Advanced Search (OLGA)

Gene: Cxcl16 (C-X-C motif chemokine ligand 16) Rattus norvegicus

Analyze

Symbol:

Cxcl16

Name:

C-X-C motif chemokine ligand 16

RGD ID:

1562928

Description:

Predicted to enable chemokine activity; low-density lipoprotein particle receptor activity; and scavenger receptor activity. Predicted to be involved in several processes, including cellular response to lipopolysaccharide; response to tumor necrosis factor; and response to type II interferon. Predicted to be located in membrane. Predicted to be active in extracellular space. Orthologous to human CXCL16 (C-X-C motif chemokine ligand 16); PARTICIPATES IN chemokine mediated signaling pathway; cytokine mediated signaling pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 2,3,7,8-tetrachlorodibenzodioxine; 4,4'-diaminodiphenylmethane.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

C-X-C motif chemokine 16; chemokine (C-X-C motif) ligand 16; similar to chemokine (C-X-C motif) ligand 16; small-inducible cytokine B16; transmembrane chemokine CXCL16

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	55,665,355 - 55,669,950 (-)	NCBI		GRCr8
mRatBN7.2	10	55,166,721 - 55,171,316 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	55,166,723 - 55,171,592 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	59,845,644 - 59,850,516 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	59,334,153 - 59,339,026 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	54,833,353 - 54,838,107 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	57,060,005 - 57,064,600 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	57,060,007 - 57,064,600 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	56,817,242 - 56,821,837 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	57,296,126 - 57,300,721 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	10	54,313,016 - 54,317,611 (-)	NCBI		Celera
Cytogenetic Map	10	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

COVID-19 (ISO)

Experimental Liver Cirrhosis (ISO)

systemic scleroderma (ISO)

viral pneumonia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (ISO)

1-chloro-2,4-dinitrobenzene (ISO)

1-naphthyl isothiocyanate (EXP)

1-octadec-9-enoylglycero-3-phosphate (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-diaminodiphenylmethane (EXP)

4-(ethoxymethylene)-2-phenyloxazol-5-one (ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

acrolein (ISO)

aflatoxin B1 (EXP)

all-trans-retinoic acid (ISO)

amitrole (EXP)

anthra[1,9-cd]pyrazol-6(2H)-one (EXP)

antirheumatic drug (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (ISO)

benzene (ISO)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

beta-lapachone (ISO)

beta-naphthoflavone (EXP)

bis(2-chloroethyl) sulfide (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

butan-1-ol (ISO)

caffeine (ISO)

cantharidin (ISO)

carbon nanotube (ISO)

chenodeoxycholic acid (ISO)

choline (ISO)

cisplatin (ISO)

cobalt atom (ISO)

crocidolite asbestos (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

cypermethrin (EXP)

DDE (ISO)

dexamethasone (ISO)

diarsenic trioxide (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP,ISO)

dioxygen (ISO)

endosulfan (EXP)

epoxiconazole (ISO)

ethanol (ISO)

fentanyl (EXP)

flutamide (EXP)

folic acid (ISO)

furan (EXP)

gentamycin (EXP)

glycine betaine (EXP)

L-methionine (ISO)

lidocaine (EXP)

lipopolysaccharide (ISO)

monocrotaline (ISO)

N-nitrosodiethylamine (EXP)

N-nitrosodimethylamine (EXP)

nickel atom (ISO)

nickel dichloride (ISO)

nickel sulfate (ISO)

oxaliplatin (EXP)

paracetamol (EXP)

paraquat (EXP)

perfluorononanoic acid (ISO)

phorbol 13-acetate 12-myristate (ISO)

pirinixic acid (ISO)

potassium chromate (ISO)

propiconazole (EXP)

quercetin (ISO)

silicon dioxide (ISO)

simvastatin (EXP)

sodium arsenite (ISO)

