Symbol:
Cxcl16
Name:
C-X-C motif chemokine ligand 16
RGD ID:
1562928
Description:
Predicted to enable chemokine activity; low-density lipoprotein particle receptor activity; and scavenger receptor activity. Predicted to be involved in several processes, including cellular response to lipopolysaccharide; response to tumor necrosis factor; and response to type II interferon. Predicted to be located in membrane. Predicted to be active in extracellular space. Orthologous to human CXCL16 (C-X-C motif chemokine ligand 16); PARTICIPATES IN chemokine mediated signaling pathway; cytokine mediated signaling pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 2,3,7,8-tetrachlorodibenzodioxine; 4,4'-diaminodiphenylmethane.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
C-X-C motif chemokine 16; chemokine (C-X-C motif) ligand 16; similar to chemokine (C-X-C motif) ligand 16; small-inducible cytokine B16; transmembrane chemokine CXCL16
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CXCL16 (C-X-C motif chemokine ligand 16)
HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Cxcl16 (C-X-C motif chemokine ligand 16)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Cxcl16 (C-X-C motif chemokine ligand 16)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CXCL16 (C-X-C motif chemokine ligand 16)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CXCL16 (C-X-C motif chemokine ligand 16)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Cxcl16 (C-X-C motif chemokine ligand 16)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CXCL16 (C-X-C motif chemokine ligand 16)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CXCL16 (C-X-C motif chemokine ligand 16)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Cxcl16 (C-X-C motif chemokine ligand 16)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
ABCC5 (ATP binding cassette subfamily C member 5)
HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
CXCL16 (C-X-C motif chemokine ligand 16)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Cxcl16 (C-X-C motif chemokine ligand 16)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 55,665,355 - 55,669,950 (-) NCBI GRCr8 mRatBN7.2 10 55,166,721 - 55,171,316 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 55,166,723 - 55,171,592 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 59,845,644 - 59,850,516 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 59,334,153 - 59,339,026 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 54,833,353 - 54,838,107 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 57,060,005 - 57,064,600 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 57,060,007 - 57,064,600 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 56,817,242 - 56,821,837 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 57,296,126 - 57,300,721 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 10 54,313,016 - 54,317,611 (-) NCBI Celera Cytogenetic Map 10 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Cxcl16 Rat 1,1-dichloroethene increases expression ISO RGD:1558593 6480464 vinylidene chloride results in increased expression of CXCL16 mRNA CTD PMID:26682919 Cxcl16 Rat 1,2-dimethylhydrazine increases expression ISO RGD:1558593 6480464 1,2-Dimethylhydrazine results in increased expression of CXCL16 mRNA CTD PMID:22206623 Cxcl16 Rat 1,2-dimethylhydrazine multiple interactions ISO RGD:1558593 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of CXCL16 mRNA CTD PMID:22206623 Cxcl16 Rat 1-chloro-2,4-dinitrobenzene decreases expression ISO RGD:1558593 6480464 Dinitrochlorobenzene results in decreased expression of CXCL16 mRNA CTD PMID:21404309 Cxcl16 Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of CXCL16 mRNA CTD PMID:25380136|PMID:30723492 Cxcl16 Rat 1-octadec-9-enoylglycero-3-phosphate multiple interactions ISO RGD:1558593 6480464 3-(4-(4-((1-(2-chlorophenyl)ethoxy)carbonyl amino)-3-methyl-5-isoxazolyl) benzylsulfanyl) propanoic acid inhibits the reaction [lysophosphatidic acid results in increased expression of more ... CTD PMID:25822713 Cxcl16 Rat 1-octadec-9-enoylglycero-3-phosphate increases expression ISO RGD:1558593 6480464 lysophosphatidic acid results in increased expression of CXCL16 protein CTD PMID:25822713 Cxcl16 Rat 17beta-estradiol multiple interactions ISO RGD:1354459 6480464 [Estradiol co-treated with TGFB1 protein] results in decreased expression of CXCL16 mRNA CTD PMID:30165855 Cxcl16 Rat 17beta-estradiol increases expression ISO RGD:1354459 6480464 Estradiol results in increased expression of CXCL16 mRNA CTD PMID:31614463 Cxcl16 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1558593 6480464 Tetrachlorodibenzodioxin affects the expression of CXCL16 mRNA CTD PMID:21570461 Cxcl16 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of CXCL16 mRNA CTD PMID:33387578|PMID:34747641 Cxcl16 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1558593 6480464 Tetrachlorodibenzodioxin results in increased expression of CXCL16 mRNA CTD PMID:27562557|PMID:29673856 Cxcl16 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO RGD:1558593 6480464 [Zinc co-treated with Nickel co-treated with Cobalt co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with more ... CTD PMID:23503329 Cxcl16 Rat 4,4'-diaminodiphenylmethane