Symbol:
Hira
Name:
histone cell cycle regulator
RGD ID:
1584950
Description:
Predicted to enable RNA polymerase II-specific DNA-binding transcription factor binding activity and histone binding activity. Predicted to contribute to nucleosome binding activity. Predicted to be involved in nucleosome assembly. Predicted to act upstream of or within gastrulation; muscle cell differentiation; and osteoblast differentiation. Predicted to be located in nucleoplasm. Predicted to be part of HIR complex. Predicted to be active in chromatin. Orthologous to human HIRA (histone cell cycle regulator); PARTICIPATES IN histone modification pathway; INTERACTS WITH 3-chloropropane-1,2-diol; 4,4'-sulfonyldiphenol; bisphenol A.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
HIR histone cell cycle regulation defective homolog A; HIR histone cell cycle regulation defective homolog A (S. cerevisiae); histone cell cycle regulation defective homolog A; LOC100911837; LOC363849; protein HIRA-like; similar to histone cell cycle regulation defective homolog A isoform 1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
HIRA (histone cell cycle regulator) HGNC
Ensembl, HomoloGene, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):
Hira (histone cell cycle regulator) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
LOC102009660 (protein HIRA) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
LOC100977781 (protein HIRA) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
HIRA (histone cell cycle regulator) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
LOC101957075 (protein HIRA) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
HIRA (histone cell cycle regulator) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
HIRA (histone cell cycle regulator) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
LOC101713307 (protein HIRA) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
HIRA (histone cell cycle regulator)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Hira (histone cell cycle regulator)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
hira (histone cell cycle regulator a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
HIR1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
Hira
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
hira-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
HIR2
Alliance
DIOPT (OrthoFinder|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
hira
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 11 95,528,831 - 95,637,565 (-) NCBI GRCr8 mRatBN7.2 11 82,024,469 - 82,133,212 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 11 82,024,469 - 82,133,529 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 11 90,753,636 - 90,862,674 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 11 83,414,851 - 83,523,894 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 11 82,468,120 - 82,577,162 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 11 86,168,196 - 86,276,430 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 11 86,168,196 - 86,276,430 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 11 89,270,162 - 89,378,396 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Celera 11 80,805,603 - 80,913,841 (-) NCBI Celera Cytogenetic Map 11 q23 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Hira Rat 1,2-dimethylhydrazine affects expression ISO Hira (Mus musculus) 6480464 1 and 2-Dimethylhydrazine affects the expression of HIRA mRNA CTD PMID:22206623 Hira Rat 17beta-estradiol increases expression ISO HIRA (Homo sapiens) 6480464 Estradiol results in increased expression of HIRA mRNA CTD PMID:15223131 more ... Hira Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO HIRA (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of HIRA mRNA CTD PMID:17101203 Hira Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Hira (Mus musculus) 6480464 Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to HIRA promoter] CTD PMID:19654925 Hira Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Hira (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of HIRA mRNA CTD PMID:21570461 Hira Rat 3,3',5-triiodo-L-thyronine increases expression ISO HIRA (Homo sapiens) 6480464 Triiodothyronine results in increased expression of HIRA mRNA CTD PMID:23397585 Hira Rat 3-chloropropane-1,2-diol decreases expression EXP 6480464 alpha-Chlorohydrin results in decreased expression of HIRA protein CTD PMID:34915118 Hira Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO HIRA (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of HIRA mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of