Symbol:
Copg1 (Ensembl: Hmces)
Name:
COPI coat complex subunit gamma 1 (Ensembl:5-hydroxymethylcytosine binding, ES cell specific)
RGD ID:
1565292
Description:
Predicted to enable structural molecule activity. Involved in establishment of Golgi localization and organelle transport along microtubule. Located in Golgi membrane. Human ortholog(s) of this gene implicated in immunodeficiency 128. Orthologous to human COPG1 (COPI coat complex subunit gamma 1); INTERACTS WITH 2,6-dinitrotoluene; 4,4'-sulfonyldiphenol; 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
coatomer protein complex, subunit gamma; coatomer protein complex, subunit gamma 1; coatomer subunit gamma; coatomer subunit gamma-1; Copg; gamma-1-coat protein; gamma-1-COP; gamma-coat protein; gamma-COP
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
COPG1 (COPI coat complex subunit gamma 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Copg1 (coatomer protein complex, subunit gamma 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Copg1 (COPI coat complex subunit gamma 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
COPG1 (COPI coat complex subunit gamma 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
COPG1 (COPI coat complex subunit gamma 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Copg1 (COPI coat complex subunit gamma 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
COPG1 (COPI coat complex subunit gamma 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
COPG1 (COPI coat complex subunit gamma 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Copg1 (COPI coat complex subunit gamma 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
HMCES (5-hydroxymethylcytosine binding, ES cell specific) HGNC
EggNOG, OrthoDB
Alliance orthologs 3
Homo sapiens (human):
COPG1 (COPI coat complex subunit gamma 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Copg1 (coatomer protein complex, subunit gamma 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
copg2 (coatomer protein complex, subunit gamma 2)
Alliance
DIOPT (InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
SEC21
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
T14G10.5
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
gammaCOP
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
copg1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 121,923,644 - 121,949,819 (+) NCBI GRCr8 mRatBN7.2 4 120,366,540 - 120,392,502 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 120,366,542 - 120,415,616 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 125,839,212 - 125,863,727 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 121,613,989 - 121,638,505 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 120,238,238 - 120,262,752 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 119,815,041 - 119,840,997 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 119,815,139 - 119,864,114 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 185,062,623 - 185,088,579 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 122,109,613 - 122,134,049 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 4 109,326,188 - 109,350,625 (+) NCBI Celera Cytogenetic Map 4 q34 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Copg1 Rat 1,2-dimethylhydrazine increases expression ISO Copg1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of COPG1 mRNA CTD PMID:22206623 Copg1 Rat 17alpha-ethynylestradiol multiple interactions ISO Copg1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of COPG1 mRNA CTD PMID:17942748 Copg1 Rat 17beta-estradiol increases expression ISO Copg1 (Mus musculus) 6480464 Estradiol results in increased expression of COPG1 mRNA CTD PMID:39298647 Copg1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Copg1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of COPG1 mRNA CTD PMID:17942748 Copg1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Copg1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of COPG1 mRNA CTD PMID:21570461 Copg1 Rat 2,6-dimethoxyphenol multiple interactions ISO COPG1 (Homo sapiens) 6480464 [Furaldehyde co-treated with pyrogallol 1 more ... CTD PMID:38598786 Copg1 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of COPG1 mRNA CTD PMID:21346803 Copg1 Rat 3,4-methylenedioxymethamphetamine increases expression ISO Copg1 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of COPG1 mRNA CTD PMID:20188158 Copg1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO COPG1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of COPG1 mRNA CTD PMID:28628672 Copg1 Rat 4,4'-diaminodiphenylmethane increases expression ISO Copg1 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of COPG1 mRNA CTD PMID:18648102 Copg1 Rat 4,4'-sulfonyldiphenol increases expression ISO Copg1 (Mus musculus) 6480464 bisphenol S results in increased expression of COPG1 mRNA CTD PMID:39298647 Copg1 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of COPG1 mRNA CTD PMID:36041667 Copg1 Rat 4,4'-sulfonyldiphenol increases expression ISO COPG1 (Homo sapiens) 6480464 bisphenol S results in increased expression of COPG1 protein CTD PMID:34186270 Copg1 Rat 4-hydroxyphenyl retinamide decreases expression ISO Copg1 (Mus musculus) 6480464 Fenretinide results in decreased expression of COPG1 mRNA CTD PMID:28973697 Copg1 Rat 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole affects expression EXP 6480464 Omeprazole affects the expression of COPG1 mRNA CTD PMID:19483382 Copg1 Rat 6-propyl-2-thiouracil affects expression EXP 6480464 Propylthiouracil affects the expression of COPG1 mRNA CTD PMID:19483382 Copg1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of COPG1 mRNA CTD PMID:30047161 Copg1 Rat actinomycin D multiple interactions ISO COPG1 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of and results in increased secretion of COPG1 protein CTD PMID:38460933 Copg1 Rat amiodarone affects expression EXP 6480464 Amiodarone affects the expression of COPG1 mRNA CTD PMID:19483382 Copg1 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of COPG1 mRNA CTD PMID:30047161 Copg1 Rat benzbromarone affects expression EXP 6480464 Benzbromarone affects the expression of COPG1 mRNA CTD PMID:19483382 Copg1 Rat benzo[a]pyrene decreases expression ISO COPG1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of COPG1 mRNA CTD PMID:20106945 Copg1 Rat benzo[a]pyrene affects methylation ISO COPG1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of COPG1 intron CTD PMID:30157460 Copg1 Rat benzo[a]pyrene increases expression ISO Copg1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of COPG1 mRNA CTD PMID:22228805 Copg1 Rat benzo[a]pyrene multiple interactions ISO Copg1 (Mus musculus) 6480464 AHR protein affects the reaction [Benzo(a)pyrene affects the expression of COPG1 mRNA] CTD PMID:22228805 Copg1 Rat benzo[e]pyrene decreases methylation ISO COPG1 (Homo sapiens) 6480464 benzo(e)pyrene results in decreased methylation of COPG1 intron CTD PMID:30157460 Copg1 Rat beta-lapachone decreases expression ISO COPG1 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of COPG1 mRNA CTD PMID:38218311 Copg1 Rat beta-lapachone increases expression ISO COPG1 (Homo sapiens) 6480464 beta-lapachone results in increased expression of COPG1 mRNA CTD PMID:38218311 Copg1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of COPG1 mRNA CTD PMID:25181051 Copg1 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of COPG1 mRNA CTD PMID:36041667 Copg1 Rat bisphenol A increases expression ISO COPG1 (Homo sapiens) 6480464 bisphenol A results in increased expression of COPG1 protein CTD PMID:37567409 Copg1 Rat bisphenol A affects expression ISO COPG1 (Homo sapiens) 6480464 bisphenol A affects the expression of COPG1 mRNA CTD PMID:30903817 Copg1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of COPG1 mRNA CTD PMID:30816183 and PMID:32145629 Copg1 Rat bisphenol AF increases expression ISO COPG1 (Homo sapiens) 6480464 bisphenol AF results in increased expression of COPG1 protein CTD PMID:34186270 Copg1 Rat Bisphenol B increases expression ISO COPG1 (Homo sapiens) 6480464 bisphenol B results in increased expression of COPG1 protein CTD PMID:34186270 Copg1 Rat bisphenol F multiple interactions ISO COPG1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of COPG1 mRNA CTD PMID:28628672 Copg1 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of COPG1 mRNA CTD PMID:36041667 Copg1 Rat buspirone decreases expression EXP 6480464 Buspirone results in decreased expression of COPG1 mRNA CTD PMID:24136188 Copg1 Rat caffeine decreases phosphorylation ISO COPG1 (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of COPG1 protein CTD PMID:35688186 Copg1 Rat clofibrate decreases expression ISO Copg1 (Mus musculus) 6480464 Clofibrate results in decreased expression of COPG1 mRNA CTD PMID:17585979 Copg1 Rat clofibrate affects expression EXP 6480464 Clofibrate affects