increases expression EXP 6480464 4,4'-diaminodiphenylmethane results in increased expression of CXCL16 mRNA CTD PMID:25380136 Cxcl16 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:1558593 6480464 bisphenol S results in increased expression of CXCL16 mRNA CTD PMID:39298647 Cxcl16 Rat 4-(ethoxymethylene)-2-phenyloxazol-5-one decreases expression ISO RGD:1558593 6480464 Oxazolone results in decreased expression of CXCL16 mRNA CTD PMID:21404309 Cxcl16 Rat 4-hydroxyphenyl retinamide increases expression ISO RGD:1558593 6480464 Fenretinide results in increased expression of CXCL16 mRNA CTD PMID:28973697 Cxcl16 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of CXCL16 mRNA CTD PMID:30047161 Cxcl16 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of CXCL16 mRNA CTD PMID:31881176 Cxcl16 Rat acrolein decreases expression ISO RGD:1558593 6480464 Acrolein results in decreased expression of CXCL16 mRNA CTD PMID:18515264 Cxcl16 Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of CXCL16 mRNA CTD PMID:25378103 Cxcl16 Rat all-trans-retinoic acid increases expression ISO RGD:1354459 6480464 Tretinoin results in increased expression of CXCL16 mRNA CTD PMID:16142401|PMID:33167477 Cxcl16 Rat all-trans-retinoic acid increases secretion ISO RGD:1354459 6480464 Tretinoin results in increased secretion of CXCL16 protein CTD PMID:16142401 Cxcl16 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of CXCL16 mRNA CTD PMID:30047161 Cxcl16 Rat anthra[1,9-cd]pyrazol-6(2H)-one multiple interactions EXP 6480464 pyrazolanthrone inhibits the reaction [cypermethrin results in increased expression of CXCL16 protein] CTD PMID:35512476 Cxcl16 Rat antirheumatic drug decreases expression ISO RGD:1354459 6480464 Antirheumatic Agents results in decreased expression of CXCL16 mRNA CTD PMID:24449571 Cxcl16 Rat arsane affects expression ISO RGD:1354459 6480464 Arsenic affects the expression of CXCL16 protein CTD PMID:24675094 Cxcl16 Rat arsane multiple interactions ISO RGD:1354459 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Cxcl16 Rat arsenic atom affects expression ISO RGD:1354459 6480464 Arsenic affects the expression of CXCL16 protein CTD PMID:24675094 Cxcl16 Rat arsenic atom multiple interactions ISO RGD:1354459 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Cxcl16 Rat arsenous acid increases expression ISO RGD:1354459 6480464 Arsenic Trioxide results in increased expression of CXCL16 mRNA CTD PMID:25258189 Cxcl16 Rat benzene affects expression ISO RGD:1354459 6480464 Benzene affects the expression of CXCL16 mRNA CTD PMID:17119257 Cxcl16 Rat benzene increases expression ISO RGD:1354459 6480464 Benzene results in increased expression of CXCL16 mRNA CTD PMID:15929907|PMID:19162166 Cxcl16 Rat benzo[a]pyrene decreases expression ISO RGD:1558593 6480464 Benzo(a)pyrene results in decreased expression of CXCL16 mRNA CTD PMID:19770486 Cxcl16 Rat benzo[a]pyrene increases expression ISO RGD:1354459 6480464 Benzo(a)pyrene results in increased expression of CXCL16 mRNA CTD PMID:32234424 Cxcl16 Rat benzo[a]pyrene decreases methylation ISO RGD:1354459 6480464 Benzo(a)pyrene results in decreased methylation of CXCL16 promoter CTD PMID:27901495 Cxcl16 Rat benzo[a]pyrene increases expression ISO RGD:1558593 6480464 Benzo(a)pyrene results in increased expression of CXCL16 mRNA CTD PMID:22228805|PMID:23735875 Cxcl16 Rat benzo[b]fluoranthene increases expression ISO RGD:1558593 6480464 benzo(b)fluoranthene results in increased expression of CXCL16 mRNA CTD PMID:26377693 Cxcl16 Rat beta-lapachone increases expression ISO RGD:1354459 6480464 beta-lapachone results in increased expression of CXCL16 mRNA CTD PMID:38218311 Cxcl16 Rat beta-naphthoflavone multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of CXCL16 mRNA CTD PMID:18164116 Cxcl16 Rat bis(2-chloroethyl) sulfide increases expression ISO RGD:1354459 6480464 Mustard Gas results in increased expression of CXCL16 mRNA CTD PMID:25102026 Cxcl16 Rat bis(2-ethylhexyl) phthalate increases expression ISO RGD:1354459 6480464 Diethylhexyl Phthalate results in increased expression of CXCL16 mRNA CTD PMID:31163220 Cxcl16 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of CXCL16 mRNA CTD PMID:25181051 Cxcl16 Rat bisphenol A increases expression ISO RGD:1558593 6480464 bisphenol A results in increased expression of CXCL16 mRNA CTD PMID:34585602 Cxcl16 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of CXCL16 mRNA CTD PMID:30816183|PMID:32145629|PMID:32528016 Cxcl16 Rat butan-1-ol multiple interactions ISO RGD:1354459 6480464 [[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic more ... CTD PMID:29432896 Cxcl16 Rat caffeine increases phosphorylation ISO RGD:1354459 6480464 Caffeine results in increased phosphorylation of CXCL16 protein CTD PMID:35688186 Cxcl16 Rat cantharidin increases expression ISO RGD:1558593 6480464 Cantharidin results in increased expression of CXCL16 mRNA CTD PMID:36907384 Cxcl16 Rat carbon nanotube increases expression ISO RGD:1558593 6480464 Nanotubes, Carbon results in increased expression of CXCL16 mRNA CTD PMID:25554681 Cxcl16 Rat chenodeoxycholic acid increases expression ISO RGD:1558593 6480464 Chenodeoxycholic Acid results in increased expression of CXCL16 mRNA CTD PMID:21224055 Cxcl16 Rat choline multiple