Soman (EXP)

succimer (ISO)

sulfadimethoxine (EXP)

sunitinib (ISO)

taurocholic acid (ISO)

temozolomide (ISO)

tetrachloromethane (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

toluene 2,4-diisocyanate (ISO)

topotecan (EXP)

trichloroethene (EXP)

triphenyl phosphate (ISO)

valproic acid (ISO)

vancomycin (ISO)

vinclozolin (EXP)

zinc atom (ISO)

zinc(0) (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to lipopolysaccharide (ISO)

lymphocyte chemotaxis (IEA)

positive regulation of cell growth (IEA,ISO)

positive regulation of cell migration (IBA,IEA,ISO)

receptor-mediated endocytosis (IEA)

response to cytokine (ISO)

response to tumor necrosis factor (IEA,ISO)

response to type II interferon (IEA,ISO)

signal transduction (IEA)

T cell chemotaxis (IBA,ISO)

Cellular Component

extracellular space (IBA,IEA,ISO)

membrane (IEA,ISO)

Molecular Function

chemokine activity (IBA,IEA,ISO)

chemokine receptor binding (ISO)

low-density lipoprotein particle receptor activity (IBA,IEA,ISO)

scavenger receptor activity (IBA,IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

chemokine mediated signaling pathway (IEA)

cytokine mediated signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Imbalanced Host Response to SARS-CoV-2 Drives Development of COVID-19.	Blanco-Melo D, etal., Cell. 2020 May 28;181(5):1036-1045.e9. doi: 10.1016/j.cell.2020.04.026. Epub 2020 May 15.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Serum chemokine and cytokine levels as indicators of disease activity in patients with systemic sclerosis.	Hasegawa M, etal., Clin Rheumatol. 2011 Feb;30(2):231-7. Epub 2010 Nov 4.
4.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
5.	Dysregulated expression of MIG/CXCL9, IP-10/CXCL10 and CXCL16 and their receptors in systemic sclerosis.	Rabquer BJ, etal., Arthritis Res Ther. 2011 Feb 8;13(1):R18.
6.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:11017100	PMID:11060282	PMID:15890643	PMID:18373975	PMID:19919988	PMID:24006456	PMID:29030988	PMID:35512476

Genomics

Comparative Map Data

Cxcl16
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	55,665,355 - 55,669,950 (-)	NCBI		GRCr8
mRatBN7.2	10	55,166,721 - 55,171,316 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	55,166,723 - 55,171,592 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	59,845,644 - 59,850,516 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	59,334,153 - 59,339,026 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	54,833,353 - 54,838,107 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	57,060,005 - 57,064,600 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	57,060,007 - 57,064,600 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	56,817,242 - 56,821,837 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	57,296,126 - 57,300,721 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	10	54,313,016 - 54,317,611 (-)	NCBI		Celera
Cytogenetic Map	10	q24	NCBI

CXCL16
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	4,733,533 - 4,739,928 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	4,733,533 - 4,739,928 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	17	4,636,828 - 4,643,223 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	4,583,577 - 4,589,972 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	17	4,583,583 - 4,589,863	NCBI
Celera	17	4,652,030 - 4,658,426 (-)	NCBI		Celera
Cytogenetic Map	17	p13.2	NCBI
HuRef	17	4,525,914 - 4,531,582 (-)	NCBI		HuRef
CHM1_1	17	4,645,559 - 4,651,953 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	17	4,623,202 - 4,629,598 (-)	NCBI		T2T-CHM13v2.0

Cxcl16
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	70,345,215 - 70,350,810 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	70,344,809 - 70,350,810 (-)	Ensembl		GRCm39 Ensembl
GRCm38	11	70,454,389 - 70,459,984 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	70,453,983 - 70,459,984 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	70,267,736 - 70,273,486 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	70,270,429 - 70,276,179 (-)	NCBI		MGSCv36	mm8
Celera	11	78,000,199 - 78,005,953 (-)	NCBI		Celera
Cytogenetic Map	11	B3	NCBI
cM Map	11	42.99	NCBI

Cxcl16
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955467	10,132,461 - 10,136,649 (-)	NCBI	ChiLan1.0	ChiLan1.0

CXCL16
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	12,351,100 - 12,357,230 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	14,319,363 - 14,325,829 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	4,789,280 - 4,795,656 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	4,778,717 - 4,785,639 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	17	4,778,717 - 4,785,639 (-)	Ensembl	panpan1.1		panPan2