HIRA mRNA CTD PMID:28628672 Hira Rat 4,4'-sulfonyldiphenol multiple interactions ISO HIRA (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of HIRA mRNA CTD PMID:28628672 Hira Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of HIRA mRNA CTD PMID:36041667 Hira Rat aflatoxin B1 increases expression ISO Hira (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of HIRA mRNA CTD PMID:19770486 Hira Rat all-trans-retinoic acid decreases expression ISO HIRA (Homo sapiens) 6480464 Tretinoin results in decreased expression of HIRA mRNA CTD PMID:15498508 Hira Rat amiodarone increases expression ISO HIRA (Homo sapiens) 6480464 Amiodarone results in increased expression of HIRA mRNA CTD PMID:19774075 Hira Rat antirheumatic drug decreases expression ISO HIRA (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of HIRA mRNA CTD PMID:24449571 Hira Rat arsenous acid increases expression ISO Hira (Mus musculus) 6480464 Arsenic Trioxide results in increased expression of HIRA mRNA CTD PMID:35676786 Hira Rat benzo[a]pyrene decreases expression ISO HIRA (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of HIRA mRNA CTD PMID:20498004 Hira Rat benzo[a]pyrene diol epoxide I decreases expression ISO HIRA (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 Hira Rat biotin decreases expression ISO HIRA (Homo sapiens) 6480464 Biotin results in decreased expression of HIRA mRNA CTD PMID:15219929 Hira Rat bisphenol A increases expression ISO Hira (Mus musculus) 6480464 bisphenol A results in increased expression of HIRA mRNA CTD PMID:26063408 Hira Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of HIRA mRNA CTD PMID:36041667 Hira Rat bisphenol A multiple interactions ISO HIRA (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of HIRA gene and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of HIRA mRNA CTD PMID:28628672 and PMID:31601247 Hira Rat bisphenol A affects methylation ISO Hira (Mus musculus) 6480464 bisphenol A affects the methylation of HIRA promoter CTD PMID:27334623 Hira Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of HIRA mRNA CTD PMID:25181051 Hira Rat Bisphenol A diglycidyl ether affects splicing ISO Hira (Mus musculus) 6480464 bisphenol A diglycidyl ether affects the splicing of HIRA mRNA CTD PMID:36464114 Hira Rat bisphenol AF affects splicing ISO Hira (Mus musculus) 6480464 bisphenol AF affects the splicing of HIRA mRNA CTD PMID:36464114 Hira Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of HIRA mRNA CTD PMID:36041667 Hira Rat butanal decreases expression ISO HIRA (Homo sapiens) 6480464 butyraldehyde results in decreased expression of HIRA mRNA CTD PMID:26079696 Hira Rat cadmium atom decreases expression ISO HIRA (Homo sapiens) 6480464 Cadmium results in decreased expression of HIRA mRNA CTD PMID:21297354 Hira Rat caffeine affects phosphorylation ISO HIRA (Homo sapiens) 6480464 Caffeine affects the phosphorylation of HIRA protein CTD PMID:35688186 Hira Rat copper(II) sulfate decreases expression ISO HIRA (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of HIRA mRNA CTD PMID:19549813 Hira Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of HIRA mRNA CTD PMID:26577399 Hira Rat cyclosporin A decreases expression ISO HIRA (Homo sapiens) 6480464 Cyclosporine results in decreased expression of HIRA mRNA CTD PMID:25562108 Hira Rat dexamethasone multiple interactions ISO HIRA (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of HIRA mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of HIRA mRNA CTD PMID:28628672 Hira Rat diarsenic trioxide increases expression ISO Hira (Mus musculus) 6480464 Arsenic Trioxide results in increased expression of HIRA mRNA CTD PMID:35676786 Hira Rat Dibutyl phosphate affects expression ISO HIRA (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of HIRA mRNA CTD PMID:37042841 Hira Rat dorsomorphin multiple interactions ISO HIRA (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of HIRA mRNA CTD PMID:27188386 Hira Rat entinostat decreases expression ISO HIRA (Homo sapiens) 6480464 entinostat results in decreased expression of HIRA mRNA CTD PMID:27188386 Hira Rat ethanol affects splicing ISO Hira (Mus musculus) 6480464 Ethanol affects the splicing of HIRA mRNA CTD PMID:30319688 Hira Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of HIRA mRNA CTD PMID:24136188 Hira Rat folic acid decreases expression ISO Hira (Mus musculus) 6480464 Folic Acid results in decreased expression of HIRA mRNA CTD PMID:25629700 Hira Rat FR900359 increases phosphorylation ISO HIRA (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of