Symbol:
Prdm2
Name:
PR/SET domain 2
RGD ID:
1594531
Description:
Predicted to enable DNA-binding transcription activator activity, RNA polymerase II-specific; DNA-binding transcription repressor activity, RNA polymerase II-specific; and RNA polymerase II transcription regulatory region sequence-specific DNA binding activity. Involved in response to estradiol. Predicted to be located in Golgi apparatus and nucleoplasm. Predicted to be active in nucleus. Orthologous to human PRDM2 (PR/SET domain 2); PARTICIPATES IN histone modification pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
PR domain 2; PR domain containing 2, with ZNF domain; PR domain containing 2, with ZNF domain (mapped); PR domain zinc finger protein 2; PR domain-containing protein 2; Prdm2_mapped; retinoblastoma interacting zinc finger protein; retinoblastoma protein-binding zinc finger protein; retinoblastoma protein-interacting zinc finger protein; Riz; zinc finger protein RIZ
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PRDM2 (PR/SET domain 2) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Prdm2 (PR domain containing 2, with ZNF domain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Prdm2 (PR/SET domain 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PRDM2 (PR/SET domain 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PRDM2 (PR/SET domain 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Prdm2 (PR/SET domain 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PRDM2 (PR/SET domain 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PRDM2 (PR/SET domain 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Prdm2 (PR/SET domain 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
PRDM2 (PR/SET domain 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Prdm2 (PR domain containing 2, with ZNF domain)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
prdm2a (PR domain containing 2, with ZNF domain a)
Alliance
DIOPT (OrthoFinder|PANTHER|PhylomeDB)
Danio rerio (zebrafish):
prdm2b (PR domain containing 2, with ZNF domain b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
prdm2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 160,704,396 - 160,815,184 (-) NCBI GRCr8 mRatBN7.2 5 155,421,066 - 155,531,884 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 155,422,134 - 155,531,825 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 158,106,645 - 158,216,138 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 159,879,929 - 159,989,430 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 159,861,245 - 159,970,147 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 161,769,587 - 161,879,150 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 161,770,653 - 161,879,133 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 165,468,778 - 165,578,775 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 161,962,929 - 162,072,519 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 5 153,753,320 - 153,860,334 (-) NCBI Celera Cytogenetic Map 5 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Prdm2 Rat 1,2-dimethylhydrazine increases expression ISO Prdm2 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of PRDM2 mRNA CTD PMID:22206623 Prdm2 Rat 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one multiple interactions ISO PRDM2 (Homo sapiens) 6480464 [Metribolone binds to and affects the folding of AR protein] promotes the reaction [AR protein modified form binds to PRDM2 protein modified form] CTD PMID:28751236 Prdm2 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO PRDM2 (Homo sapiens) 6480464 2 more ... CTD PMID:19095052 Prdm2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO PRDM2 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of PRDM2 mRNA CTD PMID:19684285 Prdm2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of PRDM2 mRNA CTD PMID:33387578 Prdm2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of PRDM2 mRNA CTD PMID:34747641 Prdm2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of PRDM2 mRNA CTD PMID:22298810 Prdm2 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of PRDM2 mRNA CTD PMID:21346803 Prdm2 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO PRDM2 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of PRDM2 mRNA CTD PMID:28628672 Prdm2 Rat 4,4'-diaminodiphenylmethane affects expression ISO Prdm2 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane affects the expression of PRDM2 mRNA CTD PMID:18648102 Prdm2 Rat 4,4'-sulfonyldiphenol multiple interactions ISO PRDM2 (Homo sapiens) 6480464 [bisphenol S co-treated with Fulvestrant] results in increased methylation of PRDM2 gene and bisphenol S inhibits the reaction [ESR1 protein binds to PRDM2 protein] CTD PMID:29389661 and PMID:31601247 Prdm2 Rat 4,4'-sulfonyldiphenol increases expression ISO Prdm2 (Mus musculus) 6480464 bisphenol S results in increased expression of PRDM2 mRNA CTD PMID:39298647 Prdm2 Rat 5-aza-2'-deoxycytidine affects expression ISO PRDM2 (Homo sapiens) 6480464 Decitabine affects the expression of PRDM2 mRNA CTD PMID:17103461 Prdm2 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of PRDM2 mRNA CTD PMID:30047161 Prdm2 Rat acrolein multiple interactions ISO PRDM2 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of