the expression of COPG1 mRNA CTD PMID:19483382 Copg1 Rat clofibric acid affects expression EXP 6480464 Clofibric Acid affects the expression of COPG1 mRNA CTD PMID:17602206 Copg1 Rat cyclosporin A increases expression ISO COPG1 (Homo sapiens) 6480464 Cyclosporine results in increased expression of COPG1 mRNA CTD PMID:20106945 more ... Copg1 Rat dexamethasone multiple interactions ISO COPG1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of COPG1 mRNA CTD PMID:28628672 Copg1 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of COPG1 mRNA CTD PMID:21266533 Copg1 Rat dicrotophos increases expression ISO COPG1 (Homo sapiens) 6480464 dicrotophos results in increased expression of COPG1 mRNA CTD PMID:28302478 Copg1 Rat elemental selenium increases expression ISO COPG1 (Homo sapiens) 6480464 Selenium results in increased expression of COPG1 mRNA CTD PMID:19244175 Copg1 Rat enzyme inhibitor multiple interactions ISO COPG1 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of COPG1 protein CTD PMID:23301498 Copg1 Rat ethanol affects splicing ISO Copg1 (Mus musculus) 6480464 Ethanol affects the splicing of COPG1 mRNA CTD PMID:30319688 Copg1 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of COPG1 mRNA CTD PMID:24136188 Copg1 Rat folic acid decreases expression ISO Copg1 (Mus musculus) 6480464 Folic Acid results in decreased expression of COPG1 mRNA CTD PMID:25629700 Copg1 Rat FR900359 affects phosphorylation ISO COPG1 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of COPG1 protein CTD PMID:37730182 Copg1 Rat furfural multiple interactions ISO COPG1 (Homo sapiens) 6480464 [Furaldehyde co-treated with pyrogallol 1 more ... CTD PMID:38598786 Copg1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of COPG1 mRNA CTD PMID:22061828 Copg1 Rat glafenine increases expression EXP 6480464 Glafenine results in increased expression of COPG1 mRNA CTD PMID:24136188 Copg1 Rat indometacin multiple interactions ISO COPG1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of COPG1 mRNA CTD PMID:28628672 Copg1 Rat inulin multiple interactions ISO Copg1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of COPG1 mRNA CTD PMID:36331819 Copg1 Rat ivermectin decreases expression ISO COPG1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of COPG1 protein CTD PMID:32959892 Copg1 Rat L-ethionine affects expression EXP 6480464 Ethionine affects the expression of COPG1 mRNA CTD PMID:19483382 Copg1 Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of COPG1 mRNA CTD PMID:30467583 Copg1 Rat methapyrilene decreases methylation ISO COPG1 (Homo sapiens) 6480464 Methapyrilene results in decreased methylation of COPG1 intron CTD PMID:30157460 Copg1 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of COPG1 mRNA CTD PMID:30047161 Copg1 Rat methotrexate affects expression ISO Copg1 (Mus musculus) 6480464 Methotrexate affects the expression of COPG1 mRNA CTD PMID:18502557 Copg1 Rat N-acetyl-L-cysteine multiple interactions ISO Copg1 (Mus musculus) 6480464 Acetylcysteine inhibits the reaction [Paraquat results in increased methylation of COPG1 mRNA] CTD PMID:34425375 Copg1 Rat nitrates multiple interactions ISO Copg1 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of COPG1 mRNA CTD PMID:35964746 Copg1 Rat Nutlin-3 multiple interactions ISO COPG1 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of and results in increased secretion of COPG1 protein CTD PMID:38460933 Copg1 Rat omeprazole affects expression EXP 6480464 Omeprazole affects the expression of COPG1 mRNA CTD PMID:19483382 Copg1 Rat paracetamol multiple interactions ISO Copg1 (Mus musculus) 6480464 MAP3K5 protein affects the reaction [Acetaminophen results in increased expression of COPG1 mRNA] CTD PMID:18700144 Copg1 Rat paraquat multiple interactions ISO Copg1 (Mus musculus) 6480464 Acetylcysteine inhibits the reaction [Paraquat results in increased methylation of COPG1 mRNA] CTD PMID:34425375 Copg1 Rat paraquat increases methylation ISO Copg1 (Mus musculus) 6480464 Paraquat results in increased methylation of COPG1 mRNA CTD PMID:34425375 Copg1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Copg1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of COPG1 mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of COPG1 mRNA CTD PMID:36331819 Copg1 Rat perfluorooctanoic acid decreases expression ISO COPG1 (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of COPG1 protein CTD PMID:26879310 Copg1 Rat phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of COPG1 mRNA CTD PMID:30047161 Copg1 Rat pirinixic acid affects expression EXP 6480464 pirinixic acid affects the expression of COPG1 mRNA CTD PMID:19483382 Copg1 Rat SB 431542 multiple interactions ISO COPG1 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in decreased expression of COPG1 protein CTD PMID:37664457 Copg1 Rat selenium atom increases expression ISO COPG1 (Homo sapiens) 6480464 Selenium results in increased expression of COPG1 mRNA CTD PMID:19244175 Copg1 Rat silicon dioxide affects secretion ISO COPG1 (Homo sapiens) 6480464 Silicon Dioxide analog affects the secretion of COPG1 protein CTD PMID:25895662 Copg1 Rat sodium arsenate increases expression ISO Copg1 (Mus musculus) 6480464 sodium arsenate results in increased expression of COPG1 mRNA CTD PMID:30953684 Copg1 Rat sodium arsenite increases expression ISO COPG1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of COPG1 mRNA CTD PMID:38568856 Copg1 Rat sodium arsenite decreases expression ISO COPG1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of COPG1 protein CTD PMID:30528433 Copg1 Rat sodium chloride multiple interactions ISO COPG1 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of COPG1 protein more ... CTD PMID:38598786 Copg1 Rat sodium fluoride decreases expression ISO Copg1 (Mus musculus) 6480464 Sodium Fluoride results in decreased expression of COPG1 mRNA and Sodium Fluoride results in decreased expression of COPG1 protein CTD PMID:27862939 and PMID:28918527 Copg1 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of COPG1 mRNA CTD PMID:30047161 Copg1 Rat temozolomide decreases expression ISO COPG1 (Homo sapiens) 6480464 Temozolomide results in decreased expression of COPG1 mRNA CTD PMID:31758290 Copg1 Rat testosterone decreases expression ISO Copg1 (Mus musculus) 6480464 Testosterone deficiency results in decreased expression of COPG1 mRNA CTD PMID:33848595 Copg1 Rat thapsigargin increases expression ISO COPG1 (Homo sapiens) 6480464 Thapsigargin results in increased expression of COPG1 mRNA CTD PMID:22378314 and PMID:29453283 Copg1 Rat thapsigargin increases expression EXP 6480464 Thapsigargin results in increased expression of COPG1 protein CTD PMID:35544339 Copg1 Rat thioacetamide affects expression EXP 6480464 Thioacetamide affects the expression of COPG1 mRNA CTD PMID:19483382 Copg1 Rat tolcapone affects binding EXP 6480464 tolcapone binds to COPG1 protein CTD PMID:19783845 Copg1 Rat triphenyl phosphate affects expression ISO COPG1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of COPG1 mRNA CTD PMID:37042841 Copg1 Rat trovafloxacin decreases expression EXP 6480464 trovafloxacin results in decreased expression of COPG1 mRNA CTD PMID:24136188 Copg1 Rat tunicamycin increases expression ISO COPG1 (Homo sapiens) 6480464 Tunicamycin results in increased expression of COPG1 mRNA CTD PMID:22378314 and PMID:29453283 Copg1 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of COPG1 mRNA CTD PMID:23034163 Copg1 Rat zinc atom increases expression ISO COPG1 (Homo sapiens) 6480464 Zinc deficiency results in increased expression of COPG1 mRNA CTD PMID:22171008 Copg1 Rat zinc(0) increases expression ISO COPG1 (Homo sapiens) 6480464 Zinc deficiency results in increased expression of COPG1 mRNA CTD PMID:22171008
1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,6-dimethoxyphenol (ISO) 2,6-dinitrotoluene (EXP) 3,4-methylenedioxymethamphetamine (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 4-hydroxyphenyl retinamide (ISO) 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP) 6-propyl-2-thiouracil (EXP) actinomycin D (ISO) amiodarone (EXP) amitrole (EXP) benzbromarone (EXP) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) beta-lapachone (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (EXP,ISO) buspirone (EXP) caffeine (ISO) clofibrate (EXP,ISO) clofibric acid (EXP) cyclosporin A (ISO) dexamethasone (ISO) dibutyl phthalate (EXP) dicrotophos (ISO) elemental selenium (ISO) enzyme inhibitor (ISO) ethanol (ISO) flutamide (EXP) folic acid (ISO) FR900359 (ISO) furfural (ISO) gentamycin (EXP) glafenine (EXP) indometacin (ISO) inulin (ISO) ivermectin (ISO) L-ethionine (EXP) methapyrilene (EXP,ISO) methimazole (EXP) methotrexate (ISO) N-acetyl-L-cysteine (ISO) nitrates (ISO) Nutlin-3 (ISO) omeprazole (EXP) paracetamol (ISO) paraquat (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenobarbital (EXP) pirinixic acid (EXP) SB 431542 (ISO) selenium atom (ISO) silicon dioxide (ISO) sodium arsenate (ISO) sodium arsenite (ISO) sodium chloride (ISO) sodium fluoride (ISO) sulfadimethoxine (EXP) temozolomide (ISO) testosterone (ISO) thapsigargin (EXP,ISO) thioacetamide (EXP) tolcapone (EXP) triphenyl phosphate (ISO) trovafloxacin (EXP) tunicamycin (ISO) vinclozolin (EXP) zinc atom (ISO) zinc(0) (ISO)