HIRA protein CTD PMID:37730182 Hira Rat fulvestrant multiple interactions ISO HIRA (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of HIRA gene CTD PMID:31601247 Hira Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of HIRA mRNA CTD PMID:33387578 Hira Rat glycidyl methacrylate decreases expression ISO HIRA (Homo sapiens) 6480464 glycidyl methacrylate results in decreased expression of HIRA protein CTD PMID:36641056 Hira Rat indole-3-methanol affects expression EXP 6480464 indole-3-carbinol affects the expression of HIRA mRNA CTD PMID:21396975 Hira Rat indometacin multiple interactions ISO HIRA (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of HIRA mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of HIRA mRNA CTD PMID:28628672 Hira Rat methyl methanesulfonate decreases expression ISO HIRA (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of HIRA mRNA CTD PMID:23649840 Hira Rat N-nitrosodiethylamine increases expression ISO Hira (Mus musculus) 6480464 Diethylnitrosamine results in increased expression of HIRA mRNA CTD PMID:17942915 Hira Rat N-nitrosodiethylamine multiple interactions ISO Hira (Mus musculus) 6480464 MET protein inhibits the reaction [Diethylnitrosamine results in increased expression of HIRA mRNA] CTD PMID:17942915 Hira Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of HIRA mRNA CTD PMID:25729387 Hira Rat pentanal decreases expression ISO HIRA (Homo sapiens) 6480464 pentanal results in decreased expression of HIRA mRNA CTD PMID:26079696 Hira Rat quinolin-8-ol decreases expression ISO HIRA (Homo sapiens) 6480464 Oxyquinoline results in decreased expression of HIRA mRNA CTD PMID:21632981 Hira Rat SB 431542 multiple interactions ISO HIRA (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of HIRA mRNA CTD PMID:27188386 Hira Rat sodium arsenite increases expression ISO HIRA (Homo sapiens) 6480464 sodium arsenite results in increased expression of HIRA mRNA CTD PMID:28595984 and PMID:34032870 Hira Rat sodium arsenite decreases expression ISO HIRA (Homo sapiens) 6480464 sodium arsenite results in decreased expression of HIRA mRNA CTD PMID:38568856 Hira Rat tamibarotene affects expression ISO HIRA (Homo sapiens) 6480464 tamibarotene affects the expression of HIRA mRNA CTD PMID:15498508 Hira Rat tetrachloromethane affects expression ISO Hira (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of HIRA mRNA CTD PMID:17484886 Hira Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of HIRA mRNA CTD PMID:31150632 Hira Rat titanium dioxide increases expression ISO Hira (Mus musculus) 6480464 titanium dioxide results in increased expression of HIRA mRNA CTD PMID:29264374 Hira Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of HIRA mRNA CTD PMID:25729387 Hira Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of HIRA mRNA CTD PMID:33387578 Hira Rat trichostatin A increases expression ISO HIRA (Homo sapiens) 6480464 trichostatin A results in increased expression of HIRA mRNA CTD PMID:26272509 Hira Rat trichostatin A multiple interactions ISO HIRA (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of HIRA mRNA CTD PMID:27188386 Hira Rat triphenyl phosphate affects expression ISO HIRA (Homo sapiens) 6480464 triphenyl phosphate affects the expression of HIRA mRNA CTD PMID:37042841 Hira Rat triptonide increases expression ISO Hira (Mus musculus) 6480464 triptonide results in increased expression of HIRA mRNA CTD PMID:33045310 Hira Rat troglitazone decreases expression ISO Hira (Mus musculus) 6480464 troglitazone results in decreased expression of HIRA mRNA CTD PMID:28973697 Hira Rat valproic acid increases methylation ISO HIRA (Homo sapiens) 6480464 Valproic Acid results in increased methylation of HIRA gene CTD PMID:29154799
1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 3,3',5-triiodo-L-thyronine (ISO) 3-chloropropane-1,2-diol (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) amiodarone (ISO) antirheumatic drug (ISO) arsenous acid (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) biotin (ISO) bisphenol A (EXP,ISO) Bisphenol A diglycidyl ether (ISO) bisphenol AF (ISO) bisphenol F (EXP) butanal (ISO) cadmium atom (ISO) caffeine (ISO) copper(II) sulfate (ISO) Cuprizon (EXP) cyclosporin A (ISO) dexamethasone (ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dorsomorphin (ISO) entinostat (ISO) ethanol (ISO) flutamide (EXP) folic acid (ISO) FR900359 (ISO) fulvestrant (ISO) gentamycin (EXP) glycidyl methacrylate (ISO) indole-3-methanol (EXP) indometacin (ISO) methyl methanesulfonate (ISO) N-nitrosodiethylamine (ISO) oxaliplatin (EXP) pentanal (ISO) quinolin-8-ol (ISO) SB 431542 (ISO) sodium arsenite (ISO) tamibarotene (ISO) tetrachloromethane (EXP,ISO) titanium dioxide (ISO) topotecan (EXP) trichloroethene (EXP) trichostatin A (ISO) triphenyl phosphate (ISO) triptonide (ISO) troglitazone (ISO) valproic acid (ISO)