PRDM2 mRNA more ... CTD PMID:32699268 and PMID:32845096 Prdm2 Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of PRDM2 mRNA CTD PMID:28959563 Prdm2 Rat aflatoxin B1 increases expression ISO Prdm2 (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of PRDM2 mRNA CTD PMID:19770486 Prdm2 Rat aflatoxin B1 increases methylation ISO PRDM2 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of PRDM2 gene CTD PMID:27153756 Prdm2 Rat all-trans-retinoic acid affects expression ISO PRDM2 (Homo sapiens) 6480464 Tretinoin affects the expression of PRDM2 mRNA CTD PMID:15498508 Prdm2 Rat alpha-pinene multiple interactions ISO PRDM2 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of PRDM2 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased expression of PRDM2 mRNA CTD PMID:32699268 Prdm2 Rat amiodarone increases expression ISO PRDM2 (Homo sapiens) 6480464 Amiodarone results in increased expression of PRDM2 mRNA CTD PMID:19774075 Prdm2 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of PRDM2 mRNA CTD PMID:30047161 Prdm2 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PRDM2 mRNA CTD PMID:16483693 Prdm2 Rat antirheumatic drug decreases expression ISO PRDM2 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of PRDM2 mRNA CTD PMID:24449571 Prdm2 Rat arsane increases methylation ISO PRDM2 (Homo sapiens) 6480464 Arsenic results in increased methylation of PRDM2 promoter CTD PMID:21291286 Prdm2 Rat arsenic atom increases methylation ISO PRDM2 (Homo sapiens) 6480464 Arsenic results in increased methylation of PRDM2 promoter CTD PMID:21291286 Prdm2 Rat benzo[a]pyrene affects methylation ISO PRDM2 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of PRDM2 5' UTR and Benzo(a)pyrene affects the methylation of PRDM2 promoter CTD PMID:27901495 Prdm2 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PRDM2 mRNA CTD PMID:25181051 Prdm2 Rat bisphenol A affects splicing ISO Prdm2 (Mus musculus) 6480464 bisphenol A affects the splicing of PRDM2 mRNA CTD PMID:37894381 Prdm2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PRDM2 mRNA CTD PMID:32145629 Prdm2 Rat bisphenol A multiple interactions ISO PRDM2 (Homo sapiens) 6480464 [bisphenol A binds to and affects the folding of AR protein] inhibits the reaction [AR protein modified form binds to PRDM2 protein modified form] more ... CTD PMID:28628672 more ... Prdm2 Rat bisphenol A increases expression ISO PRDM2 (Homo sapiens) 6480464 bisphenol A results in increased expression of PRDM2 mRNA CTD PMID:28765096 Prdm2 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of PRDM2 gene CTD PMID:28505145 Prdm2 Rat bisphenol AF multiple interactions ISO PRDM2 (Homo sapiens) 6480464 [bisphenol AF binds to and affects the folding of AR protein] inhibits the reaction [AR protein modified form binds to PRDM2 protein modified form] and bisphenol AF promotes the reaction [ESR1 protein binds to PRDM2 protein] CTD PMID:28751236 and PMID:29389661 Prdm2 Rat bortezomib decreases expression ISO PRDM2 (Homo sapiens) 6480464 Bortezomib results in decreased expression of PRDM2 mRNA CTD PMID:20977926 Prdm2 Rat cadmium atom multiple interactions ISO PRDM2 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of PRDM2 mRNA CTD PMID:35301059 Prdm2 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of PRDM2 mRNA CTD PMID:19010381 Prdm2 Rat cadmium dichloride multiple interactions ISO PRDM2 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of PRDM2 mRNA CTD PMID:35301059 Prdm2 Rat cadmium dichloride increases expression ISO PRDM2 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of PRDM2 mRNA CTD PMID:38568856 Prdm2 Rat caffeine affects phosphorylation ISO PRDM2 (Homo sapiens) 6480464 Caffeine affects the phosphorylation of PRDM2 protein CTD PMID:35688186 Prdm2 Rat CGP 52608 multiple interactions ISO PRDM2 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to PRDM2 gene] CTD PMID:28238834 Prdm2 Rat chlordecone increases expression ISO Prdm2 (Mus musculus) 6480464 Chlordecone results in increased expression of PRDM2 mRNA CTD PMID:29980752 Prdm2 Rat ciguatoxin CTX1B affects expression ISO Prdm2 (Mus musculus) 6480464 Ciguatoxins affects the expression of PRDM2 mRNA CTD PMID:18353800 Prdm2 Rat cobalt dichloride increases expression ISO PRDM2 (Homo sapiens) 6480464 cobaltous chloride results in increased expression of PRDM2 mRNA CTD PMID:19320972 Prdm2 Rat cobalt dichloride increases expression EXP 6480464 cobaltous chloride results in increased expression of PRDM2 mRNA CTD PMID:24386269 Prdm2 Rat cocaine increases expression EXP 6480464 Cocaine results in increased expression of PRDM2 mRNA CTD PMID:17898221 Prdm2 Rat copper(II) sulfate increases expression ISO PRDM2 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of PRDM2 mRNA CTD PMID:19549813 Prdm2 Rat cyclosporin A increases expression ISO Prdm2 (Mus musculus) 6480464 Cyclosporine results in increased expression of PRDM2 mRNA CTD PMID:19770486 Prdm2 Rat dexamethasone multiple interactions ISO PRDM2 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of PRDM2 mRNA CTD PMID:28628672 Prdm2 Rat Dibutyl phosphate affects expression ISO PRDM2 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of PRDM2 mRNA CTD PMID:37042841 