Advanced Search (OLGA)

Gene: Sting1 (stimulator of interferon response cGAMP interactor 1) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Sting1

Name:

stimulator of interferon response cGAMP interactor 1

RGD ID:

1562552

Description:

Enables 2',3'-cyclic GMP-AMP binding activity. Involved in positive regulation of type I interferon production. Predicted to be located in several cellular components, including ciliary basal body; mitochondrial outer membrane; and perinuclear region of cytoplasm. Predicted to be part of STING complex. Predicted to be active in autophagosome; bounding membrane of organelle; and endoplasmic reticulum membrane. Human ortholog(s) of this gene implicated in STING-associated vasculopathy with onset in infancy. Orthologous to human STING1 (stimulator of interferon response cGAMP interactor 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; acetamide; benzo[a]pyrene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

hypothetical protein LOC498840; LOC498840; mitochondrial transmembrane protein 173; RGD1562552; rSTING; similar to hypothetical protein LOC340061; Tmem173; transmembrane protein 173; uncharacterized protein LOC498840

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	18	27,606,196 - 27,612,544 (-)	NCBI		GRCr8
mRatBN7.2	18	27,332,119 - 27,338,371 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	27,332,119 - 27,338,335 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	18	27,459,541 - 27,465,793 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	28,221,584 - 28,227,830 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	27,556,463 - 27,562,709 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	28,529,537 - 28,535,828 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	28,529,576 - 28,535,828 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	18	28,242,119 - 28,248,371 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	18	28,355,029 - 28,357,171 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	18	27,065,352 - 27,071,596 (-)	NCBI		Celera
Cytogenetic Map	18	p11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Sting1	Rat	Animal Toxoplasmosis	severity	ISO	RGD:1615847	39128220		RGD
Sting1	Rat	brucellosis		ISO	RGD:1615847	39128234		RGD
Sting1	Rat	brucellosis		ISO	RGD:1615847	39128199		RGD
Sting1	Rat	Chronic Hepatitis B	susceptibility	ISO	RGD:1602274	39128221	DNA:hypermethylation:promoter	RGD
Sting1	Rat	chronic obstructive pulmonary disease		ISO	RGD:1615847	39128228	associated with Haemophilus Infections;mRNA, protein:increased expression:lung (mouse)	RGD
Sting1	Rat	Cytomegalovirus Infections		ISO	RGD:1615847	39128225		RGD
Sting1	Rat	Haemophilus Infections		ISO	RGD:1615847	39128228	mRNA,protein:increased expression:lung (mouse)	RGD
Sting1	Rat	hepatitis B		ISO	RGD:1615847	39128205		RGD
Sting1	Rat	human immunodeficiency virus infectious disease		ISO	RGD:1602274	39128218	mRNA:increased expression:multiple tissues (human)	RGD
Sting1	Rat	listeriosis		ISO	RGD:1615847	39128219		RGD
Sting1	Rat	listeriosis		ISO	RGD:1615847	39128233		RGD
Sting1	Rat	lymphadenitis	disease_progression	ISO	RGD:1615847	39128217	associated with herpes simplex	RGD
Sting1	Rat	Pneumococcal Pneumonia		ISO	RGD:1615847	39128230		RGD
Sting1	Rat	schistosomiasis		ISO	RGD:1615847	39128195		RGD
Sting1	Rat	Silicotuberculosis	severity	ISO	RGD:1615847	39128194		RGD
Sting1	Rat	tuberculosis		ISO	RGD:1615847	39128196		RGD
Sting1	Rat	West Nile encephalitis	severity	ISO	RGD:1615847	39128224		RGD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Sting1	Rat	autosomal dominant intellectual developmental disorder 31		ISO	RGD:1602274	8554872	ClinVar Annotator: match by term: NEURODEVELOPMENTAL DISORDER WITH NEONATAL RESPIRATORY INSUFFICIENCY, HYPOTONIA, AND FEEDING DIFFICULTIES	ClinVar	PMID:28492532
Sting1	Rat	Chediak-Higashi syndrome		ISO	RGD:1602274	8554872	ClinVar Annotator: match by term: Autoinflammatory syndrome	ClinVar	PMID:25741868\|PMID:28166811\|PMID:28492532
Sting1	Rat	Chediak-Higashi syndrome		ISO	RGD:1602274	8554872	ClinVar Annotator: match by term: Autoinflammatory syndrome \| ClinVar Annotator: match by term: Chédiak-Higashi syndrome	ClinVar	PMID:17576681\|PMID:25741868\|PMID:28087229\|PMID:28492532\|PMID:30919572\|PMID:32673614\|PMID:33488593\|PMID:35086391\|PMID:35482138\|PMID:36275728\|PMID:9536098
Sting1	Rat	familial adenomatous polyposis 1		ISO	RGD:1602274	8554872	ClinVar Annotator: match by term: Familial adenomatous polyposis 1	ClinVar	PMID:17963004\|PMID:18487285\|PMID:19279422\|PMID:19409520\|PMID:20685668\|PMID:21643010\|PMID:28492532
Sting1	Rat	genetic disease		ISO	RGD:1602274	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar	PMID:25741868\|PMID:28492532\|PMID:29367762\|PMID:35086391\|PMID:35482138
Sting1	Rat	Hereditary Neoplastic Syndromes		ISO	RGD:1602274	8554872	ClinVar Annotator: match by term: Hereditary cancer-predisposing syndrome	ClinVar	PMID:17963004\|PMID:18487285\|PMID:19279422\|PMID:19409520\|PMID:20685668\|PMID:21643010\|PMID:28492532
Sting1	Rat	Neurodevelopmental Disorders		ISO	RGD:1602274	8554872	ClinVar Annotator: match by term: Neurodevelopmental disorder	ClinVar	PMID:25741868
Sting1	Rat	STING-associated vasculopathy with onset in infancy		ISO	RGD:1602274	8554872	ClinVar Annotator: match by term: STING-associated vasculopathy with onset in infancy \| ClinVar Annotator: match more ...	ClinVar	PMID:16199547\|PMID:17576681\|PMID:24033266\|PMID:25029335\|PMID:25401470\|PMID:25741868\|PMID:25790474\|PMID:26235147\|PMID:27613991\|PMID:27943079\|PMID:28041677\|PMID:28087229\|PMID:28484079\|PMID:28492532\|PMID:28968819\|PMID:29367762\|PMID:29694889\|PMID:30038614\|PMID:30463976\|PMID:30794020\|PMID:30919572\|PMID:31705453\|PMID:31866997\|PMID:32673614\|PMID:33014937\|PMID:33217613\|PMID:33230617\|PMID:33488593\|PMID:35086391\|PMID:35482138\|PMID:36275728\|PMID:9536098

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Sting1	Rat	Chemical and Drug Induced Liver Injury		ISO	RGD:1602274	11554173	CTD Direct Evidence: therapeutic	CTD	PMID:36520315
Sting1	Rat	Chilblain Lupus 1		ISO	RGD:1602274	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:27566796
Sting1	Rat	esophagus squamous cell carcinoma		ISO	RGD:1602274	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:25129146

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Sting1	Rat	STING-associated vasculopathy with onset in infancy		ISS	RGD:1615847	13592920	OMIM:615934	MouseDO

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Sting1	Rat	STING-associated vasculopathy with onset in infancy		ISO	RGD:1602274	7240710		OMIM