Copg1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 121,923,644 - 121,949,819 (+) NCBI GRCr8 mRatBN7.2 4 120,366,540 - 120,392,502 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 120,366,542 - 120,415,616 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 125,839,212 - 125,863,727 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 121,613,989 - 121,638,505 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 120,238,238 - 120,262,752 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 119,815,041 - 119,840,997 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 119,815,139 - 119,864,114 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 185,062,623 - 185,088,579 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 122,109,613 - 122,134,049 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 4 109,326,188 - 109,350,625 (+) NCBI Celera Cytogenetic Map 4 q34 NCBI
COPG1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 129,249,606 - 129,277,773 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 129,249,606 - 129,277,773 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 128,968,449 - 128,996,616 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 130,451,143 - 130,479,306 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 3 130,451,150 - 130,479,312 NCBI Celera 3 127,399,234 - 127,427,322 (+) NCBI Celera Cytogenetic Map 3 q21.3 NCBI HuRef 3 126,353,590 - 126,381,662 (+) NCBI HuRef CHM1_1 3 128,931,675 - 128,959,852 (+) NCBI CHM1_1 T2T-CHM13v2.0 3 131,994,406 - 132,022,572 (+) NCBI T2T-CHM13v2.0
Copg1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 87,864,801 - 87,890,577 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 87,864,796 - 87,890,577 (+) Ensembl GRCm39 Ensembl GRCm38 6 87,887,819 - 87,913,595 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 87,887,814 - 87,913,595 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 87,837,934 - 87,863,589 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 87,853,581 - 87,879,236 (+) NCBI MGSCv36 mm8 Celera 6 89,824,999 - 89,850,681 (+) NCBI Celera Cytogenetic Map 6 D1 NCBI cM Map 6 39.13 NCBI
Copg1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955429 13,578,494 - 13,616,463 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955429 13,582,676 - 13,615,801 (+) NCBI ChiLan1.0 ChiLan1.0
COPG1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 127,185,345 - 127,213,547 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 127,190,069 - 127,218,271 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 126,310,558 - 126,338,726 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 133,664,856 - 133,693,633 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 3 133,664,856 - 133,694,849 (+) Ensembl panpan1.1 panPan2
COPG1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 2,832,150 - 2,860,356 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 20 2,832,198 - 2,860,320 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 2,869,065 - 2,897,262 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 2,852,770 - 2,880,977 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 20 2,844,919 - 2,880,996 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 20 2,572,649 - 2,600,856 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 2,895,653 - 2,923,949 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 2,860,084 - 2,888,263 (-) NCBI UU_Cfam_GSD_1.0
Copg1
COPG1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 71,672,733 - 71,730,399 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 71,707,097 - 71,730,402 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 79,410,094 - 79,420,841 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
COPG1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 22 51,787,002 - 51,812,031 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 22 51,787,340 - 51,812,026 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666041 114,585,201 - 114,613,333 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Copg1
.