Prdm2 Rat dorsomorphin multiple interactions ISO PRDM2 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PRDM2 mRNA CTD PMID:27188386 Prdm2 Rat doxorubicin decreases expression ISO PRDM2 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of PRDM2 mRNA CTD PMID:29803840 Prdm2 Rat elemental selenium increases expression ISO PRDM2 (Homo sapiens) 6480464 Selenium results in increased expression of PRDM2 mRNA CTD PMID:19244175 Prdm2 Rat fenthion increases expression ISO Prdm2 (Mus musculus) 6480464 Fenthion results in increased expression of PRDM2 mRNA CTD PMID:34813904 Prdm2 Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of PRDM2 mRNA CTD PMID:30307764 Prdm2 Rat fonofos increases methylation ISO PRDM2 (Homo sapiens) 6480464 Fonofos results in increased methylation of PRDM2 promoter CTD PMID:22847954 Prdm2 Rat FR900359 affects phosphorylation ISO PRDM2 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of PRDM2 protein CTD PMID:37730182 Prdm2 Rat fulvestrant multiple interactions ISO PRDM2 (Homo sapiens) 6480464 [bisphenol S co-treated with Fulvestrant] results in increased methylation of PRDM2 gene CTD PMID:31601247 Prdm2 Rat furan decreases expression EXP 6480464 furan results in decreased expression of PRDM2 mRNA CTD PMID:24614236 Prdm2 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of PRDM2 mRNA CTD PMID:22061828 Prdm2 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of PRDM2 mRNA CTD PMID:22061828 Prdm2 Rat glyphosate increases methylation EXP 6480464 Glyphosate results in increased methylation of PRDM2 gene CTD PMID:31011160 Prdm2 Rat indometacin multiple interactions ISO PRDM2 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of PRDM2 mRNA CTD PMID:28628672 Prdm2 Rat inulin multiple interactions ISO Prdm2 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of PRDM2 mRNA CTD PMID:36331819 Prdm2 Rat methamphetamine affects response to substance ISO PRDM2 (Homo sapiens) 6480464 PRDM2 gene SNP affects the susceptibility to Methamphetamine CTD PMID:18316681 Prdm2 Rat methidathion decreases expression ISO Prdm2 (Mus musculus) 6480464 methidathion results in decreased expression of PRDM2 mRNA CTD PMID:34813904 Prdm2 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of PRDM2 mRNA CTD PMID:30047161 Prdm2 Rat methotrexate decreases expression ISO PRDM2 (Homo sapiens) 6480464 Methotrexate results in decreased expression of PRDM2 mRNA CTD PMID:24449571 Prdm2 Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of PRDM2 gene CTD PMID:33148267 Prdm2 Rat nitrates multiple interactions ISO Prdm2 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of PRDM2 mRNA CTD PMID:35964746 Prdm2 Rat nitric oxide increases expression ISO PRDM2 (Homo sapiens) 6480464 Nitric Oxide results in increased expression of PRDM2 mRNA CTD PMID:23546878 Prdm2 Rat ozone multiple interactions ISO PRDM2 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of PRDM2 mRNA more ... CTD PMID:32699268 more ... Prdm2 Rat ozone multiple interactions ISO Prdm2 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of PRDM2 mRNA CTD PMID:34911549 Prdm2 Rat paracetamol increases expression ISO PRDM2 (Homo sapiens) 6480464 Acetaminophen results in increased expression of PRDM2 mRNA CTD PMID:21420995 and PMID:29067470 Prdm2 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of PRDM2 mRNA CTD PMID:33387578 Prdm2 Rat parathion increases methylation ISO PRDM2 (Homo sapiens) 6480464 Parathion results in increased methylation of PRDM2 promoter CTD PMID:22847954 Prdm2 Rat perfluorohexanesulfonic acid decreases expression ISO Prdm2 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in decreased expression of PRDM2 mRNA CTD PMID:37995155 Prdm2 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Prdm2 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of PRDM2 mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of PRDM2 mRNA CTD PMID:36331819 Prdm2 Rat permethrin multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of PRDM2 gene CTD PMID:33148267 Prdm2 Rat phenobarbital decreases expression ISO Prdm2 (Mus musculus) 6480464 Phenobarbital results in decreased expression of PRDM2 mRNA CTD PMID:19270015 Prdm2 Rat phenobarbital affects expression ISO Prdm2 (Mus musculus) 6480464 Phenobarbital affects the expression of PRDM2 mRNA CTD PMID:23091169 Prdm2 Rat potassium dichromate decreases expression ISO Prdm2 (Mus musculus) 6480464 Potassium Dichromate results in decreased expression of PRDM2 mRNA CTD PMID:23608068 Prdm2 Rat resveratrol decreases expression ISO PRDM2 (Homo sapiens) 6480464 resveratrol results in decreased expression of PRDM2 mRNA CTD PMID:12569576 Prdm2 Rat SB 431542 multiple interactions ISO PRDM2 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PRDM2 mRNA CTD PMID:27188386 Prdm2 Rat selenium atom increases expression ISO PRDM2 (Homo sapiens) 6480464 Selenium results in increased expression of PRDM2 mRNA CTD PMID:19244175 Prdm2 Rat silicon dioxide increases expression ISO PRDM2 (Homo sapiens) 6480464 Silicon Dioxide results in increased expression of PRDM2 mRNA CTD PMID:25351596 Prdm2 Rat sodium arsenite decreases expression ISO PRDM2 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of PRDM2 protein CTD PMID:21925251 Prdm2 Rat sodium