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Sting1	Rat	(-)-demecolcine	increases expression	ISO	RGD:1602274	6480464	Demecolcine results in increased expression of STING1 mRNA	CTD	PMID:23649840
Sting1	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of STING1 mRNA	CTD	PMID:34747641
Sting1	Rat	3-isobutyl-1-methyl-7H-xanthine	multiple interactions	ISO	RGD:1602274	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in decreased expression more ...	CTD	PMID:28628672
Sting1	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	RGD:1615847	6480464	bisphenol S results in increased expression of STING1 mRNA	CTD	PMID:30951980
Sting1	Rat	4-hydroxyphenyl retinamide	increases expression	ISO	RGD:1615847	6480464	Fenretinide results in increased expression of STING1 mRNA	CTD	PMID:28973697
Sting1	Rat	acetamide	increases expression	EXP		6480464	acetamide results in increased expression of STING1 mRNA	CTD	PMID:31881176
Sting1	Rat	aflatoxin B1	affects expression	ISO	RGD:1602274	6480464	Aflatoxin B1 affects the expression of STING1 protein	CTD	PMID:20106945
Sting1	Rat	aflatoxin B1	decreases methylation	ISO	RGD:1602274	6480464	Aflatoxin B1 results in decreased methylation of STING1 3' UTR	CTD	PMID:30157460
Sting1	Rat	aflatoxin B1	increases expression	ISO	RGD:1602274	6480464	Aflatoxin B1 results in increased expression of STING1 mRNA	CTD	PMID:21641981
Sting1	Rat	antirheumatic drug	decreases expression	ISO	RGD:1602274	6480464	Antirheumatic Agents results in decreased expression of STING1 mRNA	CTD	PMID:24449571
Sting1	Rat	arsane	affects methylation	ISO	RGD:1602274	6480464	Arsenic affects the methylation of STING1 gene	CTD	PMID:25304211
Sting1	Rat	arsane	multiple interactions	ISO	RGD:1602274	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
Sting1	Rat	arsenic atom	affects methylation	ISO	RGD:1602274	6480464	Arsenic affects the methylation of STING1 gene	CTD	PMID:25304211
Sting1	Rat	arsenic atom	multiple interactions	ISO	RGD:1602274	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
Sting1	Rat	arsenite(3-)	increases methylation	ISO	RGD:1602274	6480464	arsenite results in increased methylation of STING1 promoter	CTD	PMID:23974009
Sting1	Rat	aucubin	multiple interactions	ISO	RGD:1615847	6480464	aucubin affects the reaction [[LDLR protein affects the susceptibility to Dietary Fats] which affects the more ...	CTD	PMID:36108984
Sting1	Rat	benzo[a]pyrene	increases expression	EXP		6480464	Benzo(a)pyrene results in increased expression of STING1 mRNA	CTD	PMID:21839799
Sting1	Rat	benzo[a]pyrene	decreases expression	ISO	RGD:1615847	6480464	Benzo(a)pyrene results in decreased expression of STING1 mRNA	CTD	PMID:21569818
Sting1	Rat	benzo[a]pyrene	increases expression	ISO	RGD:1602274	6480464	Benzo(a)pyrene results in increased expression of STING1 mRNA	CTD	PMID:21871943\|PMID:26238291\|PMID:32234424
Sting1	Rat	bis(2-ethylhexyl) phthalate	multiple interactions	ISO	RGD:1615847	6480464	Lycopene inhibits the reaction [Diethylhexyl Phthalate results in increased expression of STING1 mRNA]; Lycopene inhibits more ...	CTD	PMID:36583613
Sting1	Rat	bis(2-ethylhexyl) phthalate	increases expression	ISO	RGD:1615847	6480464	Diethylhexyl Phthalate results in increased expression of STING1 mRNA; Diethylhexyl Phthalate results in increased expression more ...	CTD	PMID:36583613
Sting1	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of STING1 mRNA	CTD	PMID:25181051
Sting1	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of STING1 mRNA	CTD	PMID:30816183
Sting1	Rat	cadmium dichloride	increases expression	ISO	RGD:1602274	6480464	Cadmium Chloride results in increased expression of STING1 mRNA	CTD	PMID:26472689
Sting1	Rat	carbon nanotube	increases expression	ISO	RGD:1615847	6480464	Nanotubes, Carbon analog results in increased expression of STING1 mRNA; Nanotubes, Carbon results in increased more ...	CTD	PMID:25554681\|PMID:25620056
Sting1	Rat	chloroprene	decreases expression	ISO	RGD:1615847	6480464	Chloroprene results in decreased expression of STING1 mRNA	CTD	PMID:23125180
Sting1	Rat	cisplatin	increases expression	ISO	RGD:1615847	6480464	Cisplatin results in increased expression of STING1 mRNA	CTD	PMID:21151649
Sting1	Rat	Cuprizon	increases expression	EXP		6480464	Cuprizone results in increased expression of STING1 mRNA	CTD	PMID:27523638
Sting1	Rat	cyfluthrin	increases expression	ISO	RGD:1615847	6480464	cyfluthrin results in increased expression of STING1 mRNA; cyfluthrin results in increased expression of STING1 more ...	CTD	PMID:36515635
Sting1	Rat	cyfluthrin	increases expression	EXP		6480464	cyfluthrin results in increased expression of STING1 mRNA; cyfluthrin results in increased expression of STING1 more ...	CTD	PMID:36515635
Sting1	Rat	dexamethasone	multiple interactions	ISO	RGD:1602274	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in decreased expression more ...	CTD	PMID:28628672
Sting1	Rat	dexamethasone	multiple interactions	ISO	RGD:1615847	6480464	Dexamethasone inhibits the reaction [Paraquat results in increased expression of STING1 mRNA]; Dexamethasone inhibits the more ...	CTD	PMID:34455893
Sting1	Rat	dibutyl phthalate	increases expression	EXP		6480464	Dibutyl Phthalate results in increased expression of STING1 mRNA	CTD	PMID:21266533
Sting1	Rat	dibutyl phthalate	increases expression	ISO	RGD:1615847	6480464	Dibutyl Phthalate results in increased expression of STING1 mRNA	CTD	PMID:21266533
Sting1	Rat	dioxygen	multiple interactions	ISO	RGD:1615847	6480464	[NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of STING1 mRNA	CTD	PMID:30529165
Sting1	Rat	doxorubicin	decreases expression	ISO	RGD:1602274	6480464	Doxorubicin results in decreased expression of STING1 mRNA	CTD	PMID:29803840
Sting1	Rat	endosulfan	increases expression	EXP		6480464	Endosulfan results in increased expression of STING1 mRNA	CTD	PMID:29391264
Sting1	Rat	ethidium	multiple interactions	ISO	RGD:1615847	6480464	Ethidium inhibits the reaction [cyanoginosin LR results in increased expression of STING1 protein]	CTD	PMID:35032610
Sting1	Rat	ethyl methanesulfonate	increases expression	ISO	RGD:1602274	6480464	Ethyl Methanesulfonate results in increased expression of STING1 mRNA	CTD	PMID:23649840
Sting1	Rat	fonofos	decreases methylation	ISO	RGD:1602274	6480464	Fonofos results in decreased methylation of STING1 promoter	CTD	PMID:22847954
Sting1	Rat	formaldehyde	increases expression	ISO	RGD:1602274	6480464	Formaldehyde results in increased expression of STING1 mRNA	CTD	PMID:23649840
Sting1	Rat	genistein	decreases expression	ISO	RGD:1615847	6480464	Genistein results in decreased expression of STING1 mRNA	CTD	PMID:32186404
Sting1	Rat	hexadecanoic acid	multiple interactions	EXP		6480464	STING1 protein promotes the reaction [Palmitic Acid results in increased expression of and results in more ...	CTD	PMID:35235096
Sting1	Rat	hexadecanoic acid	increases expression	EXP		6480464	Palmitic Acid results in increased expression of STING1 mRNA; Palmitic Acid results in increased expression more ...	CTD	PMID:35235096
Sting1	Rat	indometacin	multiple interactions	ISO	RGD:1602274	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in decreased expression more ...	CTD	PMID:28628672
Sting1	Rat	lipopolysaccharide	increases expression	ISO	RGD:1615847	39128228	lipopolysaccharide increases expression of Sting1 mRNA and protein in lungs	RGD
Sting1	Rat	lipopolysaccharide	multiple interactions	ISO	RGD:1602274	6480464	[S-(1,2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in decreased expression of STING1 mRNA	CTD	PMID:35811015
Sting1	Rat	lycopene	multiple interactions	ISO	RGD:1615847	6480464	Lycopene inhibits the reaction [Diethylhexyl Phthalate results in increased expression of STING1 mRNA]; Lycopene inhibits more ...	CTD	PMID:36583613
Sting1	Rat	manganese atom	multiple interactions	ISO	RGD:1602274	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
Sting1	Rat	manganese(0)	multiple interactions	ISO	RGD:1602274	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
Sting1	Rat	manganese(II) chloride	multiple interactions	ISO	RGD:1602274	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
Sting1	Rat	methyl methanesulfonate	increases expression	ISO	RGD:1602274	6480464	Methyl Methanesulfonate results in increased expression of STING1 mRNA	CTD	PMID:23649840
Sting1	Rat	microcystin-LR	increases expression	ISO	RGD:1602274	6480464	cyanoginosin LR results in increased expression of STING1 protein	CTD	PMID:36435412
Sting1	Rat	microcystin-LR	increases expression	ISO	RGD:1615847	6480464	cyanoginosin LR results in increased expression of STING1 mRNA; cyanoginosin LR results in increased expression more ...	CTD	PMID:35032610
Sting1	Rat	microcystin-LR	multiple interactions	ISO	RGD:1615847	6480464	Ethidium inhibits the reaction [cyanoginosin LR results in increased expression of STING1 protein]	CTD	PMID:35032610
Sting1	Rat	nickel atom	increases expression	ISO	RGD:1602274	6480464	Nickel results in increased expression of STING1 mRNA	CTD	PMID:24768652\|PMID:25583101
Sting1	Rat	nitrates	multiple interactions	ISO	RGD:1615847	6480464	[Particulate Matter results in increased abundance of Nitrates] which results in increased expression of STING1 more ...	CTD	PMID:35964746
Sting1	Rat	ozone	multiple interactions	ISO	RGD:1615847	6480464	[NOTCH3 gene mutant form affects the susceptibility to Ozone] which results in increased expression of more ...	CTD	PMID:25658374
Sting1	Rat	paracetamol	multiple interactions	ISO	RGD:1615847	6480464	[vadimezan affects the reaction [P2RX1 protein affects the susceptibility to Acetaminophen]] which affects the phosphorylation more ...	CTD	PMID:37046119
Sting1	Rat	paracetamol	affects expression	ISO	RGD:1615847	6480464	Acetaminophen affects the expression of STING1 mRNA	CTD	PMID:17562736
Sting1	Rat	paracetamol	decreases expression	ISO	RGD:1602274	6480464	Acetaminophen results in decreased expression of STING1 mRNA	CTD	PMID:29067470
Sting1	Rat	paraquat	increases expression	ISO	RGD:1615847	6480464	Paraquat results in increased expression of STING1 mRNA; Paraquat results in increased expression of STING1 more ...	CTD	PMID:34455893
Sting1	Rat	paraquat	multiple interactions	ISO	RGD:1615847	6480464	Dexamethasone inhibits the reaction [Paraquat results in increased expression of STING1 mRNA]; Dexamethasone inhibits the more ...	CTD	PMID:34455893
Sting1	Rat	paraquat	affects localization	ISO	RGD:1615847	6480464	Paraquat affects the localization of STING1 protein	CTD	PMID:34455893
Sting1	Rat	parathion	decreases methylation	ISO	RGD:1602274	6480464	Parathion results in decreased methylation of STING1 promoter	CTD	PMID:22847954
Sting1	Rat	perfluorohexanesulfonic acid	increases expression	ISO	RGD:1615847	6480464	perfluorohexanesulfonic acid results in increased expression of STING1 mRNA	CTD	PMID:37995155
Sting1	Rat	Phytolaccoside E	increases expression	ISO	RGD:1615847	6480464	esculentoside A results in increased expression of STING1 protein	CTD	PMID:36460195
Sting1	Rat	Phytolaccoside E	increases expression	ISO	RGD:1602274	6480464	esculentoside A results in increased expression of STING1 protein	CTD	PMID:36460195
Sting1	Rat	S-(1,2-dichlorovinyl)-L-cysteine	multiple interactions	ISO	RGD:1602274	6480464	[S-(1,2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in decreased expression of STING1 mRNA	CTD	PMID:35811015
Sting1	Rat	silicon dioxide	decreases expression	ISO	RGD:1602274	6480464	Silicon Dioxide analog results in decreased expression of STING1 mRNA	CTD	PMID:25895662
Sting1	Rat	silver atom	increases expression	ISO	RGD:1615847	6480464	Silver results in increased expression of STING1 mRNA	CTD	PMID:27131904
Sting1	Rat	silver(0)	increases expression	ISO	RGD:1615847	6480464	Silver results in increased expression of STING1 mRNA	CTD	PMID:27131904
Sting1	Rat	sodium arsenite	increases expression	ISO	RGD:1602274	6480464	sodium arsenite results in increased expression of STING1 mRNA	CTD	PMID:29301061
Sting1	Rat	sodium arsenite	multiple interactions	ISO	RGD:1602274	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
Sting1	Rat	sodium arsenite	decreases expression	ISO	RGD:1602274	6480464	sodium arsenite results in decreased expression of STING1 mRNA	CTD	PMID:38568856
Sting1	Rat	sodium fluoride	decreases expression	ISO	RGD:1615847	6480464	Sodium Fluoride results in decreased expression of STING1 protein	CTD	PMID:28918527
Sting1	Rat	sunitinib	decreases expression	ISO	RGD:1602274	6480464	Sunitinib results in decreased expression of STING1 mRNA	CTD	PMID:31533062
Sting1	Rat	temozolomide	increases expression	ISO	RGD:1602274	6480464	Temozolomide results in increased expression of STING1 mRNA	CTD	PMID:31758290
Sting1	Rat	terbufos	decreases methylation	ISO	RGD:1602274	6480464	terbufos results in decreased methylation of STING1 promoter	CTD	PMID:22847954
Sting1	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of STING1 mRNA	CTD	PMID:34492290
Sting1	Rat	thiram	decreases expression	ISO	RGD:1602274	6480464	Thiram results in decreased expression of STING1 mRNA	CTD	PMID:38568856
Sting1	Rat	titanium dioxide	increases expression	ISO	RGD:1615847	6480464	titanium dioxide results in increased expression of STING1 mRNA	CTD	PMID:23557971\|PMID:27760801
Sting1	Rat	titanium dioxide	increases expression	EXP		6480464	titanium dioxide results in increased expression of STING1 mRNA	CTD	PMID:30012374
Sting1	Rat	triclosan	decreases expression	ISO	RGD:1602274	6480464	Triclosan results in decreased expression of STING1 mRNA	CTD	PMID:30510588
Sting1	Rat	Triptolide	increases expression	ISO	RGD:1615847	6480464	triptolide results in increased expression of STING1 mRNA	CTD	PMID:36520315
Sting1	Rat	Triptolide	multiple interactions	ISO	RGD:1615847	6480464	STING1 protein affects the reaction [triptolide affects the expression of CD40 protein]; STING1 protein affects more ...	CTD	PMID:36520315
Sting1	Rat	vadimezan	multiple interactions	ISO	RGD:1615847	6480464	[vadimezan affects the reaction [P2RX1 protein affects the susceptibility to Acetaminophen]] which affects the phosphorylation more ...	CTD	PMID:37046119
Sting1	Rat	valproic acid	increases methylation	ISO	RGD:1602274	6480464	Valproic Acid results in increased methylation of STING1 gene	CTD	PMID:29154799
Sting1	Rat	zinc oxide	multiple interactions	ISO	RGD:1602274	6480464	RU.521 inhibits the reaction [Zinc Oxide analog results in increased expression of STING1 protein]	CTD	PMID:36368621
Sting1	Rat	zinc oxide	increases expression	ISO	RGD:1602274	6480464	Zinc Oxide analog results in increased expression of STING1 protein	CTD	PMID:36368621
Sting1	Rat	zinc oxide	multiple interactions	ISO	RGD:1615847	6480464	RU.521 inhibits the reaction [Zinc Oxide analog results in increased expression of STING1 protein]	CTD	PMID:36368621
Sting1	Rat	zinc oxide	increases expression	ISO	RGD:1615847	6480464	Zinc Oxide analog results in increased expression of STING1 protein	CTD	PMID:36368621
Sting1	Rat	zoledronic acid	increases expression	ISO	RGD:1602274	6480464	Zoledronic Acid results in increased expression of STING1 mRNA	CTD	PMID:24714768

