,234,731 - 122,249,889 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 131,674,508 - 131,689,583 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CLCN2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 15 5,057,687 - 5,073,596 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 15 5,057,900 - 5,073,184 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666063 13,835,604 - 13,851,241 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Clcn2
.
Predicted Target Of
Count of predictions: 589 Count of miRNA genes: 215 Interacting mature miRNAs: 261 Transcripts: ENSRNOT00000002376, ENSRNOT00000050927, ENSRNOT00000071707, ENSRNOT00000071956, ENSRNOT00000073435, ENSRNOT00000073841 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
724554 Iddm17 Insulin dependent diabetes mellitus QTL 17 0.001 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 11 18976208 86241447 Rat 70208 Niddm22 Non-insulin dependent diabetes mellitus QTL 22 3.61 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 11 59802794 82566553 Rat 1581565 Pur10 Proteinuria QTL 10 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 11 44803318 82846466 Rat 634339 Niddm50 Non-insulin dependent diabetes mellitus QTL 50 3.32 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 11 66422148 86241447 Rat 1549848 Bvd6 Brain ventricular dilatation QTL 6 3.1 0.0001 brain ventricle morphology trait (VT:0000822) hydrocephalus severity score (CMO:0001881) 11 66113321 82169223 Rat 10450831 Scl80 Serum cholesterol level QTL 80 4.7 0.01 blood LDL cholesterol amount (VT:0000181) blood low density lipoprotein cholesterol level (CMO:0000053) 11 76957131 83051965 Rat 10058954 Gmadr7 Adrenal mass QTL 7 2.49 0.0049 adrenal gland mass (VT:0010420) both adrenal glands wet weight to body weight ratio (CMO:0002411) 11 60346590 86241447 Rat 1300135 Rf19 Renal function QTL 19 3.38 blood creatinine amount (VT:0005328) creatinine clearance (CMO:0000765) 11 40946188 82566702 Rat 1354656 Bvd3 Brain ventricular dilatation QTL 3 3.64 0.001 brain ventricle morphology trait (VT:0000822) hydrocephalus severity score (CMO:0001881) 11 69446070 82846715 Rat 2312566 Glom20 Glomerulus QTL 20 3.6 0.001 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 11 44285759 82566702 Rat 1354593 Stl12 Serum triglyceride level QTL 12 3.36 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 11 66422148 86241447 Rat 724563 Uae10 Urinary albumin excretion QTL 10 6 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 11 27672410 82846715 Rat 724561 Plsm4 Polydactyly-luxate syndrome (PLS) morphotypes QTL 4 0.0003 forelimb integrity trait (VT:0010562) front foot phalanges count (CMO:0001947) 11 54457534 86241447 Rat 4889521 Gluco62 Glucose level QTL 62 2.82 0.001 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 11 55136729 82993457 Rat 7411658 Foco27 Food consumption QTL 27 16.2 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 11 56351424 86241447 Rat 631506 Bp104 Blood pressure QTL 104 2.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 11 59802794 82566545 Rat 1581572 Uae35 Urinary albumin excretion QTL 35 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 11 44803318 82846466 Rat 1300110 Stl7 Serum triglyceride level QTL 7 4.64 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 11 29528418 82566702 Rat
D11Wox16
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 11 80,208,450 - 80,208,686 (+) MAPPER mRatBN7.2 Rnor_6.0 11 82,872,959 - 82,873,194 NCBI Rnor6.0 Rnor_6.0 11 83,894,190 - 83,894,425 NCBI Rnor6.0 Rnor_5.0 11 85,952,052 - 85,952,287 UniSTS Rnor5.0 Rnor_5.0 11 86,966,108 - 86,966,343 UniSTS Rnor5.0 RGSC_v3.4 11 82,438,087 - 82,438,322 UniSTS RGSC3.4 Celera 11 79,048,188 - 79,048,423 UniSTS Cytogenetic Map 11 q23 UniSTS