arsenite affects expression ISO PRDM2 (Homo sapiens) 6480464 sodium arsenite affects the expression of PRDM2 mRNA CTD PMID:29319823 Prdm2 Rat Soman decreases expression EXP 6480464 Soman results in decreased expression of PRDM2 mRNA CTD PMID:19281266 Prdm2 Rat Soman increases expression EXP 6480464 Soman results in increased expression of PRDM2 mRNA CTD PMID:19281266 Prdm2 Rat succimer multiple interactions ISO PRDM2 (Homo sapiens) 6480464 [Succimer co-treated with Magnetite Nanoparticles] results in increased expression of PRDM2 mRNA CTD PMID:26378955 Prdm2 Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of PRDM2 mRNA CTD PMID:30047161 Prdm2 Rat tamibarotene affects expression ISO PRDM2 (Homo sapiens) 6480464 tamibarotene affects the expression of PRDM2 mRNA CTD PMID:15498508 Prdm2 Rat terbufos increases methylation ISO PRDM2 (Homo sapiens) 6480464 terbufos results in increased methylation of PRDM2 promoter CTD PMID:22847954 Prdm2 Rat tetrachloromethane increases expression ISO Prdm2 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of PRDM2 mRNA CTD PMID:31919559 Prdm2 Rat thimerosal decreases expression ISO PRDM2 (Homo sapiens) 6480464 Thimerosal results in decreased expression of PRDM2 mRNA CTD PMID:27188386 Prdm2 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of PRDM2 mRNA CTD PMID:34492290 Prdm2 Rat thiram increases expression ISO PRDM2 (Homo sapiens) 6480464 Thiram results in increased expression of PRDM2 mRNA CTD PMID:38568856 Prdm2 Rat titanium dioxide decreases expression ISO Prdm2 (Mus musculus) 6480464 titanium dioxide results in decreased expression of PRDM2 mRNA CTD PMID:29264374 Prdm2 Rat titanium dioxide increases methylation ISO Prdm2 (Mus musculus) 6480464 titanium dioxide results in increased methylation of PRDM2 gene CTD PMID:35295148 Prdm2 Rat titanium dioxide decreases methylation ISO Prdm2 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of PRDM2 gene and titanium dioxide results in decreased methylation of PRDM2 promoter CTD PMID:35295148 Prdm2 Rat trichostatin A decreases expression ISO PRDM2 (Homo sapiens) 6480464 trichostatin A results in decreased expression of PRDM2 mRNA CTD PMID:26272509 Prdm2 Rat trichostatin A multiple interactions ISO PRDM2 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PRDM2 mRNA CTD PMID:27188386 Prdm2 Rat triphenyl phosphate affects expression ISO PRDM2 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of PRDM2 mRNA CTD PMID:37042841 Prdm2 Rat triptonide increases expression ISO Prdm2 (Mus musculus) 6480464 triptonide results in increased expression of PRDM2 mRNA CTD PMID:33045310 Prdm2 Rat troglitazone decreases expression ISO Prdm2 (Mus musculus) 6480464 troglitazone results in decreased expression of PRDM2 mRNA CTD PMID:28973697 Prdm2 Rat tungsten decreases expression ISO Prdm2 (Mus musculus) 6480464 Tungsten results in decreased expression of PRDM2 mRNA CTD PMID:30912803 Prdm2 Rat urethane increases expression ISO PRDM2 (Homo sapiens) 6480464 Urethane results in increased expression of PRDM2 mRNA CTD PMID:28818685 Prdm2 Rat valproic acid increases expression ISO PRDM2 (Homo sapiens) 6480464 Valproic Acid results in increased expression of PRDM2 mRNA CTD PMID:23179753 Prdm2 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of PRDM2 mRNA CTD PMID:19015723 Prdm2 Rat vitamin E decreases expression ISO PRDM2 (Homo sapiens) 6480464 Vitamin E results in decreased expression of PRDM2 mRNA CTD PMID:19244175 Prdm2 Rat vitamin E increases expression ISO PRDM2 (Homo sapiens) 6480464 Vitamin E results in increased expression of PRDM2 mRNA CTD PMID:19244175 Prdm2 Rat vorinostat decreases expression ISO PRDM2 (Homo sapiens) 6480464 vorinostat results in decreased expression of PRDM2 mRNA CTD PMID:27188386
1,2-dimethylhydrazine (ISO) 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (EXP) acrolein (ISO) acrylamide (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) alpha-pinene (ISO) amiodarone (ISO) amitrole (EXP) ammonium chloride (EXP) antirheumatic drug (ISO) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) bortezomib (ISO) cadmium atom (ISO) cadmium dichloride (EXP,ISO) caffeine (ISO) CGP 52608 (ISO) chlordecone (ISO) ciguatoxin CTX1B (ISO) cobalt dichloride (EXP,ISO) cocaine (EXP) copper(II) sulfate (ISO) cyclosporin A (ISO) dexamethasone (ISO) Dibutyl phosphate (ISO) dorsomorphin (ISO) doxorubicin (ISO) elemental selenium (ISO) fenthion (ISO) fenvalerate (EXP) fonofos (ISO) FR900359 (ISO) fulvestrant (ISO) furan (EXP) gentamycin (EXP) glyphosate (EXP) indometacin (ISO) inulin (ISO) methamphetamine (ISO) methidathion (ISO) methimazole (EXP) methotrexate (ISO) N,N-diethyl-m-toluamide (EXP) nitrates (ISO) nitric oxide (ISO) ozone (ISO) paracetamol (EXP,ISO) parathion (ISO) perfluorohexanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) permethrin (EXP) phenobarbital (ISO) potassium dichromate (ISO) resveratrol (ISO) SB 431542 (ISO) selenium atom (ISO) silicon dioxide (ISO) sodium arsenite (ISO) Soman (EXP) succimer (ISO) sulfadimethoxine (EXP) tamibarotene (ISO) terbufos (ISO) tetrachloromethane (ISO) thimerosal (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) trichostatin A (ISO) triphenyl phosphate (ISO) triptonide (ISO) troglitazone (ISO) tungsten (ISO) urethane (ISO) valproic acid (ISO) vinclozolin (EXP) vitamin E (ISO) vorinostat (ISO)