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Sting1	Rat	activation of innate immune response	involved_in	ISO	RGD:1602274	1624291	PMID:23910378	RGD	PMID:23910378
Sting1	Rat	activation of innate immune response	involved_in	ISO	RGD:1615847	1624291	PMID:21947006, PMID:23258412, PMID:23910378	RGD	PMID:21947006\|PMID:23258412\|PMID:23910378
Sting1	Rat	activation of innate immune response	involved_in	IEA	InterPro:IPR029158	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Sting1	Rat	activation of innate immune response	involved_in	IBA	MGI:1919762\|PANTHER:PTN002855811\|UniProtKB:Q86WV6\|ZFIN:ZDB-GENE-120921-1	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Sting1	Rat	activation of innate immune response	involved_in	IEA	UniProtKB:Q86WV6\|ensembl:ENSP00000331288	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	activation of innate immune response	involved_in	IEA	UniProtKB:Q3TBT3\|ensembl:ENSMUSP00000111393	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	antiviral innate immune response	involved_in	IEA	UniProtKB:Q86WV6\|ensembl:ENSP00000331288	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	antiviral innate immune response	involved_in	ISO	RGD:1602274	1624291	PMID:21074459	RGD	PMID:21074459
Sting1	Rat	autophagosome assembly	involved_in	ISS	UniProtKB:Q86WV6	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Sting1	Rat	autophagosome assembly	involved_in	IBA	MGI:1919762\|PANTHER:PTN005046674\|UniProtKB:Q86WV6	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Sting1	Rat	autophagosome assembly	involved_in	ISO	RGD:1615847	1624291	PMID:30568238	RGD	PMID:30568238
Sting1	Rat	autophagosome assembly	involved_in	IEA	UniProtKB:Q3TBT3\|ensembl:ENSMUSP00000111393	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	autophagosome assembly	involved_in	ISO	RGD:1602274	1624291	PMID:30568238, PMID:30842662, PMID:37535724	RGD	PMID:30568238\|PMID:30842662\|PMID:37535724
Sting1	Rat	autophagosome assembly	involved_in	IEA	UniProtKB:Q86WV6\|ensembl:ENSP00000331288	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	autophagy	involved_in	IEA	UniProtKB-KW:KW-0072	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Sting1	Rat	cellular response to exogenous dsRNA	involved_in	IEA	UniProtKB:Q86WV6\|ensembl:ENSP00000331288	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	cellular response to exogenous dsRNA	involved_in	ISO	RGD:1602274	1624291	PMID:18818105	RGD	PMID:18818105
Sting1	Rat	cellular response to interferon-beta	acts_upstream_of_or_within	IEA	UniProtKB:Q3TBT3\|ensembl:ENSMUSP00000111393	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	cellular response to interferon-beta	acts_upstream_of_or_within	ISO	RGD:1615847	1624291	PMID:21892174	RGD	PMID:21892174
Sting1	Rat	cGAS/STING signaling pathway	involved_in	IEA	UniProtKB:Q86WV6\|ensembl:ENSP00000331288	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	cGAS/STING signaling pathway	involved_in	ISO	RGD:1602274	1624291	PMID:25636800, PMID:30842659, PMID:30842662, PMID:35388221, PMID:37832545	RGD	PMID:25636800\|PMID:30842659\|PMID:30842662\|PMID:35388221\|PMID:37832545
Sting1	Rat	cGAS/STING signaling pathway	involved_in	IEA	UniProtKB:Q3TBT3\|ensembl:ENSMUSP00000111393	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	cGAS/STING signaling pathway	involved_in	ISS	UniProtKB:Q86WV6	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Sting1	Rat	cGAS/STING signaling pathway	involved_in	ISO	RGD:1615847	1624291	PMID:37832545	RGD	PMID:37832545
Sting1	Rat	cytoplasmic pattern recognition receptor signaling pathway	involved_in	ISO	RGD:1602274	1624291	PMID:23910378, PMID:35388221	RGD	PMID:23910378\|PMID:35388221
Sting1	Rat	cytoplasmic pattern recognition receptor signaling pathway	involved_in	IEA	UniProtKB:Q86WV6\|ensembl:ENSP00000331288	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	defense response to virus	involved_in	ISO	RGD:1615847	1624291	PMID:19776740	RGD	PMID:19776740
Sting1	Rat	defense response to virus	involved_in	IEA	UniProtKB:Q3TBT3\|ensembl:ENSMUSP00000111393	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	defense response to virus	acts_upstream_of_or_within	ISO	RGD:1615847	1624291	PMID:21892174	RGD	PMID:21892174
Sting1	Rat	defense response to virus	involved_in	IBA	MGI:1919762\|PANTHER:PTN002855811\|UniProtKB:Q86WV6	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Sting1	Rat	defense response to virus	involved_in	IEA	UniProtKB:Q86WV6\|ensembl:ENSP00000331288	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	defense response to virus	involved_in	ISO	RGD:1602274	1624291	PMID:21074459, PMID:25254379	RGD	PMID:21074459\|PMID:25254379
Sting1	Rat	defense response to virus	involved_in	ISS	UniProtKB:Q86WV6	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Sting1	Rat	immune system process	involved_in	IEA	UniProtKB-KW:KW-0391	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Sting1	Rat	innate immune response	involved_in	ISS	UniProtKB:Q86WV6	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Sting1	Rat	innate immune response	involved_in	ISO	RGD:1602274	1624291	PMID:18818105, PMID:19433799, PMID:21074459, PMID:23910378, PMID:25254379	RGD	PMID:18818105\|PMID:19433799\|PMID:21074459\|PMID:23910378\|PMID:25254379
Sting1	Rat	innate immune response	involved_in	IEA	UniProtKB:Q3TBT3\|ensembl:ENSMUSP00000111393	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	innate immune response	involved_in	ISO	RGD:1615847	1624291	PMID:19433799, PMID:19776740, PMID:23910378	RGD	PMID:19433799\|PMID:19776740\|PMID:23910378
Sting1	Rat	innate immune response	involved_in	IBA	FB:FBgn0033453\|MGI:1919762\|PANTHER:PTN005046674\|UniProtKB:Q86WV6\|ZFIN:ZDB-GENE-120921-1	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Sting1	Rat	innate immune response	involved_in	IEA	UniProtKB-KW:KW-0399	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Sting1	Rat	innate immune response	involved_in	IEA	UniProtKB:Q86WV6\|ensembl:ENSP00000331288	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	monoatomic ion transmembrane transport	involved_in	IEA	UniProtKB-KW:KW-0407	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Sting1	Rat	monoatomic ion transport	involved_in	IEA	UniProtKB-KW:KW-0406	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Sting1	Rat	pattern recognition receptor signaling pathway	involved_in	ISO	RGD:1602274	1624291	PMID:23910378	RGD	PMID:23910378
Sting1	Rat	pattern recognition receptor signaling pathway	involved_in	IEA	UniProtKB:Q86WV6\|ensembl:ENSP00000331288	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	positive regulation of defense response to virus by host	involved_in	IEA	UniProtKB:Q86WV6\|ensembl:ENSP00000331288	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	positive regulation of defense response to virus by host	involved_in	ISO	RGD:1602274	1624291	PMID:18818105	RGD	PMID:18818105
Sting1	Rat	positive regulation of DNA-binding transcription factor activity	involved_in	ISO	RGD:1602274	1624291	PMID:18818105	RGD	PMID:18818105
Sting1	Rat	positive regulation of interferon-beta production	involved_in	ISS	UniProtKB:Q86WV6	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Sting1	Rat	positive regulation of interferon-beta production	involved_in	ISO	RGD:1615847	1624291	PMID:19433799, PMID:19776740	RGD	PMID:19433799\|PMID:19776740
Sting1	Rat	positive regulation of interferon-beta production	involved_in	IEA	UniProtKB:Q3TBT3\|ensembl:ENSMUSP00000111393	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	positive regulation of interferon-beta production	involved_in	ISO	RGD:1602274	1624291	PMID:19433799, PMID:21074459, PMID:25254379	RGD	PMID:19433799\|PMID:21074459\|PMID:25254379
Sting1	Rat	positive regulation of interferon-beta production	involved_in	IEA	UniProtKB:Q86WV6\|ensembl:ENSP00000331288	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	positive regulation of macroautophagy	involved_in	ISS	UniProtKB:Q86WV6	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Sting1	Rat	positive regulation of macroautophagy	involved_in	IEA	UniProtKB:Q3TBT3\|ensembl:ENSMUSP00000111393	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	positive regulation of macroautophagy	involved_in	IBA	FB:FBgn0033453\|MGI:1919762\|PANTHER:PTN005046674\|UniProtKB:A7SLZ2\|UniProtKB:Q86WV6\|ZFIN:ZDB-GENE-120921-1	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Sting1	Rat	positive regulation of macroautophagy	involved_in	ISO	RGD:1602274	1624291	PMID:30568238, PMID:30842662, PMID:37535724	RGD	PMID:30568238\|PMID:30842662\|PMID:37535724
Sting1	Rat	positive regulation of macroautophagy	involved_in	ISO	RGD:1615847	1624291	PMID:30568238	RGD	PMID:30568238
Sting1	Rat	positive regulation of macroautophagy	involved_in	IEA	UniProtKB:Q86WV6\|ensembl:ENSP00000331288	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	positive regulation of transcription by RNA polymerase II	involved_in	IEA	UniProtKB:Q86WV6\|ensembl:ENSP00000331288	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	positive regulation of transcription by RNA polymerase II	acts_upstream_of_or_within	IEA	UniProtKB:Q3TBT3\|ensembl:ENSMUSP00000111393	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	positive regulation of transcription by RNA polymerase II	acts_upstream_of_or_within	ISO	RGD:1615847	1624291	PMID:21892174	RGD	PMID:21892174
Sting1	Rat	positive regulation of transcription by RNA polymerase II	involved_in	ISO	RGD:1602274	1624291	PMID:18818105	RGD	PMID:18818105
Sting1	Rat	positive regulation of type I interferon production	involved_in	IDA		11344949	PMID:26669264	UniProt
Sting1	Rat	positive regulation of type I interferon production	involved_in	IEA	InterPro:IPR029158	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Sting1	Rat	positive regulation of type I interferon production	involved_in	IEA	UniProtKB:Q86WV6\|ensembl:ENSP00000331288	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	positive regulation of type I interferon production	involved_in	IBA	MGI:1919762\|PANTHER:PTN002855811\|RGD:1562552\|UniProtKB:Q86WV6	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Sting1	Rat	positive regulation of type I interferon production	involved_in	IEA	UniProtKB:Q3TBT3\|ensembl:ENSMUSP00000111393	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	positive regulation of type I interferon production	involved_in	ISO	RGD:1602274	1624291	PMID:22394562, PMID:23747010, PMID:25636800, PMID:26669264, PMID:29694889, PMID:29973723, PMID:30842659, PMID:35388221, PMID:37832545	RGD	PMID:22394562\|PMID:23747010\|PMID:25636800\|PMID:26669264\|PMID:29694889\|PMID:29973723\|PMID:30842659\|PMID:35388221\|PMID:37832545
Sting1	Rat	positive regulation of type I interferon production	involved_in	ISO	RGD:1615847	1624291	PMID:26669264, PMID:27324217, PMID:29973723	RGD	PMID:26669264\|PMID:27324217\|PMID:29973723
Sting1	Rat	positive regulation of type I interferon-mediated signaling pathway	involved_in	ISO	RGD:1615847	1624291	PMID:23910378	RGD	PMID:23910378
Sting1	Rat	positive regulation of type I interferon-mediated signaling pathway	involved_in	IEA	UniProtKB:Q3TBT3\|ensembl:ENSMUSP00000111393	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	positive regulation of type I interferon-mediated signaling pathway	involved_in	ISO	RGD:1602274	1624291	PMID:23910378	RGD	PMID:23910378
Sting1	Rat	positive regulation of type I interferon-mediated signaling pathway	involved_in	IEA	UniProtKB:Q86WV6\|ensembl:ENSP00000331288	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	protein complex oligomerization	involved_in	IEA	UniProtKB:Q86WV6\|ensembl:ENSP00000331288	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	protein complex oligomerization	acts_upstream_of	ISO	RGD:1602274	1624291	PMID:35388221	RGD	PMID:35388221
Sting1	Rat	protein complex oligomerization	involved_in	ISO	RGD:1602274	1624291	PMID:30842659	RGD	PMID:30842659
Sting1	Rat	protein localization to endoplasmic reticulum	involved_in	IEA	UniProtKB:Q86WV6\|ensembl:ENSP00000331288	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	protein localization to endoplasmic reticulum	involved_in	ISO	RGD:1602274	1624291	PMID:37832545	RGD	PMID:37832545
Sting1	Rat	proton transmembrane transport	involved_in	IEA	GO:0015252	1600115	GO_REF:0000108	GOC	GO_REF:0000108
Sting1	Rat	regulation of gene expression	acts_upstream_of_or_within	ISO	RGD:1615847	1624291	MGI:1328317\|MGI:1859179\|MGI:1859212\|MGI:1929658 PMID:23160154	RGD	PMID:23160154
Sting1	Rat	regulation of gene expression	acts_upstream_of_or_within	IEA	UniProtKB:Q3TBT3\|ensembl:ENSMUSP00000111393	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	regulation of inflammatory response	acts_upstream_of_or_within	ISO	RGD:1615847	1624291	MGI:1328317 PMID:28069950	RGD	PMID:28069950
Sting1	Rat	regulation of inflammatory response	acts_upstream_of_or_within	IEA	UniProtKB:Q3TBT3\|ensembl:ENSMUSP00000111393	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	reticulophagy	involved_in	ISS	UniProtKB:Q3TBT3	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Sting1	Rat	reticulophagy	involved_in	IEA	UniProtKB:Q3TBT3\|ensembl:ENSMUSP00000111393	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	reticulophagy	involved_in	IBA	MGI:1919762\|PANTHER:PTN005046674	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Sting1	Rat	reticulophagy	involved_in	ISO	RGD:1615847	1624291	PMID:29056340	RGD	PMID:29056340