RH129159
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 11 80,193,708 - 80,193,923 (+) MAPPER mRatBN7.2 Rnor_6.0 11 83,879,450 - 83,879,664 NCBI Rnor6.0 Rnor_6.0 11 82,858,219 - 82,858,433 NCBI Rnor6.0 Rnor_5.0 11 86,951,368 - 86,951,582 UniSTS Rnor5.0 Rnor_5.0 11 85,937,312 - 85,937,526 UniSTS Rnor5.0 RGSC_v3.4 11 82,423,347 - 82,423,561 UniSTS RGSC3.4 Celera 11 79,033,448 - 79,033,662 UniSTS RH 3.4 Map 11 656.5 UniSTS Cytogenetic Map 11 q23 UniSTS
BF387879
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 11 80,188,772 - 80,188,925 (+) MAPPER mRatBN7.2 Rnor_6.0 11 83,874,516 - 83,874,668 NCBI Rnor6.0 Rnor_6.0 11 82,853,285 - 82,853,437 NCBI Rnor6.0 Rnor_5.0 11 86,946,434 - 86,946,586 UniSTS Rnor5.0 Rnor_5.0 11 85,932,378 - 85,932,530 UniSTS Rnor5.0 RGSC_v3.4 11 82,418,413 - 82,418,565 UniSTS RGSC3.4 Celera 11 79,028,514 - 79,028,666 UniSTS RH 3.4 Map 11 657.9 UniSTS Cytogenetic Map 11 q23 UniSTS
RH94517
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 11 80,187,994 - 80,188,141 (+) MAPPER mRatBN7.2 Rnor_6.0 11 82,852,507 - 82,852,653 NCBI Rnor6.0 Rnor_6.0 11 83,873,738 - 83,873,884 NCBI Rnor6.0 Rnor_5.0 11 86,945,656 - 86,945,802 UniSTS Rnor5.0 Rnor_5.0 11 85,931,600 - 85,931,746 UniSTS Rnor5.0 RGSC_v3.4 11 82,417,635 - 82,417,781 UniSTS RGSC3.4 Celera 11 79,027,736 - 79,027,882 UniSTS RH 3.4 Map 11 658.0 UniSTS Cytogenetic Map 11 q23 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
2
8
3
3
3
3
8
8
3
10
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000002376 ⟹ ENSRNOP00000002376
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 11 80,198,153 - 80,211,653 (+) Ensembl Rnor_6.0 Ensembl 11 83,884,048 - 83,897,084 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000050927 ⟹ ENSRNOP00000050925
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 11 80,198,153 - 80,211,653 (+) Ensembl Rnor_6.0 Ensembl 11 83,883,879 - 83,897,394 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000071707 ⟹ ENSRNOP00000066524
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 11 80,198,153 - 80,211,653 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000073435 ⟹ ENSRNOP00000065970
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 11 80,199,817 - 80,211,657 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000119058 ⟹ ENSRNOP00000089386
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 11 80,199,817 - 80,211,657 (+) Ensembl
RefSeq Acc Id:
NM_017137 ⟹ NP_058833
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 93,702,594 - 93,716,059 (+) NCBI mRatBN7.2 11 80,198,190 - 80,211,657 (+) NCBI Rnor_6.0 11 82,862,664 - 82,876,165 (+) NCBI Rnor_5.0 11 86,935,748 - 86,969,314 (+) NCBI RGSC_v3.4 11 82,427,792 - 82,441,293 (+) RGD Celera 11 79,037,893 - 79,051,394 (+) RGD
Sequence:
ACGAGCGGCACGAGGCCTGCGGCGCGCGACCGGGGACCCGTCGCACTCTGCACTCGGCCGCCCGGGCTAAGGGGACAGGACGGGTGCGGGCGCGGGCTCAGCGAGCCGGGAGCTGAGTCAAGGCCAGA
hide sequence
RefSeq Acc Id:
XM_006248563 ⟹ XP_006248625
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 93,702,382 - 93,716,059 (+) NCBI mRatBN7.2 11 80,197,741 - 80,211,648 (+) NCBI
Sequence:
GAAAAAGAAGAAAGGGAGGCGACGGGGGAGCGGGCTCTCAGGCATCCTCCCAGACCCGTCTAAG
hide sequence
RefSeq Acc Id:
XM_039088239 ⟹ XP_038944167
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 93,702,382 - 93,716,059 (+) NCBI mRatBN7.2 11 80,197,741 - 80,211,648 (+) NCBI
RefSeq Acc Id:
XM_039088240 ⟹ XP_038944168