1.
The retinoblastoma-interacting zinc-finger protein RIZ is a downstream effector of estrogen action.
Abbondanza C, etal., Proc Natl Acad Sci U S A. 2000 Mar 28;97(7):3130-5.
2.
Histone lysine methylation dynamics: establishment, regulation, and biological impact.
Black JC, etal., Mol Cell. 2012 Nov 30;48(4):491-507. doi: 10.1016/j.molcel.2012.11.006.
3.
The retinoblastoma protein binds to RIZ, a zinc-finger protein that shares an epitope with the adenovirus E1A protein.
Buyse IM, etal., Proc Natl Acad Sci U S A. 1995 May 9;92(10):4467-71.
4.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.
GOA pipeline
RGD automated data pipeline
6.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
Prdm2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 160,704,396 - 160,815,184 (-) NCBI GRCr8 mRatBN7.2 5 155,421,066 - 155,531,884 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 155,422,134 - 155,531,825 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 158,106,645 - 158,216,138 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 159,879,929 - 159,989,430 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 159,861,245 - 159,970,147 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 161,769,587 - 161,879,150 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 161,770,653 - 161,879,133 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 165,468,778 - 165,578,775 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 161,962,929 - 162,072,519 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 5 153,753,320 - 153,860,334 (-) NCBI Celera Cytogenetic Map 5 q36 NCBI
PRDM2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 13,700,188 - 13,825,079 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 13,700,188 - 13,825,079 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 14,026,683 - 14,151,574 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 13,903,937 - 14,024,162 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 13,776,655 - 13,859,875 NCBI Celera 1 12,508,705 - 12,633,526 (+) NCBI Celera Cytogenetic Map 1 p36.21 NCBI HuRef 1 12,544,696 - 12,669,465 (+) NCBI HuRef CHM1_1 1 13,825,064 - 13,950,026 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 13,142,270 - 13,267,189 (+) NCBI T2T-CHM13v2.0
Prdm2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 142,833,961 - 142,939,560 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 142,833,961 - 142,939,565 (-) Ensembl GRCm39 Ensembl GRCm38 4 143,107,391 - 143,212,769 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 143,107,391 - 143,212,995 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 142,697,294 - 142,802,612 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 142,394,156 - 142,479,396 (-) NCBI MGSCv36 mm8 Celera 4 144,915,482 - 145,028,265 (-) NCBI Celera Cytogenetic Map 4 E1 NCBI cM Map 4 76.84 NCBI
Prdm2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955527 4,012,332 - 4,105,311 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955527 4,005,410 - 4,105,376 (-) NCBI ChiLan1.0 ChiLan1.0
PRDM2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 213,094,678 - 213,224,420 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 212,342,327 - 212,472,168 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 12,838,201 - 12,963,735 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 13,853,829 - 13,910,800 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 13,853,895 - 13,961,610 (+) Ensembl panpan1.1 panPan2 PanPan1.1 Ensembl 1 13,853,895 - 13,961,610 (+) NCBI panpan1.1 panPan2
PRDM2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 2 83,381,021 - 83,429,640 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 2 83,382,552 - 83,465,687 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 2 79,917,102 - 80,036,570 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 2 84,031,028 - 84,150,815 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 2 84,031,037 - 84,150,473 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 2 80,784,169 - 80,888,460 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 2 81,802,556 - 81,922,434 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 2 82,869,382 - 82,989,085 (-) NCBI UU_Cfam_GSD_1.0
Prdm2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 36,081,381 - 36,129,727 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936474 1,862,898 - 1,949,500 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936474 1,910,026 - 1,924,900 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PRDM2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 73,118,177 - 73,239,423 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 73,135,872 - 73,240,271 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 67,387,475 - 67,455,877 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PRDM2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 118,437,171 - 118,565,554 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 118,436,717 - 118,550,461 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666054 22,166,785 - 22,295,971 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Prdm2
.