interactions ISO RGD:1558593 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ... CTD PMID:20938992 Cxcl16 Rat cisplatin multiple interactions ISO RGD:1558593 6480464 [Cisplatin co-treated with TNF protein] results in increased expression of CXCL16 mRNA CTD PMID:23103562 Cxcl16 Rat cobalt atom multiple interactions ISO RGD:1558593 6480464 [Zinc co-treated with Nickel co-treated with Cobalt co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with more ... CTD PMID:23503329 Cxcl16 Rat crocidolite asbestos increases expression ISO RGD:1558593 6480464 Asbestos, Crocidolite results in increased expression of CXCL16 mRNA CTD PMID:29507420 Cxcl16 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of CXCL16 mRNA CTD PMID:26577399|PMID:27523638 Cxcl16 Rat cyclosporin A increases expression ISO RGD:1354459 6480464 Cyclosporine results in increased expression of CXCL16 mRNA CTD PMID:20106945 Cxcl16 Rat cypermethrin increases expression EXP 6480464 cypermethrin results in increased expression of CXCL16 mRNA; cypermethrin results in increased expression of CXCL16 more ... CTD PMID:35512476 Cxcl16 Rat cypermethrin multiple interactions EXP 6480464 CXCL16 protein promotes the reaction [cypermethrin results in increased expression of IL18 mRNA]; CXCL16 protein more ... CTD PMID:35512476 Cxcl16 Rat DDE decreases expression ISO RGD:1354459 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of CXCL16 mRNA CTD PMID:38568856 Cxcl16 Rat dexamethasone multiple interactions ISO RGD:1558593 6480464 [Zinc co-treated with Nickel co-treated with Cobalt co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with more ... CTD PMID:23503329 Cxcl16 Rat diarsenic trioxide increases expression ISO RGD:1354459 6480464 Arsenic Trioxide results in increased expression of CXCL16 mRNA CTD PMID:25258189 Cxcl16 Rat Dibutyl phosphate affects expression ISO RGD:1354459 6480464 di-n-butylphosphoric acid affects the expression of CXCL16 mRNA CTD PMID:37042841 Cxcl16 Rat dibutyl phthalate increases expression ISO RGD:1558593 6480464 Dibutyl Phthalate results in increased expression of CXCL16 mRNA CTD PMID:21266533 Cxcl16 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of CXCL16 mRNA CTD PMID:21266533 Cxcl16 Rat dioxygen multiple interactions ISO RGD:1558593 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of CXCL16 mRNA CTD PMID:30529165 Cxcl16 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of CXCL16 mRNA CTD PMID:29391264 Cxcl16 Rat epoxiconazole decreases expression ISO RGD:1558593 6480464 epoxiconazole results in decreased expression of CXCL16 mRNA CTD PMID:35436446 Cxcl16 Rat ethanol multiple interactions ISO RGD:1558593 6480464 [Carbon Tetrachloride co-treated with Ethanol] results in increased expression of CXCL16 mRNA CTD PMID:30517762 Cxcl16 Rat fentanyl increases expression EXP 6480464 Fentanyl results in increased expression of CXCL16 mRNA CTD PMID:36032789 Cxcl16 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of CXCL16 mRNA CTD PMID:24793618 Cxcl16 Rat folic acid multiple interactions ISO RGD:1558593 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of CXCL16 mRNA; [Methionine deficiency co-treated more ... CTD PMID:20938992|PMID:22206623 Cxcl16 Rat furan increases expression EXP 6480464 furan results in increased expression of CXCL16 mRNA CTD PMID:26194646|PMID:27387713 Cxcl16 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of CXCL16 mRNA CTD PMID:33387578 Cxcl16 Rat glycine betaine decreases expression EXP 6480464 Betaine results in decreased expression of CXCL16 mRNA CTD PMID:26391144 Cxcl16 Rat L-methionine multiple interactions ISO RGD:1558593 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ... CTD PMID:20938992 Cxcl16 Rat lidocaine increases expression EXP 6480464 Lidocaine results in increased expression of CXCL16 mRNA CTD PMID:35283115 Cxcl16 Rat lipopolysaccharide multiple interactions ISO RGD:1558593 6480464 [Lipopolysaccharides co-treated with Monocrotaline] results in increased expression of CXCL16 protein; [Monocrotaline co-treated with Lipopolysaccharides] more ... CTD PMID:21279329|PMID:21327618 Cxcl16 Rat lipopolysaccharide increases expression ISO RGD:1558593 6480464 Lipopolysaccharides results in increased expression of CXCL16 mRNA CTD PMID:26582142 Cxcl16 Rat manganese atom multiple interactions ISO RGD:1354459 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Cxcl16 Rat manganese(0) multiple interactions ISO RGD:1354459 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Cxcl16 Rat manganese(II) chloride multiple interactions ISO RGD:1354459 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Cxcl16 Rat monocrotaline multiple interactions ISO RGD:1558593 6480464 [Lipopolysaccharides co-treated with Monocrotaline] results in increased expression of CXCL16 protein; [Monocrotaline co-treated with Lipopolysaccharides] more ... CTD PMID:21279329|PMID:21327618 Cxcl16 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of CXCL16 mRNA CTD PMID:18164116 Cxcl16 Rat N-nitrosodimethylamine increases expression EXP 6480464 Dimethylnitrosamine results in increased expression of CXCL16 mRNA CTD PMID:25380136 Cxcl16 Rat nickel atom multiple interactions ISO RGD:1558593 6480464 [Zinc co-treated with Nickel co-treated with Cobalt