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Sting1	Rat	autophagosome	located_in	ISO	RGD:1602274	1624291	PMID:29694889	RGD	PMID:29694889
Sting1	Rat	autophagosome	located_in	IEA	UniProtKB:Q3TBT3\|ensembl:ENSMUSP00000111393	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	autophagosome	is_active_in	IBA	MGI:1919762\|PANTHER:PTN005046674\|UniProtKB:Q86WV6	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Sting1	Rat	autophagosome	located_in	ISO	RGD:1615847	1624291	PMID:29056340	RGD	PMID:29056340
Sting1	Rat	autophagosome	located_in	IEA	UniProtKB:Q86WV6\|ensembl:ENSP00000331288	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	autophagosome membrane	located_in	IEA	UniProtKB-SubCell:SL-0022	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Sting1	Rat	ciliary basal body	located_in	ISO	RGD:1602274	1624291		RGD	GO_REF:0000052
Sting1	Rat	ciliary basal body	located_in	IEA	UniProtKB:Q86WV6\|ensembl:ENSP00000331288	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	cilium	located_in	IEA	UniProtKB:Q86WV6\|ensembl:ENSP00000331288	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	cilium	located_in	ISO	RGD:1602274	1624291		RGD	GO_REF:0000052
Sting1	Rat	cytoplasm	located_in	ISO	RGD:1615847	1624291	PMID:24560620	RGD	PMID:24560620
Sting1	Rat	cytoplasm	located_in	IEA	UniProtKB:Q3TBT3\|ensembl:ENSMUSP00000111393	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Sting1	Rat	cytoplasm	located_in	ISS	UniProtKB:Q3TBT3	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Sting1	Rat	cytoplasmic vesicle	located_in	IEA	UniProtKB-KW:KW-0968	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Sting1	Rat	cytosol	located_in	IEA	UniProtKB:Q86WV6\|ensembl:ENSP00000331288	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	cytosol	located_in	ISO	RGD:1602274	1624291		RGD	GO_REF:0000052
Sting1	Rat	endoplasmic reticulum	located_in	IEA	UniProtKB-KW:KW-0256	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Sting1	Rat	endoplasmic reticulum	located_in	IEA	UniProtKB:Q3TBT3\|ensembl:ENSMUSP00000111393	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	endoplasmic reticulum	located_in	ISO	RGD:1615847	1624291	PMID:19926846, PMID:21892174	RGD	PMID:19926846\|PMID:21892174
Sting1	Rat	endoplasmic reticulum membrane	is_active_in	ISO	RGD:1615847	1624291	PMID:37832545	RGD	PMID:37832545
Sting1	Rat	endoplasmic reticulum membrane	located_in	IEA	UniProtKB:Q3TBT3\|ensembl:ENSMUSP00000111393	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	endoplasmic reticulum membrane	located_in	ISO	RGD:1615847	1624291	PMID:19776740, PMID:27324217	RGD	PMID:19776740\|PMID:27324217
Sting1	Rat	endoplasmic reticulum membrane	is_active_in	IBA	FB:FBgn0033453\|MGI:1919762\|PANTHER:PTN005046674\|UniProtKB:Q86WV6	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Sting1	Rat	endoplasmic reticulum membrane	located_in	IEA	UniProtKB-SubCell:SL-0097	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Sting1	Rat	endoplasmic reticulum membrane	is_active_in	ISO	RGD:1602274	1624291	PMID:37832545	RGD	PMID:37832545
Sting1	Rat	endoplasmic reticulum membrane	located_in	ISO	RGD:1602274	1624291	PMID:19433799, PMID:25254379, PMID:29694889, PMID:30119996, PMID:30842659, PMID:30842662	RGD	PMID:19433799\|PMID:25254379\|PMID:29694889\|PMID:30119996\|PMID:30842659\|PMID:30842662
Sting1	Rat	endoplasmic reticulum membrane	located_in	IEA	UniProtKB:Q86WV6\|ensembl:ENSP00000331288	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	endoplasmic reticulum-Golgi intermediate compartment membrane	located_in	IEA	UniProtKB-SubCell:SL-0099	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Sting1	Rat	endoplasmic reticulum-Golgi intermediate compartment membrane	is_active_in	IEA	UniProtKB:Q3TBT3\|ensembl:ENSMUSP00000111393	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	endoplasmic reticulum-Golgi intermediate compartment membrane	is_active_in	ISO	RGD:1615847	1624291	PMID:37832545	RGD	PMID:37832545
Sting1	Rat	endoplasmic reticulum-Golgi intermediate compartment membrane	is_active_in	ISO	RGD:1602274	1624291	PMID:32690950, PMID:37832545	RGD	PMID:32690950\|PMID:37832545
Sting1	Rat	endoplasmic reticulum-Golgi intermediate compartment membrane	located_in	IEA	UniProtKB:Q86WV6\|ensembl:ENSP00000331288	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	endoplasmic reticulum-Golgi intermediate compartment membrane	located_in	ISO	RGD:1602274	1624291	PMID:30842662	RGD	PMID:30842662
Sting1	Rat	endosome	located_in	IEA	UniProtKB:Q86WV6\|ensembl:ENSP00000331288	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	endosome	located_in	ISO	RGD:1602274	1624291	PMID:29694889	RGD	PMID:29694889
Sting1	Rat	Golgi apparatus	located_in	ISO	RGD:1615847	1624291	PMID:19926846, PMID:28930687	RGD	PMID:19926846\|PMID:28930687
Sting1	Rat	Golgi apparatus	located_in	IEA	UniProtKB:Q3TBT3\|ensembl:ENSMUSP00000111393	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	Golgi apparatus	located_in	IEA	UniProtKB-KW:KW-0333	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Sting1	Rat	Golgi membrane	located_in	IEA	UniProtKB:Q86WV6\|ensembl:ENSP00000331288	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	Golgi membrane	located_in	IEA	UniProtKB:Q3TBT3\|ensembl:ENSMUSP00000111393	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	Golgi membrane	located_in	IEA	UniProtKB-SubCell:SL-0134	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Sting1	Rat	Golgi membrane	located_in	ISO	RGD:1615847	1624291	PMID:27324217, PMID:29973723	RGD	PMID:27324217\|PMID:29973723
Sting1	Rat	Golgi membrane	is_active_in	ISO	RGD:1602274	1624291	PMID:37535724	RGD	PMID:37535724
Sting1	Rat	Golgi membrane	located_in	ISO	RGD:1602274	1624291	PMID:29973723	RGD	PMID:29973723
Sting1	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Sting1	Rat	mitochondrial outer membrane	located_in	ISO	RGD:1602274	1624291	PMID:18818105	RGD	PMID:18818105
Sting1	Rat	mitochondrial outer membrane	located_in	IEA	UniProtKB-KW:KW-1000	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Sting1	Rat	mitochondrial outer membrane	located_in	IEA	UniProtKB:Q86WV6\|ensembl:ENSP00000331288	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	mitochondrial outer membrane	located_in	IEA	UniProtKB-SubCell:SL-0172	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Sting1	Rat	mitochondrion	located_in	IEA	UniProtKB-KW:KW-0496	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Sting1	Rat	nucleoplasm	located_in	IEA	UniProtKB:Q86WV6\|ensembl:ENSP00000331288	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	nucleoplasm	located_in	ISO	RGD:1602274	1624291		RGD	GO_REF:0000052
Sting1	Rat	perinuclear region of cytoplasm	located_in	IEA	UniProtKB-SubCell:SL-0198	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Sting1	Rat	perinuclear region of cytoplasm	located_in	ISO	RGD:1615847	1624291	PMID:19776740	RGD	PMID:19776740
Sting1	Rat	perinuclear region of cytoplasm	located_in	IEA	UniProtKB:Q3TBT3\|ensembl:ENSMUSP00000111393	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	peroxisome	located_in	IEA	UniProtKB:Q3TBT3\|ensembl:ENSMUSP00000111393	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	peroxisome	located_in	ISO	RGD:1615847	1624291	PMID:22745163	RGD	PMID:22745163
Sting1	Rat	plasma membrane	located_in	IEA	UniProtKB-SubCell:SL-0039	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Sting1	Rat	plasma membrane	located_in	IEA	UniProtKB-KW:KW-1003	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Sting1	Rat	STING complex	part_of	ISO	RGD:1602274	1624291	PMID:30405246	RGD	PMID:30405246
Sting1	Rat	STING complex	part_of	IEA	UniProtKB:Q3TBT3\|ensembl:ENSMUSP00000111393	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	STING complex	part_of	IEA	UniProtKB:Q86WV6\|ensembl:ENSP00000331288	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	STING complex	part_of	ISO	RGD:1615847	1624291	PMID:23910378	RGD	PMID:23910378