Predicted Target Of
Count of predictions: 91 Count of miRNA genes: 82 Interacting mature miRNAs: 85 Transcripts: ENSRNOT00000041175 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
10053720 Scort26 Serum corticosterone level QTL 26 2.06 0.0147 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 5 124965598 166875058 Rat 8552960 Pigfal15 Plasma insulin-like growth factor 1 level QTL 15 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 111416838 156416838 Rat 2302369 Scl60 Serum cholesterol level QTL 60 3.13 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 143608201 161165651 Rat 631562 Apr2 Acute phase response QTL 2 3.7 blood murinoglobulin 1 amount (VT:0010597) plasma murinoglobulin 1 level (CMO:0001931) 5 135927956 166875058 Rat 61444 Strs2 Sensitivity to stroke QTL 2 4.7 cerebrum integrity trait (VT:0010549) post-insult time to onset of cerebrovascular lesion (CMO:0002343) 5 135929696 166875058 Rat 1300119 Bp180 Blood pressure QTL 180 3.82 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 5 144358090 157869054 Rat 1549904 Neuinf1 Neuroinflammation QTL 1 3 0 nervous system integrity trait (VT:0010566) blood T lymphocyte count (CMO:0000110) 5 154828214 166875058 Rat 8552908 Pigfal4 Plasma insulin-like growth factor 1 level QTL 4 6.6 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 128506074 166875058 Rat 61393 Bp7 Blood pressure QTL 7 4.5 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 60293434 161481680 Rat 7794791 Mcs33 Mammary carcinoma susceptibility QTL 33 1.93 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 5 131345754 166875058 Rat 1354631 Swd2 Spike wave discharge measurement QTL 2 3.64 0.0002 brain electrophysiology trait (VT:0010557) brain total spike-and-wave discharge duration (CMO:0001740) 5 151113452 164465185 Rat 1302790 Scl20 Serum cholesterol level QTL 20 6.4 0.0001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 82394392 166664054 Rat 1598861 Cm64 Cardiac mass QTL 64 2.9 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 127798274 166875058 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 631263 Cm24 Cardiac mass QTL 24 3.5 heart mass (VT:0007028) heart left ventricle weight to body weight ratio (CMO:0000530) 5 143799107 158428037 Rat 631505 Bp103 Blood pressure QTL 103 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 132717196 165560427 Rat 1641920 Colcs1 Colorectal carcinoma susceptibility QTL 1 2.99 0.0055 intestine integrity trait (VT:0010554) benign colorectal tumor surface area measurement (CMO:0001799) 5 121846814 166846814 Rat 8694169 Bw148 Body weight QTL 148 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 128506074 166875058 Rat 1331721 Bp210 Blood pressure QTL 210 3.413 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 5 143069996 166846814 Rat 631272 Lanf1 Left ventricular atrial natriuretic factor QTL 1 12 heart left ventricle natriuretic peptide A amount (VT:0010596) heart left ventricle natriuretic peptide A level (CMO:0002165) 5 151113452 166875058 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 634349 Bp139 Blood pressure QTL 139 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 128924607 166875058 Rat 724525 Bp147 Blood pressure QTL 147 4.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 126424772 166875058 Rat 738018 Anxrr4 Anxiety related response QTL 4 5.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 5 130130159 166875058 Rat 2313096 Bmd78 Bone mineral density QTL 78 3.1 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 5 144377876 161317411 Rat 8694441 Bw169 Body weight QTL 169 17.61 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 5 111416838 156416838 Rat 8694389 Bw160 Body weight QTL 160 6.17 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 5 111416838 156416838 Rat 8694198 Abfw3 Abdominal fat weight QTL 3 16.13 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 5 111416838 156416838 Rat 1298090 Bp155 Blood pressure QTL 155 3.8 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 5 151006154 161165494 Rat 1598819 Bp292 Blood pressure QTL 292 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 127798274 166875058 Rat