co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with more ... CTD PMID:23503329 Cxcl16 Rat nickel atom increases expression ISO RGD:1354459 6480464 Nickel results in increased expression of CXCL16 mRNA CTD PMID:25583101 Cxcl16 Rat nickel dichloride increases expression ISO RGD:1354459 6480464 nickel chloride results in increased expression of CXCL16 mRNA CTD PMID:26044615 Cxcl16 Rat nickel sulfate increases expression ISO RGD:1354459 6480464 nickel sulfate results in increased expression of CXCL16 mRNA CTD PMID:22714537 Cxcl16 Rat oxaliplatin increases expression EXP 6480464 oxaliplatin results in increased expression of CXCL16 mRNA CTD PMID:25729387 Cxcl16 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of CXCL16 mRNA CTD PMID:25729387 Cxcl16 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of CXCL16 mRNA CTD PMID:33387578 Cxcl16 Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of CXCL16 mRNA CTD PMID:32680482 Cxcl16 Rat perfluorononanoic acid increases expression ISO RGD:1354459 6480464 perfluoro-n-nonanoic acid results in increased expression of CXCL16 mRNA CTD PMID:32588087 Cxcl16 Rat phorbol 13-acetate 12-myristate decreases expression ISO RGD:1558593 6480464 Tetradecanoylphorbol Acetate results in decreased expression of CXCL16 mRNA CTD PMID:22359662 Cxcl16 Rat phorbol 13-acetate 12-myristate multiple interactions ISO RGD:1558593 6480464 IL17RA gene mutant form inhibits the reaction [Tetradecanoylphorbol Acetate results in decreased expression of CXCL16 more ... CTD PMID:22359662 Cxcl16 Rat pirinixic acid decreases expression ISO RGD:1558593 6480464 pirinixic acid results in decreased expression of CXCL16 mRNA CTD PMID:17426115 Cxcl16 Rat potassium chromate increases expression ISO RGD:1354459 6480464 potassium chromate(VI) results in increased expression of CXCL16 mRNA CTD PMID:22714537 Cxcl16 Rat propiconazole increases expression EXP 6480464 propiconazole results in increased expression of CXCL16 mRNA CTD PMID:30047161 Cxcl16 Rat quercetin increases expression ISO RGD:1354459 6480464 Quercetin results in increased expression of CXCL16 mRNA CTD PMID:21632981 Cxcl16 Rat silicon dioxide multiple interactions ISO RGD:1354459 6480464 CXCL16 mRNA promotes the reaction [Silicon Dioxide results in increased expression of and results in more ... CTD PMID:34653535 Cxcl16 Rat simvastatin decreases expression EXP 6480464 Simvastatin results in decreased expression of CXCL16 mRNA CTD PMID:25055962 Cxcl16 Rat sodium arsenite increases expression ISO RGD:1354459 6480464 sodium arsenite results in increased expression of CXCL16 mRNA CTD PMID:38568856 Cxcl16 Rat sodium arsenite multiple interactions ISO RGD:1354459 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Cxcl16 Rat Soman increases expression EXP 6480464 Soman results in increased expression of CXCL16 mRNA CTD PMID:19281266 Cxcl16 Rat succimer multiple interactions ISO RGD:1558593 6480464 [Succimer binds to Magnetite Nanoparticles] which results in decreased expression of CXCL16 mRNA; [Succimer co-treated more ... CTD PMID:21641980|PMID:26378955 Cxcl16 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of CXCL16 mRNA CTD PMID:30047161 Cxcl16 Rat sunitinib increases expression ISO RGD:1354459 6480464 Sunitinib results in increased expression of CXCL16 mRNA CTD PMID:31533062 Cxcl16 Rat taurocholic acid increases expression ISO RGD:1558593 6480464 Taurocholic Acid results in increased expression of CXCL16 mRNA CTD PMID:21224055 Cxcl16 Rat temozolomide increases expression ISO RGD:1354459 6480464 Temozolomide results in increased expression of CXCL16 mRNA CTD PMID:31758290 Cxcl16 Rat tetrachloromethane increases expression ISO RGD:1558593 6480464 Carbon Tetrachloride results in increased expression of CXCL16 mRNA CTD PMID:17484886 Cxcl16 Rat tetrachloromethane multiple interactions ISO RGD:1558593 6480464 [Carbon Tetrachloride co-treated with Ethanol] results in increased expression of CXCL16 mRNA CTD PMID:30517762 Cxcl16 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of CXCL16 mRNA CTD PMID:34492290 Cxcl16 Rat titanium dioxide increases expression ISO RGD:1558593 6480464 titanium dioxide results in increased expression of CXCL16 mRNA CTD PMID:23557971|PMID:27760801 Cxcl16 Rat titanium dioxide increases methylation ISO RGD:1558593 6480464 titanium dioxide results in increased methylation of CXCL16 promoter CTD PMID:35295148 Cxcl16 Rat toluene 2,4-diisocyanate increases expression ISO RGD:1558593 6480464 Toluene 2,4-Diisocyanate results in increased expression of CXCL16 mRNA CTD PMID:19647056 Cxcl16 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of CXCL16 mRNA CTD PMID:25729387 Cxcl16 Rat topotecan increases expression EXP 6480464 Topotecan results in increased expression of CXCL16 mRNA CTD PMID:25729387 Cxcl16 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of CXCL16 mRNA CTD PMID:33387578 Cxcl16 Rat triphenyl phosphate affects expression ISO RGD:1354459 6480464 triphenyl phosphate affects the expression of CXCL16 mRNA CTD PMID:37042841 Cxcl16 Rat valproic acid increases expression ISO RGD:1354459 6480464 Valproic Acid results in increased expression of CXCL16 mRNA CTD PMID:23179753|PMID:29154799 Cxcl16 Rat vancomycin decreases expression ISO RGD:1558593 6480464 Vancomycin results in decreased expression of CXCL16 mRNA CTD PMID:18930951 Cxcl16 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of CXCL16 mRNA CTD PMID:19015723 Cxcl16 Rat zinc atom multiple interactions ISO RGD:1558593 6480464 [Zinc co-treated with Nickel co-treated with Cobalt co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with more ... CTD PMID:23503329 Cxcl16 Rat zinc(0) multiple interactions ISO RGD:1558593 6480464 [Zinc co-treated with Nickel co-treated with Cobalt co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with more ... CTD PMID:23503329 Cxcl16 Rat zoledronic acid increases expression ISO RGD:1354459 6480464 zoledronic acid results in increased expression of CXCL16 mRNA CTD PMID:24714768