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Sting1	Rat	2',3'-cyclic GMP-AMP binding	enables	IDA		11344949	PMID:26669264	UniProt
Sting1	Rat	2',3'-cyclic GMP-AMP binding	enables	IBA	FB:FBgn0033453\|MGI:1919762\|PANTHER:PTN005046674\|RGD:1562552\|UniProtKB:A7SLZ2\|UniProtKB:E1C7U0\|UniProtKB:Q86WV6	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Sting1	Rat	2',3'-cyclic GMP-AMP binding	enables	ISO	RGD:1602274	1624291	PMID:23747010, PMID:26669264, PMID:30842659, PMID:30842662, PMID:35388221	RGD	PMID:23747010\|PMID:26669264\|PMID:30842659\|PMID:30842662\|PMID:35388221
Sting1	Rat	2',3'-cyclic GMP-AMP binding	enables	ISO	RGD:1615847	1624291	PMID:23258412, PMID:26300263, PMID:26669264	RGD	PMID:23258412\|PMID:26300263\|PMID:26669264
Sting1	Rat	2',3'-cyclic GMP-AMP binding	enables	IEA	UniProtKB:Q3TBT3\|ensembl:ENSMUSP00000111393	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	2',3'-cyclic GMP-AMP binding	enables	IEA	UniProtKB:Q86WV6\|ensembl:ENSP00000331288	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	cyclic-di-GMP binding	enables	ISO	RGD:1615847	1624291	PMID:21947006, PMID:26300263	RGD	PMID:21947006\|PMID:26300263
Sting1	Rat	cyclic-di-GMP binding	enables	IEA	UniProtKB:Q3TBT3\|ensembl:ENSMUSP00000111393	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	cyclic-di-GMP binding	enables	IBA	FB:FBgn0033453\|MGI:1919762\|PANTHER:PTN005046674\|UniProtKB:A7SLZ2\|UniProtKB:Q86WV6	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Sting1	Rat	cyclic-di-GMP binding	enables	ISO	RGD:1602274	1624291	PMID:22705373, PMID:29694889	RGD	PMID:22705373\|PMID:29694889
Sting1	Rat	cyclic-di-GMP binding	enables	IEA	UniProtKB:Q86WV6\|ensembl:ENSP00000331288	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	DNA-binding transcription factor binding	enables	ISO	RGD:1602274	1624291	UniProtKB:Q14653 PMID:18818105	RGD	PMID:18818105
Sting1	Rat	identical protein binding	enables	ISO	RGD:1602274	1624291	UniProtKB:Q86WV6 PMID:19433799, PMID:22312431, PMID:22728658, PMID:22728659, PMID:22728660, PMID:23542348, PMID:30405246, PMID:30842659	RGD	PMID:19433799\|PMID:22312431\|PMID:22728658\|PMID:22728659\|PMID:22728660\|PMID:23542348\|PMID:30405246\|PMID:30842659
Sting1	Rat	identical protein binding	enables	IEA	UniProtKB:Q86WV6\|ensembl:ENSP00000331288	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	nucleotide binding	enables	IEA	UniProtKB-KW:KW-0547	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Sting1	Rat	protein binding	enables	ISO	RGD:1602274	1624291	UniProtKB:B2RUZ4\|UniProtKB:O15260\|UniProtKB:O43657\|UniProtKB:O94822\|UniProtKB:O94826\|UniProtKB:O95214\|UniProtKB:O95470\|UniProtKB:O95786\|UniProtKB:O95786-1\|UniProtKB:P03255\|UniProtKB:P09913\|UniProtKB:P09914\|UniProtKB:P0C6X5-PRO_0000283876\|UniProtKB:P0C6X7-PRO_0000037311\|UniProtKB:P27958-PRO_0000037575\|UniProtKB:P39656\|UniProtKB:P42226\|UniProtKB:P43308\|UniProtKB:P46977\|UniProtKB:P51617\|UniProtKB:P53992\|UniProtKB:Q13190\|UniProtKB:Q14653\|UniProtKB:Q16666\|UniProtKB:Q16666-8\|UniProtKB:Q7RTR2\|UniProtKB:Q7Z434\|UniProtKB:Q7Z434-1\|UniProtKB:Q8WTX9\|UniProtKB:Q96A33\|UniProtKB:Q96DZ9-2\|UniProtKB:Q96HR9-2\|UniProtKB:Q96N66\|UniProtKB:Q99IB8-PRO_0000045601\|UniProtKB:Q9BWQ6\|UniProtKB:Q9BXJ8\|UniProtKB:Q9H8X9\|UniProtKB:Q9NV29\|UniProtKB:Q9NZ01\|UniProtKB:Q9UHD2\|UniProtKB:Q9Y342 PMID:18724357, PMID:18818105, PMID:19416887, PMID:19433799, PMID:20080758, PMID:20628368, PMID:20890285, PMID:21903422, PMID:22000020, PMID:22312431, PMID:22908223, PMID:22911572, PMID:23542348, more ...	RGD	PMID:18724357\|PMID:18818105\|PMID:19416887\|PMID:19433799\|PMID:20080758\|PMID:20628368\|PMID:20890285\|PMID:21903422\|PMID:22000020\|PMID:22312431\|PMID:22908223\|PMID:22911572\|PMID:23542348\|PMID:24560620\|PMID:24622840\|PMID:25299331\|PMID:26405230\|PMID:27302953\|PMID:29251827\|PMID:29429998\|PMID:30104205\|PMID:30842662\|PMID:32296183\|PMID:35013224
Sting1	Rat	protein binding	enables	ISO	RGD:1615847	1624291	PR:Q91VN6\|UniProtKB:Q07113\|UniProtKB:Q91VN6\|UniProtKB:Q9WUN2 PMID:21892174, PMID:22000020, PMID:23142775, PMID:24560620, PMID:37863414	RGD	PMID:21892174\|PMID:22000020\|PMID:23142775\|PMID:24560620\|PMID:37863414
Sting1	Rat	protein homodimerization activity	enables	ISO	RGD:1602274	1624291	PMID:19433799, PMID:21074459, PMID:22705373	RGD	PMID:19433799\|PMID:21074459\|PMID:22705373
Sting1	Rat	protein homodimerization activity	enables	IEA	UniProtKB:Q86WV6\|ensembl:ENSP00000331288	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	protein kinase binding	enables	ISO	RGD:1602274	1624291	UniProtKB:Q9WUN2 PMID:18818105, PMID:21074459	RGD	PMID:18818105\|PMID:21074459
Sting1	Rat	protein kinase binding	enables	IEA	UniProtKB:Q86WV6\|ensembl:ENSP00000331288	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	protein serine/threonine kinase binding	enables	ISO	RGD:1602274	1624291	UniProtKB:Q9UHD2 PMID:18818105	RGD	PMID:18818105
Sting1	Rat	proton channel activity	enables	ISS	UniProtKB:Q86WV6	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Sting1	Rat	proton channel activity	enables	ISO	RGD:1602274	1624291	PMID:37535724	RGD	PMID:37535724
Sting1	Rat	proton channel activity	enables	IEA	UniProtKB:Q86WV6\|ensembl:ENSP00000331288	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	RNA polymerase II-specific DNA-binding transcription factor binding	enables	IEA	UniProtKB:Q86WV6\|ensembl:ENSP00000331288	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	RNA polymerase II-specific DNA-binding transcription factor binding	enables	ISO	RGD:1602274	1624291	PMID:18818105	RGD	PMID:18818105
Sting1	Rat	signaling adaptor activity	enables	IEA	UniProtKB:Q86WV6\|ensembl:ENSP00000331288	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	signaling adaptor activity	enables	ISO	RGD:1602274	1624291	PMID:23747010, PMID:25636800, PMID:37832545	RGD	PMID:23747010\|PMID:25636800\|PMID:37832545
Sting1	Rat	signaling adaptor activity	enables	ISS	UniProtKB:Q86WV6	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Sting1	Rat	ubiquitin protein ligase binding	enables	IEA	UniProtKB:Q3TBT3\|ensembl:ENSMUSP00000111393	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Sting1	Rat	ubiquitin protein ligase binding	enables	ISO	RGD:1615847	1624291	UniProtKB:Q80VI1 PMID:21074459	RGD	PMID:21074459