Assembly: Rnor_6.0
Chromosome Start Pos End Pos Reference Nucleotide Variant Nucleotide Variant Type Strain Variant Page
4
119839020
119839021
G
A
snv
European Variation Archive Release 3 , European Variation Archive Release 4, European Variation Archive Release 6, MR/N (2020), SHR/OlalpcvMcwi (2019), SHRSP/A3NCrl (2019), SHRSP/Gcrc (RGD), WKY/Gcrc (RGD), BXH2/CubMcwi (2020), BXH3/CubMcwi (2020), HXB2/IpcvMcwi (2019), SHR/NHsd (RGD) View more Information
Predicted Target Of
Count of predictions: 29 Count of miRNA genes: 27 Interacting mature miRNAs: 28 Transcripts: ENSRNOT00000016137 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1582232 Gluco25 Glucose level QTL 25 3.6 0.0023 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 85253748 148090731 Rat 631689 Scl4 Serum cholesterol level QTL 4 1.9 0.008 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 4 95174120 140174120 Rat 1358352 Srcrt3 Stress Responsive Cort QTL 3 2.29 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 38465774 146803430 Rat 1578655 Bmd11 Bone mineral density QTL 11 11 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 4 90850165 135850165 Rat 1300116 Hrtrt5 Heart rate QTL 5 3.76 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 4 116179486 151161268 Rat 10755501 Bp390 Blood pressure QTL 390 2.5 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 4 26775591 168368347 Rat 61330 Eau1 Experimental allergic uveoretinitis QTL 1 0.0003 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 4 70362013 132642728 Rat 731165 Uae21 Urinary albumin excretion QTL 21 2.4 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 4 106649412 151649412 Rat 737821 Hcar9 Hepatocarcinoma resistance QTL 9 3.7 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 4 109866907 167139601 Rat 1549832 Bss3 Bone structure and strength QTL 3 11 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 4 109827074 154827074 Rat 70177 Xhs1 X-ray hypersensitivity QTL 1 25.1 intestine integrity trait (VT:0010554) post-insult time to onset of moribundity (CMO:0001896) 4 82798864 152731274 Rat 61476 Aia3 Adjuvant induced arthritis QTL 3 3.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 86730991 131730991 Rat 1641919 Alc22 Alcohol consumption QTL 22 0.0005 drinking behavior trait (VT:0001422) ethanol drink intake rate (CMO:0001407) 4 81192555 126192555 Rat 1354660 Salc1 Saline consumption QTL 1 11.26 drinking behavior trait (VT:0001422) saline drink intake rate (CMO:0001627) 4 44463908 148090542 Rat 1298082 Stresp4 Stress response QTL 4 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 50119848 146803430 Rat 1578670 Bss14 Bone structure and strength QTL 14 16.4 femur morphology trait (VT:0000559) bone trabecular cross-sectional area (CMO:0002311) 4 87327165 132327165 Rat 70201 Gcr1 Gastric cancer resistance QTL 1 2.7 stomach morphology trait (VT:0000470) stomach tumor susceptibility score (CMO:0002043) 4 120260281 147278687 Rat 70200 Alc18 Alcohol consumption QTL 18 9.2 drinking behavior trait (VT:0001422) ethanol intake volume to total fluid intake volume ratio (CMO:0001591) 4 56647873 149491524 Rat 1331759 Hrtrt13 Heart rate QTL 13 3.54628 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 4 110275411 168266883 Rat 724535 Cm18 Cardiac mass QTL 18 2.6 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 4 118856416 163856416 Rat 2316958 Gluco58 Glucose level QTL 58 10 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 11320076 180699135 Rat 1578662 Bss15 Bone structure and strength QTL 15 19.6 femur width (VT:1000666) femoral neck width (CMO:0001695) 4 87327165 132327165 Rat 2302049 Pia32 Pristane induced arthritis QTL 32 5.1 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin G-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002112) 4 105789505 150789505 Rat 6478763 Anxrr46 Anxiety related response QTL 46 0.07428 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 110870972 155870972 Rat 6478760 Anxrr45 Anxiety related response QTL 45 0.06717 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 110870972 155870972 Rat 1331802 Srn5 Serum renin concentration QTL 5 3.045 renin activity (VT:0005581) plasma renin activity level (CMO:0000116) 4 119428175 157578333 Rat 738009 Sach4 Saccharine consumption QTL 4 4.9 0.000016 consumption behavior trait (VT:0002069) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 4 59948935 154902892 Rat 2312567 Glom19 Glomerulus QTL 19 1.9 0.006 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 4 45456990 146803430 Rat 738015 Pia9 Pristane induced arthritis QTL 9 4.5 0.048 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 80694870 125694870 Rat 7207480 Bss105 Bone structure and strength QTL 105 8.1 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 4 109827074 154827074 Rat 634335 Anxrr16 Anxiety related response QTL 16 7.22 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 4 93308457 167139447 Rat 631646 Stl4 Serum triglyceride level QTL 4 6.5 0.0001 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 4 73169846 132642728 Rat 634334 Xhs3 X-ray hypersensitivity QTL 3 10 intestine integrity trait (VT:0010554) post-insult time to onset of moribundity (CMO:0001896) 4 84728680 129854654 Rat 61406 Scwia1 Streptococcal cell wall induced arthritis QTL 1 2.3 joint integrity trait (VT:0010548) experimental arthritis severity measurement (CMO:0001459) 4 106805662 151805662 Rat 1354612 Foco1 Food consumption QTL 1 8.87 eating behavior trait (VT:0001431) food intake rate (CMO:0000427) 4 44463908 148090542 Rat 2303168 Bp330 Blood pressure QTL 330 4.25 0.017 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 5214602 146446691 Rat 738031 Alc14 Alcohol consumption QTL 14 7.6 0.00003 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 1576316 Ept5 Estrogen-induced pituitary tumorigenesis QTL 5 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 4 83428419 177635233 Rat 631662 Hcar2 Hepatocarcinoma resistance QTL 2 3.1 0.0003 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 4 78878504 123878504 Rat 1576305 Emca6 Estrogen-induced mammary cancer QTL 6 5.8 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 4 44463720 155883716 Rat 61418 Pia5 Pristane induced arthritis QTL 5 4.5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 62277855 128289560 Rat 738016 Alc16 Alcohol consumption QTL 16 3.6 0.00015 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 1358202 Gluco11 Glucose level QTL 11 2.4 0.02 adipocyte glucose uptake trait (VT:0004185) absolute change in adipocyte glucose uptake (CMO:0000873) 4 85379421 167139601 Rat 1641833 Alc21 Alcohol consumption QTL 21 8.6 0.0001 drinking behavior trait (VT:0001422) ethanol drink intake rate (CMO:0001407) 4 56698790 126192555 Rat 631674 Iddm14 Insulin dependent diabetes mellitus QTL 14 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 4 64528739 157573521 Rat 12798519 Anxrr54 Anxiety related response QTL 54 2.54 0.05 locomotor behavior trait (VT:0001392) distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493) 4 114627026 159627026 Rat 12798523 Anxrr56 Anxiety related response QTL 56 2.83 0.05 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 85253748 150276390 Rat 61434 Cia3 Collagen induced arthritis QTL 3 4.8 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 103194656 148194656 Rat 12798527 Anxrr58 Anxiety related response QTL 58 4.11 0.05 locomotor behavior trait (VT:0001392) distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493) 4 119463257 147278687 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