Imported Annotations - KEGG (archival)
1,1-dichloroethene (ISO) 1,2-dimethylhydrazine (ISO) 1-chloro-2,4-dinitrobenzene (ISO) 1-naphthyl isothiocyanate (EXP) 1-octadec-9-enoylglycero-3-phosphate (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (ISO) 4-(ethoxymethylene)-2-phenyloxazol-5-one (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) acrolein (ISO) aflatoxin B1 (EXP) all-trans-retinoic acid (ISO) amitrole (EXP) anthra[1,9-cd]pyrazol-6(2H)-one (EXP) antirheumatic drug (ISO) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) benzene (ISO) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) beta-lapachone (ISO) beta-naphthoflavone (EXP) bis(2-chloroethyl) sulfide (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) butan-1-ol (ISO) caffeine (ISO) cantharidin (ISO) carbon nanotube (ISO) chenodeoxycholic acid (ISO) choline (ISO) cisplatin (ISO) cobalt atom (ISO) crocidolite asbestos (ISO) Cuprizon (EXP) cyclosporin A (ISO) cypermethrin (EXP) DDE (ISO) dexamethasone (ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP,ISO) dioxygen (ISO) endosulfan (EXP) epoxiconazole (ISO) ethanol (ISO) fentanyl (EXP) flutamide (EXP) folic acid (ISO) furan (EXP) gentamycin (EXP) glycine betaine (EXP) L-methionine (ISO) lidocaine (EXP) lipopolysaccharide (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) monocrotaline (ISO) N-nitrosodiethylamine (EXP) N-nitrosodimethylamine (EXP) nickel atom (ISO) nickel dichloride (ISO) nickel sulfate (ISO) oxaliplatin (EXP) paracetamol (EXP) paraquat (EXP) perfluorononanoic acid (ISO) phorbol 13-acetate 12-myristate (ISO) pirinixic acid (ISO) potassium chromate (ISO) propiconazole (EXP) quercetin (ISO) silicon dioxide (ISO) simvastatin (EXP) sodium arsenite (ISO) Soman (EXP) succimer (ISO) sulfadimethoxine (EXP) sunitinib (ISO) taurocholic acid (ISO) temozolomide (ISO) tetrachloromethane (ISO) thioacetamide (EXP) titanium dioxide (ISO) toluene 2,4-diisocyanate (ISO) topotecan (EXP) trichloroethene (EXP) triphenyl phosphate (ISO) valproic acid (ISO) vancomycin (ISO) vinclozolin (EXP) zinc atom (ISO) zinc(0) (ISO) zoledronic acid (ISO)
1.
Imbalanced Host Response to SARS-CoV-2 Drives Development of COVID-19.
Blanco-Melo D, etal., Cell. 2020 May 28;181(5):1036-1045.e9. doi: 10.1016/j.cell.2020.04.026. Epub 2020 May 15.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Serum chemokine and cytokine levels as indicators of disease activity in patients with systemic sclerosis.
Hasegawa M, etal., Clin Rheumatol. 2011 Feb;30(2):231-7. Epub 2010 Nov 4.
4.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
5.
Dysregulated expression of MIG/CXCL9, IP-10/CXCL10 and CXCL16 and their receptors in systemic sclerosis.
Rabquer BJ, etal., Arthritis Res Ther. 2011 Feb 8;13(1):R18.
6.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
8.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
Cxcl16 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 55,665,355 - 55,669,950 (-) NCBI GRCr8 mRatBN7.2 10 55,166,721 - 55,171,316 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 55,166,723 - 55,171,592 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 59,845,644 - 59,850,516 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 59,334,153 - 59,339,026 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 54,833,353 - 54,838,107 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 57,060,005 - 57,064,600 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 57,060,007 - 57,064,600 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 56,817,242 - 56,821,837 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 57,296,126 - 57,300,721 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 10 54,313,016 - 54,317,611 (-) NCBI Celera Cytogenetic Map 10 q24 NCBI
CXCL16 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 4,733,533 - 4,739,928 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 4,733,533 - 4,739,928 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 4,636,828 - 4,643,223 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 4,583,577 - 4,589,972 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 17 4,583,583 - 4,589,863 NCBI Celera 17 4,652,030 - 4,658,426 (-) NCBI Celera Cytogenetic Map 17 p13.2 NCBI HuRef 17 4,525,914 - 4,531,582 (-) NCBI HuRef CHM1_1 17 4,645,559 - 4,651,953 (-) NCBI CHM1_1 T2T-CHM13v2.0 17 4,623,202 - 4,629,598 (-) NCBI T2T-CHM13v2.0
Cxcl16 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 70,345,215 - 70,350,810 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 70,344,809 - 70,350,810 (-) Ensembl GRCm39 Ensembl GRCm38 11 70,454,389 - 70,459,984 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 70,453,983 - 70,459,984 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 70,267,736 - 70,273,486 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 70,270,429 - 70,276,179 (-) NCBI MGSCv36 mm8 Celera 11 78,000,199 - 78,005,953 (-) NCBI Celera Cytogenetic Map 11 B3 NCBI cM Map 11 42.99 NCBI
Cxcl16 (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955467 10,132,461 - 10,136,649 (-) NCBI ChiLan1.0 ChiLan1.0
CXCL16 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 12,351,100 - 12,357,230 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 14,319,363 - 14,325,829 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 4,789,280 - 4,795,656 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 4,778,717 - 4,785,639 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 17 4,778,717 - 4,785,639 (-) Ensembl panpan1.1 panPan2
CXCL16 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 31,816,889 - 31,820,975 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 31,816,667 - 31,820,840 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 31,955,979 - 31,960,601 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 31,921,756 - 31,926,380 (+) NCBI ROS_Cfam_1.0 UMICH_Zoey_3.1 5 31,888,075 - 31,892,688 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 31,847,757 - 31,852,370 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 32,023,989 - 32,028,615 (+) NCBI UU_Cfam_GSD_1.0
Cxcl16 (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 52,738,369 - 52,743,825 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936677 3,157,144 - 3,163,210 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936677 3,157,173 - 3,162,599 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CXCL16 (Sus scrofa - pig)
CXCL16 (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 16 4,214,823 - 4,220,339 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 16 4,211,621 - 4,219,789 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666059 17,420,672 - 17,426,403 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Cxcl16 (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 266 Count of miRNA genes: 173 Interacting mature miRNAs: 198 Transcripts: ENSRNOT00000032926 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
61441 Btemp1 Thermal response to stress QTL 1 4 body temperature trait (VT:0005535) core body temperature (CMO:0001036) 10 35392457 63642539 Rat 1549846 Scl47 Serum cholesterol level QTL 47 3.6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 50574707 95574707 Rat 9589136 Insul27 Insulin level QTL 27 10.46 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 10 11474010 56474010 Rat 152025229 Scl83 Serum cholesterol level QTL 83 4.33 blood cholesterol amount (VT:0000180) 10 35710580 68663659 Rat 1578779 Tcas10 Tongue tumor susceptibility QTL 10 3.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 10 31297439 76297439 Rat 152025227 Bw195 Body weight QTL 195 5.73 body mass (VT:0001259) 10 46989699 68663659 Rat 631564 Apr3 Acute phase response QTL 3 3.9 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 10 15275955 60275955 Rat 1298069 Bp168 Blood pressure QTL 168 5.5 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 10 26521957 98003205 Rat 2293669 Bmd33 Bone mineral density QTL 33 4.5 0.0001 femur strength trait (VT:0010010) femoral neck polar moment of inertia (CMO:0001670) 10 49444551 81709989 Rat 152025224 Bw193 Body weight QTL 193 6.47 body mass (VT:0001259) 10 51663405 75085664 Rat 631552 Vetf2 Vascular elastic tissue fragility QTL 2 4.5 0.0002 aorta elastic tissue integrity trait (VT:0010556) artery internal elastic lamina non-tumorous lesion count (CMO:0001913) 10 41142633 86142633 Rat 631554 Bp133 Blood pressure QTL 133 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 743364 63851208 Rat 631557 Bp136 Blood pressure QTL 136 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 30632053 75632053 Rat 61325 Aia5 Adjuvant induced arthritis QTL 5 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1298078 Stresp5 Stress response QTL 5 2.99 0.00025 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 42045676 104670812 Rat 2293679 Bmd30 Bone mineral density QTL 30 3.5 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 10 49444551 81709989 Rat 1578762 Toxo1 Toxoplasma gondii resistance QTL 1 brain integrity trait (VT:0010579) percentage of study population displaying Toxoplasma gondii brain cysts at a point in time (CMO:0002028) 10 52200030 59378278 Rat 2298544 Neuinf9 Neuroinflammation QTL 9 4.6 nervous system integrity trait (VT:0010566) spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126) 10 5801990 62146030 Rat 70164 Bw21 Body weight QTL 21 4.36 0.00005 body mass (VT:0001259) body weight (CMO:0000012) 10 53797494 98952626 Rat 61463 Bp12 Blood pressure QTL 12 6.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 41333258 86333258 Rat 8694173 Bw149 Body weight QTL 149 4.38 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 10 44441699 89441699 Rat 2300218 Hpcl2 Hepatic cholesterol level QTL 2 liver cholesterol amount (VT:0010498) liver cholesterol level (CMO:0001597) 10 45029650 95600334 Rat 1554317 Bmd4 Bone mineral density QTL 4 9.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 19816042 99406971 Rat 70171 Cari1 Carrageenan-induced inflammation QTL 1 4.9 0.0005 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 10 53797385 107211142 Rat 1598852 Anxrr19 Anxiety related response QTL 19 5.07 body movement coordination trait (VT:0005424) number of rearing movements in an experimental apparatus (CMO:0001752) 10 18167841 63167841 Rat 1581497 Esta1 Estrogen-induced thymic atrophy QTL 1 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 10 21329805 61345413 Rat 724527 Bp148 Blood pressure QTL 148 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 28453136 73453136 Rat 1358897 Stresp6 Stress response QTL 6 4.17 0.022 blood norepinephrine amount (VT:0005663) plasma norepinephrine level (CMO:0001010) 10 35392267 64155584 Rat 1331762 Rf40 Renal function QTL 40 3.873 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 10 29299504 64155584 Rat 2300171 Bmd58 Bone mineral density QTL 58 4.9 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 26944628 71944628 Rat 61354 Pia10 Pristane induced arthritis QTL 10 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2301967 Cm73 Cardiac mass QTL 73 4.55 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 10 14487011 89062041 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 70188 BpQTLcluster1 Blood pressure QTL cluster 1 4.864 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 42323132 87323132 Rat 9590310 Scort19 Serum corticosterone level QTL 19 6.3 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 9589030 Epfw9 Epididymal fat weight QTL 9 19.24 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 10 44441699 89441699 Rat 10402859 Bp381 Blood pressure QTL 381 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 2293652 Bmd22 Bone mineral density QTL 22 4.9 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 10 49444551 81709989 Rat 70198 BpQTLcluster9 Blood pressure QTL cluster 9 2.94 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 42323132 87323132 Rat 1359017 Hrtrt21 Heart rate QTL 21 2.4 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 10 51772940 96772940 Rat 2306787 Ean3 Experimental allergic neuritis QTL 3 3.1 nervous system integrity trait (VT:0010566) body weight loss (CMO:0001399) 10 53797385 66979128 Rat 6893352 Bw100 Body weight QTL 100 0.33 0.6 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 724556 Pur2 Proteinuria QTL 2 5.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 22427500 90627625 Rat 8662860 Vetf10 Vascular elastic tissue fragility QTL 10 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 10 6154182 73453136 Rat 61387 Bp1 Blood pressure QTL 1 5.1 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 51770177 107211142 Rat 1354585 Eae18a Experimental allergic encephalomyelitis QTL 18a 7.5 0.0004 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis severity score (CMO:0001419) 10 53797385 58445852 Rat 70223 Bp57 Blood pressure QTL 57 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 1 80676123 Rat 1354587 Kidm21 Kidney mass QTL 21 3.3 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 10 15028513 60430477 Rat 6893350 Bw99 Body weight QTL 99 0.87 0.16 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 2317043 Aia7 Adjuvant induced arthritis QTL 7 3.82 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 37565079 82565079 Rat 70224 Eae3 Experimental allergic encephalomyelitis QTL 3 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 10 26521957 61345413 Rat 2317042 Aia20 Adjuvant induced arthritis QTL 20 3.38 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 37565079 82565079 Rat 1331791 Cm31 Cardiac mass QTL 31 3.84606 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 29299504 107211142 Rat 2313087 Bmd80 Bone mineral density QTL 80 3.2 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 10 19606483 64606483 Rat 70364 Bp72 Blood pressure QTL 72 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 51121100 96121100 Rat 631530 Tls3 T-lymphoma susceptibility QTL 3 0 0.0001 thymus integrity trait (VT:0010555) percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911) 10 51774612 95600334 Rat 1354608 Cm33 Cardiac mass QTL 33 2.8 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 10 54809292 99809292 Rat 631535 Cm51 Cardiac mass QTL 51 3 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 10 51786282 91669536 Rat 1576319 Cia29 Collagen induced arthritis QTL 29 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 33973921 78973921 Rat 8552805 Bw145 Body weight QTL 145 2.2 body mass (VT:0001259) change in body weight to body weight ratio (CMO:0002216) 10 41944526 78307017 Rat 631267 Cia20 Collagen induced arthritis QTL 20 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2293705 Bmd25 Bone mineral density QTL 25 7.1 0.0001 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 10 49444551 81709989 Rat 1576308 Schws1 Schwannoma susceptibility QTL 1 0.0041 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 10 40035094 102359817 Rat 631269 Cia22 Collagen induced arthritis QTL 22 8.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 631268 Cia21 Collagen induced arthritis QTL 21 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 14487011 104060283 Rat 9590268 Scort13 Serum corticosterone level QTL 13 3.26 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 7207811 Bmd90 Bone mineral density QTL 90 5.2 femur size trait (VT:1000369) femoral neck cross-sectional area (CMO:0001697) 10 49444551 81709989 Rat 1576311 Pia26 Pristane induced arthritis QTL 26 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 31224026 75632053 Rat 631270 Cia23 Collagen induced arthritis QTL 23 3.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 7411614 Foco18 Food consumption QTL 18 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 10 44441699 89441699 Rat 631547 Bp87 Blood pressure QTL 87 4.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 47369470 92369470 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 6893342 Cm78 Cardiac mass QTL 78 0.1 0.88 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 10 42876766 79813922 Rat 2292441 Bp308 Blood pressure QTL 308 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2313055 Bw96 Body weight QTL 96 3.6 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 10 19606483 64606483 Rat 631542 Bp82 Blood pressure QTL 82 6.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 26521957 98952741 Rat
RH129630
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 55,166,724 - 55,166,927 (+) MAPPER mRatBN7.2 Rnor_6.0 10 57,060,009 - 57,060,211 NCBI Rnor6.0 Rnor_5.0 10 56,817,246 - 56,817,448 UniSTS Rnor5.0 RGSC_v3.4 10 57,296,130 - 57,296,332 UniSTS RGSC3.4 Celera 10 54,313,020 - 54,313,222 UniSTS RH 3.4 Map 5 451.1 UniSTS Cytogenetic Map 10 q24 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000032926 ⟹ ENSRNOP00000037160
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 55,166,723 - 55,171,316 (-) Ensembl Rnor_6.0 Ensembl 10 57,060,007 - 57,064,600 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000118669 ⟹ ENSRNOP00000084149
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 55,166,844 - 55,171,592 (-) Ensembl
RefSeq Acc Id:
NM_001017478 ⟹ NP_001017478
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 55,665,355 - 55,669,950 (-) NCBI mRatBN7.2 10 55,166,721 - 55,171,316 (-) NCBI Rnor_6.0 10 57,060,005 - 57,064,600 (-) NCBI Rnor_5.0 10 56,817,242 - 56,821,837 (-) NCBI RGSC_v3.4 10 57,296,126 - 57,300,721 (-) RGD Celera 10 54,313,016 - 54,317,611 (-) RGD
Sequence:
CCAGGAGTCTCGAGTCGGAAGGAGCTCCGCCTTCCGGGGCAGGGATGTGTGTGTCCCCCGACTGGGAGCTGGGCGCAGCGCGGGCTCCCCGGTACTGACCAGACGGTCGGTTCAGGACAGCGCGCGGG GGACAGAAGGCGCCACCACCTCGCGCCCCCTCCCTTCCTGAGCTTGGCACAGATCAGCGCCTCCGCAAAGCATCAGCCAGGGTGAAGTGAAAGCAATAGAGAATCTGCTGGATGTCGGCTAGGTGACC TGGCCTCAACAAGCTCCGCAGCGGCCTGAGATGAGGCGGGGCTTTGGACCCTTGGCCCTTACACTCTTCCTTTTCTTCTTTGCGCTGCTGACTCTGCCAGGCGATGGCAACCAGGGCAGTGTCGCTGG AAGTTGCTACTGTGATCGTACAATTCCTTCTGGCACCCAGATACCGCCTGCTACTTTGAATCATATGCGAAAATATCTGAAAACGTTCCATCGCTGTCAATTCTTTATCAGGTTCCAGTTGCAGTCCA AGAGTGTGTGTGGAGGAAGCCAAGACCAGTGGGTCCGTGAACTAGTGAACTGCTTTGAGCACAAACAATGTGGAATCGGTCATGGGCAGAGTTTTCACCACCAAAAACATGTGCCTCAAGCCAGTACC CGGATCCCTGAGGCCACAGAAGGGAAACCTCCAGACACAAGCACGGCTGTACAGTTTCAGAGCACCCAGCAGTCCACTTTTCCATCTGGAGCACCATCCTTGAACAAAGAGCTCACCCGCCACTGGGA AACAACCATTCTCCCTTCAGGCTATGGTCTGGAGGCTAGGCCTGTGGCTGAGGCAAATGAGAAACAGCACAAACAGCAAAAAGAACCAGGAGCTGGTGCTGGCACACAAGCCTTGGTGCCGGTGCTAT CCCTCCTGGCCATCGTCTTCTTCCTCGTGGCAGCCATGGTCTGTGTGCTGTGCAACAGGAGAGTGACTCGGCAGAGCTCTTCAGGTTTGCAGCTCTGTTATACACCTGTTGAACCAAGACCCCAGGGC CTGTAGCAAGAATGGAAGCTCGTGAGAGATGATGTGGGAGAGGTGGCAGACAGACTGGCAGGCTAGGCTCCATCAACGAACTGAATCTGAGCTCATTTTTTCTGGTGATGTTTTGAATCAAAGTAGCC ATTATGTAATCTAGGACAGCTTTGAACTACAGAGCCTGTGCCCCGACCTCCTAGATTCTGGGATTATAGATATATCCTACTGCATCTGCCCTCGTCTACTTTCATAAATAAGGTATAAATTTTCAGGT TTTTGTTTTGTTTAGCGAAGATCTTATTTAGCCCAAGCCAACCTCAAATTCCCTATGTATCTCTAGGTCCCCTGCCTCCTTACACACTCACTAAACGCTTTTCTTTTTGGTTTGTTTGAGACAGGGTT TCACTATTCAGCCTTGACAGTCCTAGAACTCAGAAAGGTCTGCCTTTCTGCAGTGTTGGGATTAAAGGACTGCCCTTGGGAAACCCTCTTTACAACTAATAACATCTGCATAGCCCCTCTGCCCTAGC CTTTCCCCTGCCTCTAATAAAATGTAATACTCTCAAGTATGTGGTCCAAAAGTGCAGTCAGAGGTGGAGTGTAAAGTTCGAGGTTCAACCTGCCCATTAACAGATTAATTTTAAAAAGTGTCTGCTTT TTACATTGTGTAACAATAAACTGGACAAATTCTATGTTTTTAAAAAAAAAAAAAAAAAAAAAAAAA
hide sequence
RefSeq Acc Id:
NP_001017478 ⟸ NM_001017478
- Peptide Label:
precursor
- UniProtKB:
Q6AXU5 (UniProtKB/Swiss-Prot), A0A6M4C4P9 (UniProtKB/TrEMBL), A0A6M4C4V5 (UniProtKB/TrEMBL)
- Sequence:
MRRGFGPLALTLFLFFFALLTLPGDGNQGSVAGSCYCDRTIPSGTQIPPATLNHMRKYLKTFHRCQFFIRFQLQSKSVCGGSQDQWVRELVNCFEHKQCGIGHGQSFHHQKHVPQASTRIPEATEGKP PDTSTAVQFQSTQQSTFPSGAPSLNKELTRHWETTILPSGYGLEARPVAEANEKQHKQQKEPGAGAGTQALVPVLSLLAIVFFLVAAMVCVLCNRRVTRQSSSGLQLCYTPVEPRPQGL
hide sequence
Ensembl Acc Id:
ENSRNOP00000037160 ⟸ ENSRNOT00000032926
Ensembl Acc Id:
ENSRNOP00000084149 ⟸ ENSRNOT00000118669
RGD ID: 13697359
Promoter ID: EPDNEW_R7883
Type: initiation region
Name: Cxcl16_1
Description: C-X-C motif chemokine ligand 16
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 10 57,064,560 - 57,064,620 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-03-08
Cxcl16
C-X-C motif chemokine ligand 16
Cxcl16
chemokine (C-X-C motif) ligand 16
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2008-03-03
Cxcl16
chemokine (C-X-C motif) ligand 16
Cxcl16
similar to chemokine (C-X-C motif) ligand 16
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2006-02-09
Cxcl16
similar to chemokine (C-X-C motif) ligand 16
Symbol and Name status set to provisional
70820
PROVISIONAL