#	Reference Title	Reference Citation
1.	Sterile Lung Inflammation Induced by Silica Exacerbates Mycobacterium tuberculosis Infection via STING-Dependent Type 2 Immunity.	Benmerzoug S, etal., Cell Rep. 2019 May 28;27(9):2649-2664.e5. doi: 10.1016/j.celrep.2019.04.110.
2.	Brucella abortus Triggers a cGAS-Independent STING Pathway To Induce Host Protection That Involves Guanylate-Binding Proteins and Inflammasome Activation.	Costa Franco MM, etal., J Immunol. 2018 Jan 15;200(2):607-622. doi: 10.4049/jimmunol.1700725. Epub 2017 Dec 4.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Brucella abortus Cyclic Dinucleotides Trigger STING-Dependent Unfolded Protein Response That Favors Bacterial Replication.	Guimarães ES, etal., J Immunol. 2019 May 1;202(9):2671-2681. doi: 10.4049/jimmunol.1801233. Epub 2019 Mar 20.
5.	STING/MPYS mediates host defense against Listeria monocytogenes infection by regulating Ly6C(hi) monocyte migration.	Jin L, etal., J Immunol. 2013 Mar 15;190(6):2835-43. doi: 10.4049/jimmunol.1201788. Epub 2013 Feb 1.
6.	Nontypeable Haemophilus influenzae DNA stimulates type I interferon expression via STING signaling pathway.	Lu C, etal., Biochim Biophys Acta Mol Cell Res. 2018 Apr;1865(4):665-673. doi: 10.1016/j.bbamcr.2018.01.011. Epub 2018 Feb 5.
7.	The cGAS/STING Pathway Is Important for Dendritic Cell Activation but Is Not Essential to Induce Protective Immunity against Mycobacterium tuberculosis Infection.	Marinho FV, etal., J Innate Immun. 2018;10(3):239-252. doi: 10.1159/000488952. Epub 2018 May 23.
8.	STING is required for host defense against neuropathological West Nile virus infection.	McGuckin Wuertz K, etal., PLoS Pathog. 2019 Aug 15;15(8):e1007899. doi: 10.1371/journal.ppat.1007899. eCollection 2019 Aug.
9.	Upregulation of innate antiviral restricting factor expression in the cord blood and decidual tissue of HIV-infected mothers.	Pereira NZ, etal., PLoS One. 2013 Dec 18;8(12):e84917. doi: 10.1371/journal.pone.0084917. eCollection 2013.
10.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
11.	Herpesvirus-Associated Lymphadenitis Distorts Fibroblastic Reticular Cell Microarchitecture and Attenuates CD8 T Cell Responses to Neurotropic Infection in Mice Lacking the STING-IFNα/β Defense Pathways.	Royer DJ, etal., J Immunol. 2016 Sep 15;197(6):2338-52. doi: 10.4049/jimmunol.1600574. Epub 2016 Aug 10.
12.	The cGAS/STING Pathway Detects Streptococcus pneumoniae but Appears Dispensable for Antipneumococcal Defense in Mice and Humans.	Ruiz-Moreno JS, etal., Infect Immun. 2018 Feb 20;86(3). pii: IAI.00849-17. doi: 10.1128/IAI.00849-17. Print 2018 Mar.
13.	The N-ethyl-N-nitrosourea-induced Goldenticket mouse mutant reveals an essential function of Sting in the in vivo interferon response to Listeria monocytogenes and cyclic dinucleotides.	Sauer JD, etal., Infect Immun. 2011 Feb;79(2):688-94. doi: 10.1128/IAI.00999-10. Epub 2010 Nov 22.
14.	The role of the adaptor molecule STING during Schistosoma mansoni infection.	Souza C, etal., Sci Rep. 2020 May 13;10(1):7901. doi: 10.1038/s41598-020-64788-6.
15.	STING induces early IFN-β in the liver and constrains myeloid cell-mediated dissemination of murine cytomegalovirus.	Tegtmeyer PK, etal., Nat Commun. 2019 Jun 27;10(1):2830. doi: 10.1038/s41467-019-10863-0.
16.	Lack of immunological DNA sensing in hepatocytes facilitates hepatitis B virus infection.	Thomsen MK, etal., Hepatology. 2016 Sep;64(3):746-59. doi: 10.1002/hep.28685. Epub 2016 Jul 26.
17.	The GRA15 protein from Toxoplasma gondii enhances host defense responses by activating the interferon stimulator STING.	Wang P, etal., J Biol Chem. 2019 Nov 8;294(45):16494-16508. doi: 10.1074/jbc.RA119.009172. Epub 2019 Aug 15.
18.	Methylation status of the stimulator of interferon genes promoter in patients with chronic hepatitis B.	Wu CS, etal., Medicine (Baltimore). 2018 Dec;97(52):e13904. doi: 10.1097/MD.0000000000013904.
19.	Rat and human STINGs profile similarly towards anticancer/antiviral compounds.	Zhang H, etal., Sci Rep. 2015 Dec 16;5:18035. doi: 10.1038/srep18035.