D5Got96
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 155,532,103 - 155,532,450 (+) MAPPER mRatBN7.2 Rnor_6.0 5 161,879,412 - 161,879,758 NCBI Rnor6.0 Rnor_5.0 5 165,578,603 - 165,578,949 UniSTS Rnor5.0 RGSC_v3.4 5 162,072,797 - 162,073,144 RGD RGSC3.4 RGSC_v3.4 5 162,072,798 - 162,073,144 UniSTS RGSC3.4 RGSC_v3.1 5 162,082,986 - 162,083,332 RGD Celera 5 153,860,613 - 153,860,959 UniSTS RH 3.4 Map 5 1058.6 UniSTS RH 3.4 Map 5 1058.6 RGD RH 2.0 Map 5 1091.8 RGD Cytogenetic Map 5 q36 UniSTS
42.MMHAP20FRF12.seq
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 155,499,161 - 155,499,335 (+) MAPPER mRatBN7.2 Rnor_6.0 5 161,847,761 - 161,847,934 NCBI Rnor6.0 Rnor_5.0 5 165,546,952 - 165,547,125 UniSTS Rnor5.0 RGSC_v3.4 5 162,040,518 - 162,040,691 UniSTS RGSC3.4 Celera 5 153,830,112 - 153,830,285 UniSTS Cytogenetic Map 5 q36 UniSTS
BE120443
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 155,446,444 - 155,446,597 (+) MAPPER mRatBN7.2 Rnor_6.0 5 161,794,757 - 161,794,909 NCBI Rnor6.0 Rnor_5.0 5 165,493,948 - 165,494,100 UniSTS Rnor5.0 RGSC_v3.4 5 161,987,221 - 161,987,373 UniSTS RGSC3.4 Celera 5 153,777,437 - 153,777,589 UniSTS RH 3.4 Map 5 1057.9 UniSTS Cytogenetic Map 5 q36 UniSTS
RH135296
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 155,422,169 - 155,422,381 (+) MAPPER mRatBN7.2 Rnor_6.0 5 161,770,689 - 161,770,900 NCBI Rnor6.0 Rnor_5.0 5 165,469,880 - 165,470,091 UniSTS Rnor5.0 RGSC_v3.4 5 161,962,965 - 161,963,176 UniSTS RGSC3.4 Celera 5 153,753,356 - 153,753,567 UniSTS RH 3.4 Map 5 1058.2 UniSTS Cytogenetic Map 5 q36 UniSTS
ksks160
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 155,447,866 - 155,448,175 (+) MAPPER mRatBN7.2 Rnor_6.0 5 161,796,179 - 161,796,487 NCBI Rnor6.0 Rnor_5.0 5 165,495,370 - 165,495,678 UniSTS Rnor5.0 RGSC_v3.4 5 161,988,643 - 161,988,951 UniSTS RGSC3.4 Celera 5 153,778,859 - 153,779,167 UniSTS Cytogenetic Map 5 q36 UniSTS
PMC312773P3
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 155,479,438 - 155,479,558 (+) MAPPER mRatBN7.2 Rnor_6.0 5 161,827,987 - 161,828,106 NCBI Rnor6.0 Rnor_5.0 5 165,527,178 - 165,527,297 UniSTS Rnor5.0 RGSC_v3.4 5 162,020,799 - 162,020,918 UniSTS RGSC3.4 Celera 5 153,810,393 - 153,810,512 UniSTS Cytogenetic Map 5 q36 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000041175 ⟹ ENSRNOP00000046011
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 155,422,134 - 155,531,825 (-) Ensembl Rnor_6.0 Ensembl 5 161,770,653 - 161,879,133 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000078237 ⟹ ENSRNOP00000072686
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 5 161,773,758 - 161,875,362 (-) Ensembl
RefSeq Acc Id:
NM_001077648 ⟹ NP_001071116
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 160,705,462 - 160,815,140 (-) NCBI mRatBN7.2 5 155,422,134 - 155,531,825 (-) NCBI Rnor_6.0 5 161,770,653 - 161,879,133 (-) NCBI Rnor_5.0 5 165,468,778 - 165,578,775 (-) NCBI RGSC_v3.4 5 161,962,929 - 162,072,519 (-) RGD Celera 5 153,753,320 - 153,860,334 (-) RGD
Sequence:
GCCAAGATGGCGGCGGCGCGGCCGCGGGCGCCAGGGCGACGGCGGCGGCTGAGGCTCTGGGCTCGCTGAAGCGTTGGCACGTCGCGCTCTGGGCTCATGTAATCAAAGAAGTTTCTTTGTTGTGTGTA
hide sequence
RefSeq Acc Id:
XM_017593426 ⟹ XP_017448915