CXCL16
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	31,816,889 - 31,820,975 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	31,816,667 - 31,820,840 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	31,955,979 - 31,960,601 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	31,921,756 - 31,926,380 (+)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	5	31,888,075 - 31,892,688 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	31,847,757 - 31,852,370 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	32,023,989 - 32,028,615 (+)	NCBI		UU_Cfam_GSD_1.0

Cxcl16
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	52,738,369 - 52,743,825 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936677	3,157,144 - 3,163,210 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936677	3,157,173 - 3,162,599 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CXCL16
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	12	52,145,100 - 52,150,267 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	12	54,264,331 - 54,269,485 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CXCL16
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	4,214,823 - 4,220,339 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	16	4,211,621 - 4,219,789 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666059	17,420,672 - 17,426,403 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cxcl16
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624786	8,589,687 - 8,594,059 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Cxcl16
41 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	266
Count of miRNA genes:	173
Interacting mature miRNAs:	198
Transcripts:	ENSRNOT00000032926
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61441	Btemp1	Thermal response to stress QTL 1	4		body temperature trait (VT:0005535)	core body temperature (CMO:0001036)	10	35392457	63642539	Rat
1549846	Scl47	Serum cholesterol level QTL 47	3.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	10	50574707	95574707	Rat
9589136	Insul27	Insulin level QTL 27	10.46	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	10	11474010	56474010	Rat
152025229	Scl83	Serum cholesterol level QTL 83	4.33		blood cholesterol amount (VT:0000180)		10	35710580	68663659	Rat
1578779	Tcas10	Tongue tumor susceptibility QTL 10	3.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	10	31297439	76297439	Rat
152025227	Bw195	Body weight QTL 195	5.73		body mass (VT:0001259)		10	46989699	68663659	Rat
631564	Apr3	Acute phase response QTL 3	3.9		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	10	15275955	60275955	Rat
1298069	Bp168	Blood pressure QTL 168	5.5		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	10	26521957	98003205	Rat
2293669	Bmd33	Bone mineral density QTL 33	4.5	0.0001	femur strength trait (VT:0010010)	femoral neck polar moment of inertia (CMO:0001670)	10	49444551	81709989	Rat
152025224	Bw193	Body weight QTL 193	6.47		body mass (VT:0001259)		10	51663405	75085664	Rat
631552	Vetf2	Vascular elastic tissue fragility QTL 2	4.5	0.0002	aorta elastic tissue integrity trait (VT:0010556)	artery internal elastic lamina non-tumorous lesion count (CMO:0001913)	10	41142633	86142633	Rat
631554	Bp133	Blood pressure QTL 133		0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	743364	63851208	Rat
631557	Bp136	Blood pressure QTL 136		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	30632053	75632053	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
1298078	Stresp5	Stress response QTL 5	2.99	0.00025	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	42045676	104670812	Rat
2293679	Bmd30	Bone mineral density QTL 30	3.5	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	10	49444551	81709989	Rat
1578762	Toxo1	Toxoplasma gondii resistance QTL 1			brain integrity trait (VT:0010579)	percentage of study population displaying Toxoplasma gondii brain cysts at a point in time (CMO:0002028)	10	52200030	59378278	Rat
2298544	Neuinf9	Neuroinflammation QTL 9	4.6		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	10	5801990	62146030	Rat
70164	Bw21	Body weight QTL 21	4.36	0.00005	body mass (VT:0001259)	body weight (CMO:0000012)	10	53797494	98952626	Rat
61463	Bp12	Blood pressure QTL 12	6.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	41333258	86333258	Rat
8694173	Bw149	Body weight QTL 149	4.38	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	10	44441699	89441699	Rat
2300218	Hpcl2	Hepatic cholesterol level QTL 2			liver cholesterol amount (VT:0010498)	liver cholesterol level (CMO:0001597)	10	45029650	95600334	Rat
1554317	Bmd4	Bone mineral density QTL 4	9.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	19816042	99406971	Rat
70171	Cari1	Carrageenan-induced inflammation QTL 1	4.9	0.0005	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	10	53797385	107211142	Rat
1598852	Anxrr19	Anxiety related response QTL 19	5.07		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	10	18167841	63167841	Rat
1581497	Esta1	Estrogen-induced thymic atrophy QTL 1			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	21329805	61345413	Rat
724527	Bp148	Blood pressure QTL 148		0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	28453136	73453136	Rat
1358897	Stresp6	Stress response QTL 6	4.17	0.022	blood norepinephrine amount (VT:0005663)	plasma norepinephrine level (CMO:0001010)	10	35392267	64155584	Rat