PMID:18818105	PMID:19433799	PMID:19776740	PMID:19926846	PMID:21074459	PMID:21892174	PMID:21947006	PMID:22387590	PMID:22394562	PMID:22705373	PMID:22728658	PMID:22728659
PMID:22728660	PMID:22745163	PMID:23160154	PMID:23258412	PMID:23542348	PMID:23747010	PMID:24560620	PMID:25254379	PMID:26300263	PMID:28069950	PMID:29056340	PMID:29694889
PMID:30119996	PMID:30405246	PMID:30568238	PMID:30842659	PMID:30842662	PMID:32253733	PMID:34477314	PMID:35926582	PMID:36878046	PMID:38518595	PMID:38725841	PMID:39002476

Sting1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	18	27,606,196 - 27,612,544 (-)	NCBI		GRCr8
mRatBN7.2	18	27,332,119 - 27,338,371 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	27,332,119 - 27,338,335 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	18	27,459,541 - 27,465,793 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	28,221,584 - 28,227,830 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	27,556,463 - 27,562,709 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	28,529,537 - 28,535,828 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	28,529,576 - 28,535,828 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	18	28,242,119 - 28,248,371 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	18	28,355,029 - 28,357,171 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	18	27,065,352 - 27,071,596 (-)	NCBI		Celera
Cytogenetic Map	18	p11	NCBI

STING1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	139,475,533 - 139,482,758 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	139,475,533 - 139,482,935 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	5	138,855,118 - 138,862,343 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	138,835,733 - 138,842,476 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	5	134,930,158 - 134,937,391 (-)	NCBI		Celera
Cytogenetic Map	5	q31.2	NCBI
HuRef	5	133,997,951 - 134,005,182 (-)	NCBI		HuRef
CHM1_1	5	138,287,678 - 138,294,915 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	5	140,000,594 - 140,007,823 (-)	NCBI		T2T-CHM13v2.0

Sting1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	18	35,866,731 - 35,873,607 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	18	35,866,732 - 35,873,607 (-)	Ensembl		GRCm39 Ensembl
GRCm38	18	35,733,678 - 35,740,554 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	18	35,733,679 - 35,740,554 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	18	35,893,332 - 35,900,208 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	18	35,859,652 - 35,866,528 (-)	NCBI		MGSCv36	mm8
Celera	18	36,189,779 - 36,196,655 (-)	NCBI		Celera
Cytogenetic Map	18	B2	NCBI
cM Map	18	19.23	NCBI

Sting1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955418	1,083,613 - 1,100,448 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955418	1,091,022 - 1,097,064 (+)	NCBI	ChiLan1.0	ChiLan1.0

STING1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	4	134,741,514 - 134,750,786 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	5	132,881,061 - 132,890,364 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	134,845,689 - 134,852,938 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	140,967,399 - 140,989,653 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	140,967,399 - 140,973,846 (-)	Ensembl	panpan1.1		panPan2

STING1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	34,783,947 - 34,792,204 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	34,784,232 - 34,789,072 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	31,886,015 - 31,894,282 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	35,237,857 - 35,246,124 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	35,217,688 - 35,243,000 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	32,290,300 - 32,298,567 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	33,156,814 - 33,165,081 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	33,908,726 - 33,916,993 (-)	NCBI		UU_Cfam_GSD_1.0

Sting1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	153,048,662 - 153,055,631 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936531	8,555,637 - 8,562,885 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936531	8,555,966 - 8,562,829 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

STING1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	141,358,993 - 141,367,198 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	141,359,402 - 141,367,222 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	147,169,469 - 147,177,263 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

STING1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	23	42,153,576 - 42,160,903 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	23	42,153,026 - 42,160,907 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666034	35,727,193 - 35,734,956 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Sting1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624743	32,273,385 - 32,283,235 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624743	32,277,197 - 32,283,346 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Sting1
12 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	94
Count of miRNA genes:	75
Interacting mature miRNAs:	87
Transcripts:	ENSRNOT00000068386
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331733	Bp233	Blood pressure QTL 233	3.97196		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	24796977	79788953	Rat
1358358	Sradr6	Stress Responsive Adrenal Weight QTL 6	2.49		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	18	11944299	59330563	Rat
1331735	Rf44	Renal function QTL 44	2.981		urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	18	18234564	31359530	Rat
61382	Bp46	Blood pressure QTL 46	18.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	11941791	31393320	Rat
2301413	Bp318	Blood pressure QTL 318		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	26548082	46969551	Rat
1331741	Bp232	Blood pressure QTL 232	3.59112		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	21372893	83213037	Rat
61388	Bp2	Blood pressure QTL 2	3.23		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	1	35374722	Rat
6903359	Bp355	Blood pressure QTL 355	3.6		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	11944544	59796478	Rat
12904668	Bw188	Body weight QTL 188		0.03	body mass (VT:0001259)	body weight (CMO:0000012)	18	26548082	46969551	Rat
2313082	Bss85	Bone structure and strength QTL 85	0.8	0.0001	long bone metaphysis morphology trait (VT:0000133)	tibia midshaft total cross-sectional area (CMO:0001715)	18	14951337	59951337	Rat
12904669	Cm125	Cardiac mass QTL 125		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	18	26548082	46969551	Rat
1641923	Colcr8	Colorectal carcinoma resistance QTL 8	3.1	0.0014	intestine integrity trait (VT:0010554)	poorly differentiated malignant colorectal tumor number (CMO:0002076)	18	22066242	52293055	Rat
12904670	Cm126	Cardiac mass QTL 126		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	18	26548082	46969551	Rat
2312568	Glom21	Glomerulus QTL 21	2	0.005	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	18	5185858	40503530	Rat
12904677	Kidm72	Kidney mass QTL 72		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	18	26548082	46969551	Rat
1331766	Bp236	Blood pressure QTL 236	3.022		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	11944299	31359530	Rat
1358193	Emca2	Estrogen-induced mammary cancer QTL 2	1.6		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	18	18007599	63571040	Rat
12904673	Cm127	Cardiac mass QTL 127		0.005	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	18	26548082	46969551	Rat
12904675	Am19	Aortic mass QTL 19		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	18	26548082	46969551	Rat
631264	Scl22	Serum cholesterol level QTL 22	6.2		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	18	11941791	31393320	Rat
1331775	Bp235	Blood pressure QTL 235	3.201		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	18234564	31359530	Rat
2325839	Bp348	Blood pressure QTL 348		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	25570985	70570985	Rat
1600373	Mamtr6	Mammary tumor resistance QTL 6			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	18	19278901	83218561	Rat
2293708	Bss46	Bone structure and strength QTL 46	8.8	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	18	11791518	63636873	Rat
9589153	Insul31	Insulin level QTL 31	7.15	0.05	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	18	1	42547119	Rat
1578667	Bss21	Bone structure and strength QTL 21	3.5		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	18	11791518	83218561	Rat
2312598	Bp340	Blood pressure QTL 340		0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	1	30558703	Rat
2300180	Bmd67	Bone mineral density QTL 67	4.8	0.0001	femur mineral mass (VT:0010011)	bone mineral density (CMO:0001226)	18	1	34291613	Rat
2299160	Iddm35	Insulin dependent diabetes mellitus QTL 35	2.79		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	18	4207941	60377792	Rat
1578661	Bss20	Bone structure and strength QTL 20	3.7		femur morphology trait (VT:0000559)	femoral neck cross-sectional area (CMO:0001697)	18	11791518	83218561	Rat
1331753	Bp231	Blood pressure QTL 231	3.643		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	11944299	52293055	Rat
2293661	Bss50	Bone structure and strength QTL 50	4.64	0.0003	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	18	1	34291613	Rat
61375	Bp41	Blood pressure QTL 41	2.4		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	18	11944299	41122201	Rat