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 160,708,565 - 160,815,151 (-) NCBI mRatBN7.2 5 155,421,066 - 155,531,852 (-) NCBI Rnor_6.0 5 161,769,587 - 161,879,138 (-) NCBI
Sequence:
CCGAAGCCAAGATGGCGGCGGCGCGGCCGCGGGCGCCAGGGCGACGGCGGCGGCTGAGGCTCTG
hide sequence
RefSeq Acc Id:
XM_039110087 ⟹ XP_038966015
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 160,708,565 - 160,815,154 (-) NCBI mRatBN7.2 5 155,421,066 - 155,531,852 (-) NCBI
RefSeq Acc Id:
XM_039110090 ⟹ XP_038966018
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 160,708,565 - 160,742,653 (-) NCBI mRatBN7.2 5 155,421,066 - 155,459,327 (-) NCBI
RefSeq Acc Id:
XM_063287820 ⟹ XP_063143890
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 160,726,101 - 160,815,184 (-) NCBI
RefSeq Acc Id:
XM_063287821 ⟹ XP_063143891
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 160,708,565 - 160,780,912 (-) NCBI
RefSeq Acc Id:
XM_063287822 ⟹ XP_063143892
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 160,704,396 - 160,815,184 (-) NCBI
RefSeq Acc Id:
NP_001071116 ⟸ NM_001077648
- UniProtKB:
Q63755 (UniProtKB/Swiss-Prot), F1LQ66 (UniProtKB/TrEMBL)
- Sequence:
MHQNTESVAATETLAEVPEHVLRGLPEEVRLFPSAVDKTRIGVWATKPILKGKKFGPFVGDKKKRSQVRNNVYMWEVYYPNLGWMCIDATDPEKGNWLRYVNWACSGEEQNLFPLEINRAIYYKTLKP
hide sequence
RefSeq Acc Id:
XP_017448915 ⟸ XM_017593426
- Peptide Label:
isoform X1
- UniProtKB:
Q63755 (UniProtKB/Swiss-Prot), F1LQ66 (UniProtKB/TrEMBL)
- Sequence:
MHQNTESVAATETLAEVPEHVLRGLPEEVRLFPSAVDKTRIGVWATKPILKGKKFGPFVGDKKK
hide sequence
Ensembl Acc Id:
ENSRNOP00000046011 ⟸ ENSRNOT00000041175
Ensembl Acc Id:
ENSRNOP00000072686 ⟸ ENSRNOT00000078237
RefSeq Acc Id:
XP_038966015 ⟸ XM_039110087
- Peptide Label:
isoform X1
- UniProtKB:
Q63755 (UniProtKB/Swiss-Prot), F1LQ66 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038966018 ⟸ XM_039110090
- Peptide Label:
isoform X4
- UniProtKB:
Q63755 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063143892 ⟸ XM_063287822
- Peptide Label:
isoform X5
RefSeq Acc Id:
XP_063143891 ⟸ XM_063287821
- Peptide Label:
isoform X3
- UniProtKB:
Q63755 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063143890 ⟸ XM_063287820
- Peptide Label:
isoform X2
- UniProtKB:
Q63755 (UniProtKB/Swiss-Prot)
RGD ID: 13694240 Promoter ID: EPDNEW_R4765 Type: multiple initiation site Name: Prdm2_1 Description: PR/SET domain 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 161,879,146 - 161,879,206 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-07-27
Prdm2
PR/SET domain 2
Prdm2
PR domain 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2016-02-03
Prdm2
PR domain 2
Prdm2
PR domain containing 2, with ZNF domain
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2007-04-13
PR domain containing 2, with ZNF domain
Prdm2
PR domain containing 2, with ZNF domain (mapped)
Name updated
737654 APPROVED
2007-04-12
Prdm2
PR domain containing 2, with ZNF domain (mapped)
Prdm2_mapped
PR domain containing 2, with ZNF domain (mapped)
Data merged from RGD:3386
737654 APPROVED
2006-11-20
Prdm2
PR domain containing 2, with ZNF domain (mapped)
Symbol and Name status set to provisional
70820 PROVISIONAL
2005-11-17
Prdm2_mapped
PR domain containing 2, with ZNF domain (mapped)
Prdm2
PR domain containing 2, with ZNF domain
Symbol and Name updated
1556543 APPROVED
2001-11-30
Prdm2
PR domain containing 2, with ZNF domain
Symbol and Name updated to reflect Human and Mouse nomenclature
68913 APPROVED
2001-11-30
Riz
Retinoblastoma interacting zinc finger protein
Symbol and Name withdrawn
68913 WITHDRAWN
Note Type
Note
Reference
gene_product
member of the PR domain family, a subset of Krüppel-like zinc finger genes
1300403