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 93,706,129 - 93,716,059 (+) NCBI mRatBN7.2 11 80,201,724 - 80,211,648 (+) NCBI
RefSeq Acc Id:
XM_039088243 ⟹ XP_038944171
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 93,702,382 - 93,709,819 (+) NCBI mRatBN7.2 11 80,197,741 - 80,205,414 (+) NCBI
RefSeq Acc Id:
XM_039088244 ⟹ XP_038944172
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 93,708,699 - 93,716,059 (+) NCBI mRatBN7.2 11 80,204,364 - 80,211,648 (+) NCBI
RefSeq Acc Id:
XM_063270437 ⟹ XP_063126507
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 93,702,382 - 93,711,386 (+) NCBI
RefSeq Acc Id:
XM_063270438 ⟹ XP_063126508
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 93,702,382 - 93,711,844 (+) NCBI
RefSeq Acc Id:
XR_358402
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 93,702,382 - 93,711,841 (+) NCBI mRatBN7.2 11 80,197,741 - 80,207,443 (+) NCBI
Sequence:
GAAAAAGAAGAAAGGGAGGCGACGGGGGAGCGGGCTCTCAGGCATCCTCCCAGACCCGTCTAAGCCGCCAGAAAGTGCGAAGCAGAGGCTGCCCCGGTCTGGCCTAGAGAGCCCGATTTAGCTTTTTT
hide sequence
RefSeq Acc Id:
XR_595156
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 93,702,382 - 93,711,792 (+) NCBI mRatBN7.2 11 80,197,741 - 80,207,391 (+) NCBI
Sequence:
GAAAAAGAAGAAAGGGAGGCGACGGGGGAGCGGGCTCTCAGGCATCCTCCCAGACCCGTCTAAG
hide sequence
RefSeq Acc Id:
XR_595157
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 93,702,382 - 93,711,841 (+) NCBI mRatBN7.2 11 80,197,741 - 80,211,637 (+) NCBI
Sequence:
GAAAAAGAAGAAAGGGAGGCGACGGGGGAGCGGGCTCTCAGGCATCCTCCCAGACCCGTCTAAGCCGCCAGAAAGTGCGAAGCAGAGGCTGCCCCGGTCTGGCCTAGAGAGCCCGATTTAGCTTTTTT
hide sequence
RefSeq Acc Id:
NP_058833 ⟸ NM_017137
- UniProtKB:
P35525 (UniProtKB/Swiss-Prot), A6JS86 (UniProtKB/TrEMBL), O54821 (UniProtKB/TrEMBL)
- Sequence:
MAAATAAAATVAGEGMEPRALQYEQTLMYGRYTQELGAFAKEEAARIRLGGPEPWKGSPSARATPELLEYGQSRCARCRICSVRCHKFLVSRVGEDWIFLVLLGLLMALVSWAMDYAIAVCLQAQQWM
hide sequence
RefSeq Acc Id:
XP_006248625 ⟸ XM_006248563
- Peptide Label:
isoform X1
- UniProtKB:
A0A0A0MXT6 (UniProtKB/TrEMBL), O54822 (UniProtKB/TrEMBL)
- Sequence:
MAAATAAAATVAGEGMEPRALQYEQTLMYGRYTQELGAFAKEEAARIRLGGPEPWKGSPSARAT
hide sequence
RefSeq Acc Id:
XP_038944167 ⟸ XM_039088239
- Peptide Label:
isoform X2
- UniProtKB:
A0A8L2QXG3 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038944171 ⟸ XM_039088243
- Peptide Label:
isoform X6
- UniProtKB:
O54823 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038944168 ⟸ XM_039088240
- Peptide Label:
isoform X5
RefSeq Acc Id:
XP_038944172 ⟸ XM_039088244
- Peptide Label:
isoform X7
Ensembl Acc Id:
ENSRNOP00000002376 ⟸ ENSRNOT00000002376
Ensembl Acc Id:
ENSRNOP00000050925 ⟸ ENSRNOT00000050927
Ensembl Acc Id:
ENSRNOP00000066524 ⟸ ENSRNOT00000071707
Ensembl Acc Id:
ENSRNOP00000065970 ⟸ ENSRNOT00000073435
Ensembl Acc Id:
ENSRNOP00000089386 ⟸ ENSRNOT00000119058
RefSeq Acc Id:
XP_063126508 ⟸ XM_063270438
- Peptide Label:
isoform X4
RefSeq Acc Id:
XP_063126507 ⟸ XM_063270437
- Peptide Label:
isoform X3
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2021-03-09
Clcn2
chloride voltage-gated channel 2
LOC108348101
chloride channel protein 2
Data merged from RGD:11384925
737654 PROVISIONAL
2016-08-02
LOC108348101
chloride channel protein 2
Symbol and Name status set to provisional
70820 PROVISIONAL
2016-02-11
Clcn2
chloride voltage-gated channel 2
Clcn2
chloride channel, voltage-sensitive 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2012-07-16
Clcn2
chloride channel, voltage-sensitive 2
Clcn2
chloride channel 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-06-10
Clcn2
chloride channel 2
Symbol and Name status set to approved
70586 APPROVED