1331762	Rf40	Renal function QTL 40	3.873		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	10	29299504	64155584	Rat
2300171	Bmd58	Bone mineral density QTL 58	4.9	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	26944628	71944628	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14487011	89062041	Rat
2303118	Mamtr7	Mammary tumor resistance QTL 7		0.003	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	9658275	104670812	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	42323132	87323132	Rat
9590310	Scort19	Serum corticosterone level QTL 19	6.3	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
9589030	Epfw9	Epididymal fat weight QTL 9	19.24	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	10	44441699	89441699	Rat
10402859	Bp381	Blood pressure QTL 381		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14487011	107057807	Rat
2293652	Bmd22	Bone mineral density QTL 22	4.9	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	10	49444551	81709989	Rat
70198	BpQTLcluster9	Blood pressure QTL cluster 9	2.94		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	42323132	87323132	Rat
1359017	Hrtrt21	Heart rate QTL 21	2.4		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	10	51772940	96772940	Rat
2306787	Ean3	Experimental allergic neuritis QTL 3	3.1		nervous system integrity trait (VT:0010566)	body weight loss (CMO:0001399)	10	53797385	66979128	Rat
6893352	Bw100	Body weight QTL 100	0.33	0.6	body mass (VT:0001259)	body weight (CMO:0000012)	1	15906665	60906665	Rat
724556	Pur2	Proteinuria QTL 2	5.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	22427500	90627625	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6154182	73453136	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	51770177	107211142	Rat
1354585	Eae18a	Experimental allergic encephalomyelitis QTL 18a	7.5	0.0004	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	10	53797385	58445852	Rat
70223	Bp57	Blood pressure QTL 57	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	1	80676123	Rat
1354587	Kidm21	Kidney mass QTL 21	3.3		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	10	15028513	60430477	Rat
6893350	Bw99	Body weight QTL 99	0.87	0.16	body mass (VT:0001259)	body weight (CMO:0000012)	1	15906665	60906665	Rat
2317043	Aia7	Adjuvant induced arthritis QTL 7	3.82		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	10	37565079	82565079	Rat
70224	Eae3	Experimental allergic encephalomyelitis QTL 3	4.1		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	10	26521957	61345413	Rat
2317042	Aia20	Adjuvant induced arthritis QTL 20	3.38		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	10	37565079	82565079	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29299504	107211142	Rat
2313087	Bmd80	Bone mineral density QTL 80	3.2	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	10	19606483	64606483	Rat
70364	Bp72	Blood pressure QTL 72			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	51121100	96121100	Rat
631530	Tls3	T-lymphoma susceptibility QTL 3	0	0.0001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	10	51774612	95600334	Rat
1354608	Cm33	Cardiac mass QTL 33	2.8		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	10	54809292	99809292	Rat
631535	Cm51	Cardiac mass QTL 51	3		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	10	51786282	91669536	Rat
1576319	Cia29	Collagen induced arthritis QTL 29			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	33973921	78973921	Rat
8552805	Bw145	Body weight QTL 145	2.2		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	10	41944526	78307017	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
2293705	Bmd25	Bone mineral density QTL 25	7.1	0.0001	femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	10	49444551	81709989	Rat
1576308	Schws1	Schwannoma susceptibility QTL 1		0.0041	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	40035094	102359817	Rat
631269	Cia22	Collagen induced arthritis QTL 22	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14487011	104060283	Rat
9590268	Scort13	Serum corticosterone level QTL 13	3.26	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
7207811	Bmd90	Bone mineral density QTL 90	5.2		femur size trait (VT:1000369)	femoral neck cross-sectional area (CMO:0001697)	10	49444551	81709989	Rat
1576311	Pia26	Pristane induced arthritis QTL 26			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	31224026	75632053	Rat
631270	Cia23	Collagen induced arthritis QTL 23	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
7411614	Foco18	Food consumption QTL 18		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	10	44441699	89441699	Rat
631547	Bp87	Blood pressure QTL 87	4.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	47369470	92369470	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6357896	96121100	Rat
6893342	Cm78	Cardiac mass QTL 78	0.1	0.88	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	10	42876766	79813922	Rat
2292441	Bp308	Blood pressure QTL 308			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
2313055	Bw96	Body weight QTL 96	3.6	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	10	19606483	64606483	Rat
631542	Bp82	Blood pressure QTL 82	6.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	26521957	98952741	Rat