3
11
43
82
57
60
41
19
41
160
73
74
35
41
19
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000016137 ⟹ ENSRNOP00000016137
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 120,366,647 - 120,391,392 (+) Ensembl Rnor_6.0 Ensembl 4 119,815,246 - 119,839,683 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000057286 ⟹ ENSRNOP00000054105
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 120,392,850 - 120,415,616 (+) Ensembl Rnor_6.0 Ensembl 4 119,842,013 - 119,864,114 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000083402 ⟹ ENSRNOP00000071817
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 120,366,542 - 120,393,727 (+) Ensembl Rnor_6.0 Ensembl 4 119,815,139 - 119,845,473 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000101593 ⟹ ENSRNOP00000079638
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 120,366,642 - 120,391,410 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000108333 ⟹ ENSRNOP00000090408
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 120,366,640 - 120,391,410 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000110571 ⟹ ENSRNOP00000084887
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 120,366,628 - 120,392,498 (+) Ensembl
RefSeq Acc Id:
NM_001031822 ⟹ NP_001026992
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 121,923,962 - 121,949,819 (+) NCBI mRatBN7.2 4 120,366,639 - 120,392,498 (+) NCBI Rnor_6.0 4 119,815,246 - 119,839,683 (+) NCBI Rnor_5.0 4 185,062,623 - 185,088,579 (+) NCBI RGSC_v3.4 4 122,109,613 - 122,134,049 (+) RGD Celera 4 109,326,188 - 109,350,625 (+) RGD
Sequence:
ATGTTGAAGAAATTCGACAAGAAGGACGAGGAGTCTGGTGGAGGTTCCAACCCCCTCCAGCACCTGGAGAAGAGTGCAGTACTCCAAGAGGCTCGGGTCTTTAACGAAACTCCTATCAACCCCCGGAA
hide sequence
RefSeq Acc Id:
XM_008763066 ⟹ XP_008761288
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 121,923,644 - 121,948,731 (+) NCBI mRatBN7.2 4 120,366,540 - 120,392,502 (+) NCBI Rnor_6.0 4 119,815,041 - 119,840,997 (+) NCBI
Sequence:
CTAGATTTTGACTGTCTCCGGGCAGGCAATGAAGGTGTAACGTGGAAGCAGTTGTGCGCAGGCGCAGACGATAGAGTGCGCAGGCGCAGTCCAAAGAGCAGTGCTCAGGGCGACGTGGCGGGCGGGAG
hide sequence
RefSeq Acc Id:
NP_001026992 ⟸ NM_001031822
- UniProtKB:
Q4AEF8 (UniProtKB/Swiss-Prot), A6IB29 (UniProtKB/TrEMBL), A0A8I5ZY43 (UniProtKB/TrEMBL)
- Sequence:
MLKKFDKKDEESGGGSNPLQHLEKSAVLQEARVFNETPINPRKCAHILTKILYLINQGEHLGTTEATEAFFAMTKLFQSNDPTLRRMCYLTIKEMSCIAEDVIIVTSSLTKDMTGKEDNYRGPAVRAL
hide sequence
RefSeq Acc Id:
XP_008761288 ⟸ XM_008763066
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I5ZY43 (UniProtKB/TrEMBL)
- Sequence:
MLKKFDKKDEESGGGSNPLQHLEKSAVLQEARVFNETPINPRKCAHILTKILYLINQGEHLGTTEATEAFFAMTKLFQSNDPTLRRMCYLTIKEMSCIAEDVIIVTSSLTKDMTGKEDNYRGPAVRAL
hide sequence
Ensembl Acc Id:
ENSRNOP00000016137 ⟸ ENSRNOT00000016137
Ensembl Acc Id:
ENSRNOP00000054105 ⟸ ENSRNOT00000057286
Ensembl Acc Id:
ENSRNOP00000071817 ⟸ ENSRNOT00000083402
Ensembl Acc Id:
ENSRNOP00000090408 ⟸ ENSRNOT00000108333
Ensembl Acc Id:
ENSRNOP00000084887 ⟸ ENSRNOT00000110571
Ensembl Acc Id:
ENSRNOP00000079638 ⟸ ENSRNOT00000101593
RGD ID: 13693229 Promoter ID: EPDNEW_R3750 Type: initiation region Name: Copg1_1 Description: coatomer protein complex, subunit gamma 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 4 119,815,140 - 119,815,200 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2019-11-11
Copg1
COPI coat complex subunit gamma 1
Copg1
coatomer protein complex, subunit gamma 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2012-07-16
Copg1
coatomer protein complex, subunit gamma 1
Copg
coatomer protein complex, subunit gamma
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-02-09
Copg
coatomer protein complex, subunit gamma
Symbol and Name status set to provisional
70820 PROVISIONAL