Hira Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 11 95,528,831 - 95,637,565 (-) NCBI GRCr8 mRatBN7.2 11 82,024,469 - 82,133,212 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 11 82,024,469 - 82,133,529 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 11 90,753,636 - 90,862,674 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 11 83,414,851 - 83,523,894 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 11 82,468,120 - 82,577,162 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 11 86,168,196 - 86,276,430 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 11 86,168,196 - 86,276,430 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 11 89,270,162 - 89,378,396 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Celera 11 80,805,603 - 80,913,841 (-) NCBI Celera Cytogenetic Map 11 q23 NCBI
HIRA Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 22 19,330,698 - 19,431,733 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 22 19,330,698 - 19,447,450 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 22 19,318,221 - 19,419,256 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 22 17,698,224 - 17,799,219 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 22 17,692,777 - 17,793,773 NCBI Celera 22 3,170,348 - 3,271,476 (-) NCBI Celera Cytogenetic Map 22 q11.21 ENTREZGENE HuRef 22 2,938,779 - 3,039,800 (-) NCBI HuRef CHM1_1 22 19,317,795 - 19,418,793 (-) NCBI CHM1_1 T2T-CHM13v2.0 22 19,707,409 - 19,808,564 (-) NCBI T2T-CHM13v2.0
Hira Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 16 18,695,500 - 18,789,059 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 16 18,695,787 - 18,789,059 (+) Ensembl GRCm39 Ensembl GRCm38 16 18,876,750 - 18,970,309 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 16 18,877,037 - 18,970,309 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 16 18,876,843 - 18,970,402 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 16 18,790,313 - 18,883,872 (+) NCBI MGSCv36 mm8 Celera 16 19,450,807 - 19,544,362 (+) NCBI Celera Cytogenetic Map 16 A3 NCBI cM Map 16 11.69 NCBI
LOC102009660 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955442 18,581,370 - 18,673,761 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955442 18,581,370 - 18,673,590 (+) NCBI ChiLan1.0 ChiLan1.0
LOC100977781 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 23 28,955,170 - 29,056,833 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 22 31,498,613 - 31,604,572 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 22 2,087,846 - 2,191,192 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 22 17,765,598 - 17,845,654 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 22 17,765,598 - 17,847,084 (-) Ensembl panpan1.1 panPan2
HIRA Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 26 29,777,984 - 29,867,992 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 26 29,778,086 - 29,867,559 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 26 29,733,351 - 29,822,268 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 26 31,179,782 - 31,268,951 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 26 31,179,884 - 31,268,655 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 26 29,227,072 - 29,316,422 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 26 28,852,492 - 28,941,149 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 26 29,939,424 - 30,028,570 (+) NCBI UU_Cfam_GSD_1.0
LOC101957075 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 139,372,372 - 139,471,877 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936619 3,282,173 - 3,380,151 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936619 3,282,170 - 3,380,151 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
HIRA Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 14 51,029,126 - 51,102,409 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 14 51,029,117 - 51,102,409 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 14 54,596,123 - 54,669,440 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
HIRA Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 19 6,324,050 - 6,424,999 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 19 6,324,253 - 6,425,641 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666085 508,725 - 609,791 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
LOC101713307
.
Predicted Target Of
Count of predictions: 325 Count of miRNA genes: 206 Interacting mature miRNAs: 241 Transcripts: ENSRNOT00000075164 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
724554 Iddm17 Insulin dependent diabetes mellitus QTL 17 0.001 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 11 18976208 86241447 Rat 70208 Niddm22 Non-insulin dependent diabetes mellitus QTL 22 3.61 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 11 59802794 82566553 Rat 1581565 Pur10 Proteinuria QTL 10 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 11 44803318 82846466 Rat 634339 Niddm50 Non-insulin dependent diabetes mellitus QTL 50 3.32 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 11 66422148 86241447 Rat 1549848 Bvd6 Brain ventricular dilatation QTL 6 3.1 0.0001 brain ventricle morphology trait (VT:0000822) hydrocephalus severity score (CMO:0001881) 11 66113321 82169223 Rat 10450831 Scl80 Serum cholesterol level QTL 80 4.7 0.01 blood LDL cholesterol amount (VT:0000181) blood low density lipoprotein cholesterol level (CMO:0000053) 11 76957131 83051965 Rat 10058954 Gmadr7 Adrenal mass QTL 7 2.49 0.0049 adrenal gland mass (VT:0010420) both adrenal glands wet weight to body weight ratio (CMO:0002411) 11 60346590 86241447 Rat 1300135 Rf19 Renal function QTL 19 3.38 blood creatinine amount (VT:0005328) creatinine clearance (CMO:0000765) 11 40946188 82566702 Rat 1354656 Bvd3 Brain ventricular dilatation QTL 3 3.64 0.001 brain ventricle morphology trait (VT:0000822) hydrocephalus severity score (CMO:0001881) 11 69446070 82846715 Rat 2312566 Glom20 Glomerulus QTL 20 3.6 0.001 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 11 44285759 82566702 Rat 1354593 Stl12 Serum triglyceride level QTL 12 3.36 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 11 66422148 86241447 Rat 724563 Uae10 Urinary albumin excretion QTL 10 6 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 11 27672410 82846715 Rat 724561 Plsm4 Polydactyly-luxate syndrome (PLS) morphotypes QTL 4 0.0003 forelimb integrity trait (VT:0010562) front foot phalanges count (CMO:0001947) 11 54457534 86241447 Rat 4889521 Gluco62 Glucose level QTL 62 2.82 0.001 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 11 55136729 82993457 Rat 7411658 Foco27 Food consumption QTL 27 16.2 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 11 56351424 86241447 Rat 631506 Bp104 Blood pressure QTL 104 2.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 11 59802794 82566545 Rat 1581572 Uae35 Urinary albumin excretion QTL 35 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 11 44803318 82846466 Rat 1300110 Stl7 Serum triglyceride level QTL 7 4.64 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 11 29528418 82566702 Rat
D11Got81
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 11 82,126,584 - 82,126,804 (+) MAPPER mRatBN7.2 Rnor_6.0 11 86,269,803 - 86,270,022 NCBI Rnor6.0 Rnor_5.0 11 89,371,769 - 89,371,988 UniSTS Rnor5.0 Celera 11 80,907,218 - 80,907,437 UniSTS RH 3.4 Map 11 698.3 RGD RH 3.4 Map 11 698.3 UniSTS
BE115254
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 11 82,091,728 - 82,091,892 (+) MAPPER mRatBN7.2 Rnor_6.0 11 85,870,299 - 85,870,462 NCBI Rnor6.0 Rnor_6.0 11 86,235,449 - 86,235,612 NCBI Rnor6.0 Rnor_5.0 11 89,337,415 - 89,337,578 UniSTS Rnor5.0 Rnor_5.0 11 88,970,630 - 88,970,793 UniSTS Rnor5.0 Celera 11 80,872,849 - 80,873,012 UniSTS RH 3.4 Map 11 694.1 UniSTS
Hira
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 11 82,132,470 - 82,132,627 (+) MAPPER mRatBN7.2 Rnor_6.0 11 86,275,689 - 86,275,845 NCBI Rnor6.0 Rnor_5.0 11 89,377,655 - 89,377,811 UniSTS Rnor5.0 Celera 11 80,913,100 - 80,913,256 UniSTS Cytogenetic Map 11 p12 UniSTS
D22S1095E
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 11 82,024,581 - 82,024,683 (+) MAPPER mRatBN7.2 Rnor_6.0 11 85,802,649 - 85,802,750 NCBI Rnor6.0 Rnor_6.0 11 86,168,309 - 86,168,410 NCBI Rnor6.0 Rnor_5.0 11 89,270,275 - 89,270,376 UniSTS Rnor5.0 Rnor_5.0 11 88,902,980 - 88,903,081 UniSTS Rnor5.0 Celera 11 80,805,716 - 80,805,817 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
89
88
57
25
57
6
216
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000071462 ⟹ ENSRNOP00000065274
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 11 82,024,469 - 82,133,529 (-) Ensembl Rnor_6.0 Ensembl 11 85,802,605 - 85,895,613 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000075164 ⟹ ENSRNOP00000064357
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 11 82,024,469 - 82,133,212 (-) Ensembl Rnor_6.0 Ensembl 11 86,168,196 - 86,276,430 (-) Ensembl
RefSeq Acc Id:
NM_001135760 ⟹ NP_001129232
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 95,528,831 - 95,637,565 (-) NCBI mRatBN7.2 11 82,024,469 - 82,133,212 (-) NCBI Rnor_6.0 11 86,168,196 - 86,276,430 (-) NCBI Rnor_5.0 11 89,270,162 - 89,378,396 (-) NCBI Celera 11 80,805,603 - 80,913,841 (-) RGD
Sequence:
CTCTCTGCTCTGCCTGGCCTGTTTCTACGTCTATGCAAACGCCCCGCTCTTCCAATAAATGCTCCAGTCTGGCCCCCTATCCTTCTCCATTAGGCTAGCTCCTTTATGCATGCAATCGAGCCCAGCGT
hide sequence
RefSeq Acc Id:
XM_063270678 ⟹ XP_063126748
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 95,528,831 - 95,636,962 (-) NCBI
RefSeq Acc Id:
XM_063270679 ⟹ XP_063126749
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 95,528,831 - 95,636,962 (-) NCBI
RefSeq Acc Id:
XM_063270680 ⟹ XP_063126750
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 95,528,831 - 95,633,644 (-) NCBI
RefSeq Acc Id:
XM_063270681 ⟹ XP_063126751
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 95,528,831 - 95,636,883 (-) NCBI
RefSeq Acc Id:
XM_063270682 ⟹ XP_063126752
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 95,528,831 - 95,619,827 (-) NCBI
RefSeq Acc Id:
XM_063270683 ⟹ XP_063126753
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 95,528,831 - 95,618,004 (-) NCBI
RefSeq Acc Id:
XR_010055965
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 95,552,752 - 95,636,962 (-) NCBI
RefSeq Acc Id:
NP_001129232 ⟸ NM_001135760
- UniProtKB:
M0R4R2 (UniProtKB/TrEMBL)
- Sequence:
MKLLKPTWVNHNGKPIFSVDIHPDGTKFATGGQGQDSGKVVIWNMSPVLQEDDEKDENIPKMLCQMDNHLACVNCVRWSNSGMYLASGGDDKLIMVWKRATYIGPSTVFGSSGKLANVEQWRCVSILR
hide sequence
Ensembl Acc Id:
ENSRNOP00000064357 ⟸ ENSRNOT00000075164
Ensembl Acc Id:
ENSRNOP00000065274 ⟸ ENSRNOT00000071462
RefSeq Acc Id:
XP_063126749 ⟸ XM_063270679
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_063126748 ⟸ XM_063270678
- Peptide Label:
isoform X1
- UniProtKB:
M0R756 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063126751 ⟸ XM_063270681
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_063126750 ⟸ XM_063270680
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_063126752 ⟸ XM_063270682
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_063126753 ⟸ XM_063270683
- Peptide Label:
isoform X4
RGD ID: 13698294 Promoter ID: EPDNEW_R8817 Type: multiple initiation site Name: Hira_1 Description: histone cell cycle regulator SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 11 86,275,971 - 86,276,031 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2021-03-09
Hira
histone cell cycle regulator
LOC100911837
protein HIRA-like
Data merged from RGD:6490647
737654 PROVISIONAL
2013-09-16
Hira
histone cell cycle regulator
Hira
HIR histone cell cycle regulation defective homolog A (S. cerevisiae)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2012-07-05
LOC100911837
protein HIRA-like
Symbol and Name status set to provisional
70820 PROVISIONAL
2008-12-01
Hira
HIR histone cell cycle regulation defective homolog A (S. cerevisiae)
LOC363849
similar to histone cell cycle regulation defective homolog A isoform 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-11-19
LOC363849
similar to histone cell cycle regulation defective homolog A isoform 1
Symbol and Name status set to provisional
70820 PROVISIONAL