Markers in Region

RH129630

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	55,166,724 - 55,166,927 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	57,060,009 - 57,060,211	NCBI	Rnor6.0
Rnor_5.0	10	56,817,246 - 56,817,448	UniSTS	Rnor5.0
RGSC_v3.4	10	57,296,130 - 57,296,332	UniSTS	RGSC3.4
Celera	10	54,313,020 - 54,313,222	UniSTS
RH 3.4 Map	5	451.1	UniSTS
Cytogenetic Map	10	q24	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001017478	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC079312	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ025528	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MN855531	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MN855532	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MN855533	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MN855534	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MN855535	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MN855536	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MN855537	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MN855538	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MN855539	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MN855540	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MN855541	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MN855542	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MN855543	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MN855544	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MN855545	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MN855546	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MN855547	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MN855548	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MN855549	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MN855550	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	Y17324	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000032926 ⟹ ENSRNOP00000037160

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	55,166,723 - 55,171,316 (-)	Ensembl
Rnor_6.0 Ensembl	10	57,060,007 - 57,064,600 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000118669 ⟹ ENSRNOP00000084149

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	55,166,844 - 55,171,592 (-)	Ensembl

RefSeq Acc Id:

NM_001017478 ⟹ NP_001017478

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	55,665,355 - 55,669,950 (-)	NCBI
mRatBN7.2	10	55,166,721 - 55,171,316 (-)	NCBI
Rnor_6.0	10	57,060,005 - 57,064,600 (-)	NCBI
Rnor_5.0	10	56,817,242 - 56,821,837 (-)	NCBI
RGSC_v3.4	10	57,296,126 - 57,300,721 (-)	RGD
Celera	10	54,313,016 - 54,317,611 (-)	RGD

Sequence:

show sequence

CCAGGAGTCTCGAGTCGGAAGGAGCTCCGCCTTCCGGGGCAGGGATGTGTGTGTCCCCCGACTG
GGAGCTGGGCGCAGCGCGGGCTCCCCGGTACTGACCAGACGGTCGGTTCAGGACAGCGCGCGGG
GGACAGAAGGCGCCACCACCTCGCGCCCCCTCCCTTCCTGAGCTTGGCACAGATCAGCGCCTCC
GCAAAGCATCAGCCAGGGTGAAGTGAAAGCAATAGAGAATCTGCTGGATGTCGGCTAGGTGACC
TGGCCTCAACAAGCTCCGCAGCGGCCTGAGATGAGGCGGGGCTTTGGACCCTTGGCCCTTACAC
TCTTCCTTTTCTTCTTTGCGCTGCTGACTCTGCCAGGCGATGGCAACCAGGGCAGTGTCGCTGG
AAGTTGCTACTGTGATCGTACAATTCCTTCTGGCACCCAGATACCGCCTGCTACTTTGAATCAT
ATGCGAAAATATCTGAAAACGTTCCATCGCTGTCAATTCTTTATCAGGTTCCAGTTGCAGTCCA
AGAGTGTGTGTGGAGGAAGCCAAGACCAGTGGGTCCGTGAACTAGTGAACTGCTTTGAGCACAA
ACAATGTGGAATCGGTCATGGGCAGAGTTTTCACCACCAAAAACATGTGCCTCAAGCCAGTACC
CGGATCCCTGAGGCCACAGAAGGGAAACCTCCAGACACAAGCACGGCTGTACAGTTTCAGAGCA
CCCAGCAGTCCACTTTTCCATCTGGAGCACCATCCTTGAACAAAGAGCTCACCCGCCACTGGGA
AACAACCATTCTCCCTTCAGGCTATGGTCTGGAGGCTAGGCCTGTGGCTGAGGCAAATGAGAAA
CAGCACAAACAGCAAAAAGAACCAGGAGCTGGTGCTGGCACACAAGCCTTGGTGCCGGTGCTAT
CCCTCCTGGCCATCGTCTTCTTCCTCGTGGCAGCCATGGTCTGTGTGCTGTGCAACAGGAGAGT
GACTCGGCAGAGCTCTTCAGGTTTGCAGCTCTGTTATACACCTGTTGAACCAAGACCCCAGGGC
CTGTAGCAAGAATGGAAGCTCGTGAGAGATGATGTGGGAGAGGTGGCAGACAGACTGGCAGGCT
AGGCTCCATCAACGAACTGAATCTGAGCTCATTTTTTCTGGTGATGTTTTGAATCAAAGTAGCC
ATTATGTAATCTAGGACAGCTTTGAACTACAGAGCCTGTGCCCCGACCTCCTAGATTCTGGGAT
TATAGATATATCCTACTGCATCTGCCCTCGTCTACTTTCATAAATAAGGTATAAATTTTCAGGT
TTTTGTTTTGTTTAGCGAAGATCTTATTTAGCCCAAGCCAACCTCAAATTCCCTATGTATCTCT
AGGTCCCCTGCCTCCTTACACACTCACTAAACGCTTTTCTTTTTGGTTTGTTTGAGACAGGGTT
TCACTATTCAGCCTTGACAGTCCTAGAACTCAGAAAGGTCTGCCTTTCTGCAGTGTTGGGATTA
AAGGACTGCCCTTGGGAAACCCTCTTTACAACTAATAACATCTGCATAGCCCCTCTGCCCTAGC
CTTTCCCCTGCCTCTAATAAAATGTAATACTCTCAAGTATGTGGTCCAAAAGTGCAGTCAGAGG
TGGAGTGTAAAGTTCGAGGTTCAACCTGCCCATTAACAGATTAATTTTAAAAAGTGTCTGCTTT
TTACATTGTGTAACAATAAACTGGACAAATTCTATGTTTTTAAAAAAAAAAAAAAAAAAAAAAA
AA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001017478	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH79312	(Get FASTA)	NCBI Sequence Viewer
	AAY42602	(Get FASTA)	NCBI Sequence Viewer
	EDM05006	(Get FASTA)	NCBI Sequence Viewer
	EDM05007	(Get FASTA)	NCBI Sequence Viewer
	EDM05008	(Get FASTA)	NCBI Sequence Viewer
	EDM05009	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000037160.4
	ENSRNOP00000084149.1
GenBank Protein	Q6AXU5	(Get FASTA)	NCBI Sequence Viewer
	QJQ49351	(Get FASTA)	NCBI Sequence Viewer
	QJQ49352	(Get FASTA)	NCBI Sequence Viewer
	QJQ49353	(Get FASTA)	NCBI Sequence Viewer
	QJQ49354	(Get FASTA)	NCBI Sequence Viewer
	QJQ49355	(Get FASTA)	NCBI Sequence Viewer
	QJQ49356	(Get FASTA)	NCBI Sequence Viewer
	QJQ49357	(Get FASTA)	NCBI Sequence Viewer
	QJQ49358	(Get FASTA)	NCBI Sequence Viewer
	QJQ49359	(Get FASTA)	NCBI Sequence Viewer
	QJQ49360	(Get FASTA)	NCBI Sequence Viewer
	QJQ49361	(Get FASTA)	NCBI Sequence Viewer
	QJQ49362	(Get FASTA)	NCBI Sequence Viewer
	QJQ49363	(Get FASTA)	NCBI Sequence Viewer
	QJQ49364	(Get FASTA)	NCBI Sequence Viewer
	QJQ49365	(Get FASTA)	NCBI Sequence Viewer
	QJQ49366	(Get FASTA)	NCBI Sequence Viewer
	QJQ49367	(Get FASTA)	NCBI Sequence Viewer
	QJQ49368	(Get FASTA)	NCBI Sequence Viewer
	QJQ49369	(Get FASTA)	NCBI Sequence Viewer
	QJQ49370	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001017478 ⟸ NM_001017478
- Peptide Label:	precursor
- UniProtKB:	Q6AXU5 (UniProtKB/Swiss-Prot), A0A6M4C4P9 (UniProtKB/TrEMBL), A0A6M4C4V5 (UniProtKB/TrEMBL)
- Sequence:	show sequence MRRGFGPLALTLFLFFFALLTLPGDGNQGSVAGSCYCDRTIPSGTQIPPATLNHMRKYLKTFHR CQFFIRFQLQSKSVCGGSQDQWVRELVNCFEHKQCGIGHGQSFHHQKHVPQASTRIPEATEGKP PDTSTAVQFQSTQQSTFPSGAPSLNKELTRHWETTILPSGYGLEARPVAEANEKQHKQQKEPGA GAGTQALVPVLSLLAIVFFLVAAMVCVLCNRRVTRQSSSGLQLCYTPVEPRPQGL hide sequence

Ensembl Acc Id:

ENSRNOP00000037160 ⟸ ENSRNOT00000032926

Ensembl Acc Id:

ENSRNOP00000084149 ⟸ ENSRNOT00000118669

Protein Domains

C-X-C motif chemokine

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6AXU5-F1-model_v2	AlphaFold	Q6AXU5	1-247	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13697359

Promoter ID:

EPDNEW_R7883

Type:

initiation region

Name:

Cxcl16_1

Description:

C-X-C motif chemokine ligand 16

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	10	57,064,560 - 57,064,620	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1562928	AgrOrtholog
BioCyc Gene	G2FUF-24460	BioCyc
Ensembl Genes	ENSRNOG00000026647	Ensembl, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000032926.5	UniProtKB/Swiss-Prot
	ENSRNOT00000118669.1	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7134808	IMAGE-MGC_LOAD
InterPro	CXCL16	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	CXCL16_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:497942	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:94457	IMAGE-MGC_LOAD
NCBI Gene	497942	ENTREZGENE
PANTHER	C-X-C MOTIF CHEMOKINE 16	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR14385	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	CXCL16	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Cxcl16	PhenoGen
RatGTEx	ENSRNOG00000026647	RatGTEx
UniProt	A0A6M4C4D5_RAT	UniProtKB/TrEMBL
	A0A6M4C4E8_RAT	UniProtKB/TrEMBL
	A0A6M4C4F8_RAT	UniProtKB/TrEMBL
	A0A6M4C4I0_RAT	UniProtKB/TrEMBL
	A0A6M4C4M1_RAT	UniProtKB/TrEMBL
	A0A6M4C4P9	ENTREZGENE, UniProtKB/TrEMBL
	A0A6M4C4Q4_RAT	UniProtKB/TrEMBL
	A0A6M4C4S4_RAT	UniProtKB/TrEMBL
	A0A6M4C4V5	ENTREZGENE, UniProtKB/TrEMBL
	A0A6M4C538_RAT	UniProtKB/TrEMBL
	A0A6M4C545_RAT	UniProtKB/TrEMBL
	A0A6M4C548_RAT	UniProtKB/TrEMBL
	A0A8I6GBI0_RAT	UniProtKB/TrEMBL
	A6HG51_RAT	UniProtKB/TrEMBL
	CXL16_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-03-08	Cxcl16	C-X-C motif chemokine ligand 16	Cxcl16	chemokine (C-X-C motif) ligand 16	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-03	Cxcl16	chemokine (C-X-C motif) ligand 16	Cxcl16	similar to chemokine (C-X-C motif) ligand 16	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-02-09	Cxcl16	similar to chemokine (C-X-C motif) ligand 16			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)