RH140265

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	27,332,418 - 27,332,634 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	28,529,876 - 28,530,091	NCBI	Rnor6.0
Rnor_5.0	18	28,242,419 - 28,242,634	UniSTS	Rnor5.0
RGSC_v3.4	18	28,355,329 - 28,355,544	UniSTS	RGSC3.4
Celera	18	27,065,652 - 27,065,867	UniSTS
RH 3.4 Map	18	380.8	UniSTS
Cytogenetic Map	18	p11	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001109122	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006254601	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039097039	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC135285	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473974	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000018	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JN587497	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000068386 ⟹ ENSRNOP00000063348

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	18	27,332,119 - 27,338,335 (-)	Ensembl
Rnor_6.0 Ensembl	18	28,529,576 - 28,535,828 (-)	Ensembl

RefSeq Acc Id:

NM_001109122 ⟹ NP_001102592

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	27,606,196 - 27,612,448 (-)	NCBI
mRatBN7.2	18	27,332,119 - 27,338,371 (-)	NCBI
Rnor_6.0	18	28,529,576 - 28,535,828 (-)	NCBI
Rnor_5.0	18	28,242,119 - 28,248,371 (-)	NCBI
RGSC_v3.4	18	28,355,029 - 28,357,171 (-)	RGD
Celera	18	27,065,352 - 27,071,596 (-)	RGD

Sequence:

show sequence

CTCTCCTGGGCTTCTACTAAATTCTTAGCTTAGAGCCCGAGATTTCAGGAAGTAGAGTGTGCTGTTTACCCTCTCAATCTCTCCTGTGCAATCCTCCCTCCTGATGTCCTAGGGATAGATAGTGGAGG
GTTTGGGGGCATCTTGAAATCCTGTGGGGGGCCCTGTCACTTTGGGTCCTTGTGTGAGTCCTGCCTGGTGTCTACTGCAGCGTGTTGCATCCCACGGACCTTTAGAGGAATCCGGAGTGCGGGGCTGT
GACTGCTGTCTGCCCTTTGAGAGGCCACTTGCCGGTCGCTACGGAAGGGTTCTTCATAGTCTCTCCAGTTCCAGGAACACTTCGGTCTAGGAAGCAGAAGATGCCATACTCCAACCTGCATCCATCCA
TCCCACGGCCCAGAAGTTACCGCTTCAAACTGGCAGCCTTCGTCTTGCTGGTGGGCAGCCTGATGAGCCTTTGGATGACAGGGGAACCACCAAGTCACACTCTGCATTACCTAGCACTTCACGTAGCC
TCGCAGCAACTTGGATTACTGTTGAAAAAGCTCTGCTGTCTGGCTGAAGAGTTGTGCCATGTCCAGTCCAGGTACCAGGGCAGCTACTGGAAGGCTGTGCGCGCCTGCGTGGGGAGTCCCATCTGCTT
TATGGCCCTGATCCTACTGTCATTTTATTTCTACTGCTCCCTCGAAAATACTTCTGACCTGCGCCTTGCTTGGCATCTTGGCATCCTGGTCCTTTCAAAGTCCCTAAGCATGACCCTGGACCTTCAGA
GCTTGGCCCCAGCAGAAGTCTCTGCGGTCTGTGAAGAAAAGAACTTCAATGTTGCCCATGGACTGGCCTGGTCGTACTACATTGGGTACCTGAAGCTGATCTTGCCAGGACTGCAGGCCCGGATCCGG
ATGTTCAATCAGCTACACAACAACATGCTCTCGGGTGCGGGGAGCCGGCGGCTGTATATCCTCTTCCCATTGGACTGTGGGGTGCCTGATGATCTGAGTGTGGCTGACCCCAATATTCGATTCCGAGA
TATGCTGCCCCAGCAAAACACAGACCGTGCTGGCGTCAAGAATCGGGCTTATTCCAACAGTGTCTATGAACTTCTGGAGAATGGGCAGCCGGCAGGTGCCTGTATCCTGGAGTACGCCACCCCCTTGC
AGACCTTGTTTGCCATGTCACAGGATGGCAAAGCTGGCTTCAGTCGGGAGGACCGGCTTGAGCAGGCCAAACTCTTCTGTCGGACACTTGAGGAAATTCTGGCTGATGTCCCTGAGTCTCGAAACCAC
TGCCGCCTCATTGTCTACCAAGAATCCGAAGAGGGAAACAGTTTCTCGCTGTCTCAGGAGGTGCTCCGGCACATTCGGCAAGAAGAAAAGGAGGAAGTTACCATGAGTGGCCCCCCGACCTCAGTGGC
ACCTCGTCCCTCCCTACTGTCCCAAGAGCCGAGACTTCTCATCAGTGGCATGGAGCAGCCTCTCCCACTCCGCACGGACCTCATCTGAGGCATGAGACAGCCTTGCCTGGGTCCCAGTGACCCTTCAG
CCTCTTGACTGGGCTCCCCTTTAATGGCTGGGGGCCTCATAGAGACTTCACATCTCCAGATGAGTCCCACATTCCCGGGCAAGCCACTTCACCTCTCTGAGCCTCAGCCTGCCCCACTCCAAAGGCCA
TCATAAGGTATTCCCTGCCCACTCAGGGTTTTTGTGAAGACAATACATGTAGAAGTTTGGTGTCAATGCCTGGTAAACTTGAGAGATAGGCCAAGTATTTCCCATGATGATCAGCATTCTCCACTCTC
TGTTGACTTGTGTGGGTTGTTCCAGCAGACCTCTGACCCAGCTTCTGGTCATGTGTGTTCAACGGGAGCCTCAGTAGATGGAGAGAGGGAGAAGGAACATGTGTTCTGTAGGCAGTCACAGTGGGCCG
CCCTGCCAGGCTGTCTTCTCAGTAAACATATTTATTCTCAGGTTTCTAGAATGGTCTCTTCTCCTTGCCCCAGCACTGGTATTTGTGTGACACTGGAGTACTTACTGTCTGTGGTCTCTT

hide sequence

RefSeq Acc Id:

XM_039097039 ⟹ XP_038952967

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	27,606,276 - 27,612,544 (-)	NCBI
mRatBN7.2	18	27,332,188 - 27,338,345 (-)	NCBI


Protein RefSeqs	NP_001102592	(Get FASTA)	NCBI Sequence Viewer
	XP_038952967	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AEM66211	(Get FASTA)	NCBI Sequence Viewer
	EDL76277	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000063348
GenBank Protein	F1M391	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001102592 ⟸ NM_001109122

- UniProtKB:

F1M391 (UniProtKB/TrEMBL), I3P832 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MPYSNLHPSIPRPRSYRFKLAAFVLLVGSLMSLWMTGEPPSHTLHYLALHVASQQLGLLLKKLCCLAEELCHVQSRYQGSYWKAVRACVGSPICFMALILLSFYFYCSLENTSDLRLAWHLGILVLSK
SLSMTLDLQSLAPAEVSAVCEEKNFNVAHGLAWSYYIGYLKLILPGLQARIRMFNQLHNNMLSGAGSRRLYILFPLDCGVPDDLSVADPNIRFRDMLPQQNTDRAGVKNRAYSNSVYELLENGQPAGA
CILEYATPLQTLFAMSQDGKAGFSREDRLEQAKLFCRTLEEILADVPESRNHCRLIVYQESEEGNSFSLSQEVLRHIRQEEKEEVTMSGPPTSVAPRPSLLSQEPRLLISGMEQPLPLRTDLI

hide sequence

Ensembl Acc Id:

ENSRNOP00000063348 ⟸ ENSRNOT00000068386

RefSeq Acc Id:	XP_038952967 ⟸ XM_039097039
- Peptide Label:	isoform X1
- UniProtKB:	I3P832 (UniProtKB/TrEMBL)

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-F1M391-F1-model_v2	AlphaFold	F1M391	1-379	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13700715

Promoter ID:

EPDNEW_R11239

Type:

multiple initiation site

Name:

Tmem173_1

Description:

transmembrane protein 173

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	18	28,535,782 - 28,535,842	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-7894	BioCyc
Ensembl Genes	ENSRNOG00000042137	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000068386	ENTREZGENE
Gene3D-CATH	1.20.5.5200	UniProtKB/Swiss-Prot
	3.40.50.12100	UniProtKB/Swiss-Prot
InterPro	STING	UniProtKB/Swiss-Prot
	STING_C_chordates	UniProtKB/Swiss-Prot
	STING_C_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:498840	UniProtKB/Swiss-Prot
NCBI Gene	498840	ENTREZGENE
PANTHER	PTHR34339	UniProtKB/Swiss-Prot
	STIMULATOR OF INTERFERON GENES PROTEIN	UniProtKB/Swiss-Prot
Pfam	TMEM173	UniProtKB/Swiss-Prot
PhenoGen	Sting1	PhenoGen
RatGTEx	ENSRNOG00000042137	RatGTEx
UniProt	A0A8L2QV42_RAT	UniProtKB/TrEMBL
	F1M391	ENTREZGENE
	I3P832	ENTREZGENE, UniProtKB/TrEMBL
	STING_RAT	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2019-09-13	Sting1	stimulator of interferon response cGAMP interactor 1	Tmem173	transmembrane protein 173	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-10-12	Tmem173	transmembrane protein 173	RGD1562552	similar to hypothetical protein LOC340061	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	RGD1562552	similar to hypothetical protein LOC340061	RGD1562552_predicted	similar to hypothetical protein LOC340061 (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-07	RGD1562552_predicted	similar to hypothetical protein LOC340061 (predicted)	LOC498840	similar to hypothetical protein LOC340061	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC498840	similar to hypothetical protein LOC340061			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM