Symbol:
Tomm70a
Name:
translocase of outer mitochondrial membrane 70A
RGD ID:
1551718
MGI Page
MGI
Description:
Predicted to enable mitochondrion targeting sequence binding activity and molecular adaptor activity. Predicted to contribute to protein transmembrane transporter activity. Predicted to be involved in several processes, including cellular response to virus; protein targeting to mitochondrion; and regulation of defense response. Located in mitochondrion. Is expressed in several structures, including alimentary system; brain; genitourinary system; respiratory system; and sensory organ. Human ortholog(s) of this gene implicated in congestive heart failure. Orthologous to human TOMM70 (translocase of outer mitochondrial membrane 70).
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
2610044B22Rik; D16Ium2; D16Ium22; D16Ium22e; D16Wsu109; D16Wsu109e; mitochondrial import receptor subunit TOM70; mitochondrial precursor proteins import receptor; mKIAA0719; Tom7; Tom70; Tomm7; Tomm70; translocase of outer membrane 70 kDa subunit; translocase of outer mitochondrial membrane 70 homolog A; translocase of outer mitochondrial membrane 70 homolog A (yeast); translocase of outer mitochondrial membrane protein 70
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 16 56,942,077 - 56,974,893 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 16 56,942,066 - 56,977,068 (+) Ensembl GRCm39 Ensembl GRCm38 16 57,121,714 - 57,154,530 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 16 57,121,703 - 57,156,705 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 16 57,121,827 - 57,154,643 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 16 57,043,073 - 57,075,889 (+) NCBI MGSCv36 mm8 Celera 16 57,455,013 - 57,487,868 (+) NCBI Celera Cytogenetic Map 16 C1.1 NCBI cM Map 16 34.22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Tomm70a Mouse (1->4)-beta-D-glucan multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of TOMM70A mRNA CTD PMID:36331819 Tomm70a Mouse (S)-nicotine increases expression EXP 6480464 Nicotine results in increased expression of TOMM70A mRNA CTD PMID:21955143 Tomm70a Mouse 1,2-dichloroethane decreases expression EXP 6480464 ethylene dichloride results in decreased expression of TOMM70A mRNA CTD PMID:28960355 Tomm70a Mouse 1,2-dimethylhydrazine decreases expression EXP 6480464 1 and 2-Dimethylhydrazine results in decreased expression of TOMM70A mRNA CTD PMID:22206623 Tomm70a Mouse 1,2-dimethylhydrazine multiple interactions EXP 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of TOMM70A mRNA CTD PMID:22206623 Tomm70a Mouse 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of TOMM70A mRNA CTD PMID:17942748 Tomm70a Mouse 17alpha-ethynylestradiol multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of TOMM70A mRNA CTD PMID:17942748 Tomm70a Mouse 17beta-estradiol multiple interactions ISO TOMM70 (Homo sapiens) 6480464 Estradiol promotes the reaction [TOMM70A protein binds to ESR1 protein] CTD PMID:27156127 Tomm70a Mouse 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of TOMM70A mRNA CTD PMID:39298647 Tomm70a Mouse 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of TOMM70A mRNA CTD PMID:17942748 Tomm70a Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of TOMM70A mRNA CTD PMID:17942748 Tomm70a Mouse 2,4-dinitrotoluene affects expression ISO Tomm70 (Rattus norvegicus) 6480464 2 and 4-dinitrotoluene affects the expression of TOMM70 mRNA CTD PMID:21346803 Tomm70a Mouse 2,6-dinitrotoluene affects expression ISO Tomm70 (Rattus norvegicus) 6480464 2 and 6-dinitrotoluene affects the expression of TOMM70 mRNA CTD PMID:21346803 Tomm70a Mouse 3-chloropropane-1,2-diol increases expression ISO Tomm70 (Rattus norvegicus) 6480464 alpha-Chlorohydrin results in increased expression of TOMM70 protein CTD PMID:34915118 Tomm70a Mouse 4,4'-sulfonyldiphenol increases expression EXP 6480464 bisphenol S results in increased expression of TOMM70A mRNA CTD PMID:39298647 Tomm70a Mouse acetamide decreases expression ISO Tomm70 (Rattus norvegicus) 6480464 acetamide results in decreased expression of TOMM70 mRNA CTD PMID:31881176 Tomm70a Mouse aflatoxin B1 decreases expression EXP 6480464 Aflatoxin B1 results in decreased expression of TOMM70A mRNA CTD PMID:19770486 Tomm70a Mouse aflatoxin B1 decreases methylation ISO TOMM70 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of TOMM70A gene CTD PMID:27153756 Tomm70a Mouse all-trans-retinoic acid decreases expression EXP 6480464 Tretinoin results in decreased expression of TOMM70A mRNA CTD PMID:16169686 Tomm70a Mouse all-trans-retinoic acid decreases expression ISO TOMM70 (Homo sapiens) 6480464 Tretinoin results in decreased expression of TOMM70A mRNA CTD PMID:33167477 Tomm70a Mouse arsane multiple interactions ISO TOMM70 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of TOMM70 mRNA CTD PMID:39836092 Tomm70a Mouse arsenic atom multiple interactions ISO TOMM70 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of TOMM70 mRNA CTD PMID:39836092 Tomm70a Mouse atrazine increases expression ISO TOMM70 (Homo sapiens) 6480464 Atrazine results in increased expression of TOMM70 mRNA CTD PMID:22378314 Tomm70a Mouse benzo[a]pyrene multiple interactions EXP 6480464 Benzo(a)pyrene promotes the reaction [AHR protein binds to TOMM70A promoter] CTD PMID:19654925 Tomm70a Mouse benzo[a]pyrene affects methylation ISO TOMM70 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of TOMM70A intron CTD PMID:30157460 Tomm70a Mouse benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of TOMM70A mRNA CTD PMID:19770486 and PMID:22228805 Tomm70a Mouse benzo[a]pyrene diol epoxide I decreases expression ISO TOMM70 (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 Tomm70a Mouse bisphenol A increases expression ISO Tomm70 (Rattus norvegicus) 6480464 bisphenol A results in increased expression of TOMM70 mRNA and bisphenol A results in increased expression of TOMM70A mRNA CTD PMID:25181051 and PMID:32145629 Tomm70a Mouse bisphenol A increases expression ISO TOMM70 (Homo sapiens) 6480464 bisphenol A results in increased expression of TOMM70 protein CTD PMID:37567409 Tomm70a Mouse bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of TOMM70A mRNA CTD PMID:33221593 Tomm70a Mouse bisphenol A decreases expression ISO Tomm70 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of TOMM70 mRNA CTD PMID:30816183 and PMID:34947998 Tomm70a Mouse bisphenol A affects methylation EXP 6480464 bisphenol A affects the methylation of TOMM70A promoter CTD PMID:27334623 Tomm70a Mouse bisphenol AF increases expression ISO TOMM70 (Homo sapiens) 6480464 bisphenol AF results in increased expression of TOMM70 protein CTD PMID:34186270 Tomm70a Mouse Bisphenol B increases expression ISO TOMM70 (Homo sapiens) 6480464 bisphenol B results in increased expression of TOMM70 protein CTD PMID:34186270 Tomm70a Mouse cadmium atom multiple interactions ISO TOMM70 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of TOMM70 mRNA CTD PMID:35301059 Tomm70a Mouse cadmium atom multiple interactions EXP 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of TOMM70A mRNA CTD PMID:37325564 Tomm70a Mouse cadmium dichloride decreases expression ISO Tomm70 (Rattus norvegicus) 6480464 Cadmium Chloride results in decreased expression of TOMM70 mRNA CTD PMID:33453195 Tomm70a Mouse cadmium dichloride multiple interactions EXP 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of TOMM70A mRNA CTD PMID:37325564 Tomm70a Mouse cadmium dichloride multiple interactions ISO TOMM70 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of TOMM70 mRNA CTD PMID:35301059 Tomm70a Mouse cadmium dichloride decreases expression ISO TOMM70 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of TOMM70 mRNA CTD PMID:38568856 Tomm70a Mouse caffeine affects phosphorylation ISO TOMM70 (Homo sapiens) 6480464 Caffeine affects the phosphorylation of TOMM70 protein CTD PMID:35688186 Tomm70a Mouse CGP 52608 multiple interactions ISO TOMM70 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to TOMM70A gene] CTD PMID:28238834 Tomm70a Mouse chlorpyrifos decreases expression EXP 6480464 Chlorpyrifos results in decreased expression of TOMM70A mRNA CTD PMID:37019170 Tomm70a Mouse chromium(6+) multiple interactions ISO TOMM70 (Homo sapiens) 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in increased expression of TOMM70 mRNA CTD PMID:38479592 Tomm70a Mouse clofibrate multiple interactions EXP 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of TOMM70A mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of TOMM70A mRNA] CTD PMID:17585979 Tomm70a Mouse clofibrate increases expression EXP 6480464 Clofibrate results in increased expression of TOMM70A mRNA CTD PMID:17585979 Tomm70a Mouse cobalt dichloride increases expression ISO TOMM70 (Homo sapiens) 6480464 cobaltous chloride results in increased expression of TOMM70 mRNA CTD PMID:19376846 Tomm70a Mouse copper(II) sulfate decreases expression ISO TOMM70 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of TOMM70 mRNA CTD PMID:19549813 Tomm70a Mouse coumarin increases phosphorylation ISO TOMM70 (Homo sapiens) 6480464 coumarin results in increased phosphorylation of TOMM70 protein CTD PMID:35688186 Tomm70a Mouse deoxynivalenol increases phosphorylation EXP 6480464 deoxynivalenol results in increased phosphorylation of TOMM70A protein CTD PMID:23352502 Tomm70a Mouse deoxynivalenol decreases expression ISO TOMM70 (Homo sapiens) 6480464 deoxynivalenol results in decreased expression of TOMM70A protein CTD PMID:33890134 Tomm70a Mouse dibutyl phthalate increases expression ISO Tomm70 (Rattus norvegicus) 6480464 Dibutyl Phthalate results in increased expression of TOMM70 mRNA CTD PMID:21266533 Tomm70a Mouse dicrotophos decreases expression ISO TOMM70 (Homo sapiens) 6480464 dicrotophos results in decreased expression of TOMM70A mRNA CTD PMID:28302478 Tomm70a Mouse dioxygen multiple interactions EXP 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of TOMM70A mRNA CTD PMID:30529165 Tomm70a Mouse enzyme inhibitor multiple interactions ISO TOMM70 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of TOMM70 protein CTD PMID:23301498 Tomm70a Mouse ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of TOMM70A mRNA CTD PMID:21955143 Tomm70a Mouse ethanol affects splicing EXP 6480464 Ethanol affects the splicing of TOMM70A mRNA CTD PMID:30319688 Tomm70a Mouse flutamide increases expression ISO Tomm70 (Rattus norvegicus) 6480464 Flutamide results in increased expression of TOMM70A mRNA CTD PMID:24136188 Tomm70a Mouse folic acid multiple interactions EXP 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of TOMM70A mRNA CTD PMID:22206623 Tomm70a Mouse folic acid decreases expression EXP 6480464 Folic Acid results in decreased expression of TOMM70A mRNA CTD PMID:25629700 Tomm70a Mouse FR900359 affects phosphorylation ISO TOMM70 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of TOMM70 protein CTD PMID:37730182 Tomm70a Mouse furfural multiple interactions ISO TOMM70 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of TOMM70 protein CTD PMID:38598786 Tomm70a Mouse gentamycin increases expression ISO Tomm70 (Rattus norvegicus) 6480464 Gentamicins results in increased expression of TOM70 mRNA CTD PMID:22061828 Tomm70a Mouse isotretinoin decreases expression ISO TOMM70 (Homo sapiens) 6480464 Isotretinoin results in decreased expression of TOMM70 mRNA CTD PMID:20436886 Tomm70a Mouse ivermectin decreases expression ISO TOMM70 (Homo sapiens) 6480464 Ivermectin results in decreased expression of TOMM70 protein CTD PMID:32959892 Tomm70a Mouse manganese atom multiple interactions ISO TOMM70 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of TOMM70 mRNA CTD PMID:39836092 Tomm70a Mouse manganese(0) multiple interactions ISO TOMM70 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of TOMM70 mRNA CTD PMID:39836092 Tomm70a Mouse manganese(II) chloride multiple interactions ISO TOMM70 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of TOMM70 mRNA CTD PMID:39836092 Tomm70a Mouse morphine decreases expression EXP 6480464 Morphine results in decreased expression of TOMM70A mRNA CTD PMID:21955143 Tomm70a Mouse nefazodone increases expression ISO Tomm70 (Rattus norvegicus) 6480464 nefazodone results in increased expression of TOMM70A mRNA CTD PMID:24136188 Tomm70a Mouse nicotine increases expression EXP 6480464 Nicotine results in increased expression of TOMM70A mRNA CTD PMID:21955143 Tomm70a Mouse nitrates multiple interactions EXP 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of TOMM70A mRNA CTD PMID:35964746 Tomm70a Mouse ochratoxin A decreases expression ISO TOMM70 (Homo sapiens) 6480464 ochratoxin A results in decreased expression of TOMM70 protein CTD PMID:26861962 Tomm70a Mouse paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of TOMM70A mRNA CTD PMID:17562736 Tomm70a Mouse paracetamol decreases expression ISO TOMM70 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of TOMM70 mRNA CTD PMID:25704631 Tomm70a Mouse paracetamol multiple interactions EXP 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of TOMM70A mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of TOMM70A mRNA] CTD PMID:17585979 Tomm70a Mouse paraquat increases expression ISO Tomm70 (Rattus norvegicus) 6480464 Paraquat results in increased expression of TOMM70 mRNA CTD PMID:32680482 Tomm70a Mouse perfluorooctane-1-sulfonic acid multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of TOMM70A mRNA CTD PMID:36331819 Tomm70a Mouse phenobarbital decreases expression EXP 6480464 Phenobarbital results in decreased expression of TOMM70A mRNA and Phenobarbital results in decreased expression of TOMM70A protein CTD PMID:19363144 and PMID:35881160 Tomm70a Mouse phenobarbital increases expression ISO TOMM70 (Homo sapiens) 6480464 Phenobarbital results in increased expression of TOMM70 protein CTD PMID:35881160 Tomm70a Mouse pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of TOMM70A mRNA CTD PMID:17426115 more ... Tomm70a Mouse resveratrol increases expression EXP 6480464 resveratrol results in increased expression of TOMM70A protein CTD PMID:25505154 Tomm70a Mouse resveratrol multiple interactions ISO TOMM70 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of TOMM70 mRNA CTD PMID:23557933 Tomm70a Mouse rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of TOMM70A mRNA CTD PMID:23186747 Tomm70a Mouse rotenone decreases expression ISO TOMM70 (Homo sapiens) 6480464 Rotenone results in decreased expression of TOMM70 mRNA CTD PMID:33512557 Tomm70a Mouse SB 431542 multiple interactions ISO TOMM70 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in decreased expression of TOMM70 protein CTD PMID:37664457 Tomm70a Mouse sodium arsenite multiple interactions ISO TOMM70 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of TOMM70 mRNA CTD PMID:39836092 Tomm70a Mouse sodium chloride multiple interactions ISO TOMM70 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of TOMM70 protein CTD PMID:38598786 Tomm70a Mouse Soman increases expression ISO Tomm70 (Rattus norvegicus) 6480464 Soman results in increased expression of TOMM70 mRNA CTD PMID:19281266 Tomm70a Mouse tebufenpyrad decreases expression ISO TOMM70 (Homo sapiens) 6480464 4-chloro-N-((4-(1 and 1-dimethylethyl)phenyl)methyl)-3-ethyl-1-methyl-1H-pyrazole-5-carboxamide results in decreased expression of TOMM70 mRNA CTD PMID:33512557 Tomm70a Mouse tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of TOMM70A mRNA CTD PMID:31919559 Tomm70a Mouse thioacetamide increases expression ISO Tomm70 (Rattus norvegicus) 6480464 Thioacetamide results in increased expression of TOMM70 mRNA CTD PMID:34492290 Tomm70a Mouse titanium dioxide increases methylation EXP 6480464 titanium dioxide results in increased methylation of TOMM70A gene CTD PMID:35295148 Tomm70a Mouse trimellitic anhydride increases expression EXP 6480464 trimellitic anhydride results in increased expression of TOMM70A mRNA CTD PMID:19042947 Tomm70a Mouse triphenyl phosphate affects expression ISO Tomm70 (Rattus norvegicus) 6480464 triphenyl phosphate affects the expression of TOMM70A mRNA CTD PMID:30589522 Tomm70a Mouse triphenyl phosphate affects expression ISO TOMM70 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of TOMM70 mRNA CTD PMID:37042841 Tomm70a Mouse trovafloxacin decreases expression ISO Tomm70 (Rattus norvegicus) 6480464 trovafloxacin results in decreased expression of TOMM70A mRNA CTD PMID:24136188 Tomm70a Mouse valproic acid decreases expression ISO TOMM70 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of TOMM70 mRNA and Valproic Acid results in decreased expression of TOMM70A mRNA CTD PMID:23179753 and PMID:27188386 Tomm70a Mouse valproic acid affects splicing ISO Tomm70 (Rattus norvegicus) 6480464 Valproic Acid affects the splicing of TOMM70A mRNA CTD PMID:29427782 Tomm70a Mouse vincristine decreases expression ISO TOMM70 (Homo sapiens) 6480464 Vincristine results in decreased expression of TOMM70 mRNA CTD PMID:23649840 Tomm70a Mouse zearalenone increases expression EXP 6480464 Zearalenone results in increased expression of TOMM70A protein CTD PMID:25058043
(1->4)-beta-D-glucan (EXP) (S)-nicotine (EXP) 1,2-dichloroethane (EXP) 1,2-dimethylhydrazine (EXP) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,4-dinitrotoluene (ISO) 2,6-dinitrotoluene (ISO) 3-chloropropane-1,2-diol (ISO) 4,4'-sulfonyldiphenol (EXP) acetamide (ISO) aflatoxin B1 (EXP,ISO) all-trans-retinoic acid (EXP,ISO) arsane (ISO) arsenic atom (ISO) atrazine (ISO) benzo[a]pyrene (EXP,ISO) benzo[a]pyrene diol epoxide I (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) cadmium atom (EXP,ISO) cadmium dichloride (EXP,ISO) caffeine (ISO) CGP 52608 (ISO) chlorpyrifos (EXP) chromium(6+) (ISO) clofibrate (EXP) cobalt dichloride (ISO) copper(II) sulfate (ISO) coumarin (ISO) deoxynivalenol (EXP,ISO) dibutyl phthalate (ISO) dicrotophos (ISO) dioxygen (EXP) enzyme inhibitor (ISO) ethanol (EXP) flutamide (ISO) folic acid (EXP) FR900359 (ISO) furfural (ISO) gentamycin (ISO) isotretinoin (ISO) ivermectin (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) morphine (EXP) nefazodone (ISO) nicotine (EXP) nitrates (EXP) ochratoxin A (ISO) paracetamol (EXP,ISO) paraquat (ISO) perfluorooctane-1-sulfonic acid (EXP) phenobarbital (EXP,ISO) pirinixic acid (EXP) resveratrol (EXP,ISO) rotenone (EXP,ISO) SB 431542 (ISO) sodium arsenite (ISO) sodium chloride (ISO) Soman (ISO) tebufenpyrad (ISO) tetrachloromethane (EXP) thioacetamide (ISO) titanium dioxide (EXP) trimellitic anhydride (EXP) triphenyl phosphate (ISO) trovafloxacin (ISO) valproic acid (ISO) vincristine (ISO) zearalenone (EXP)
1.
Identification of a mammalian homologue of the fungal Tom70 mitochondrial precursor protein import receptor as a thyroid hormone-regulated gene in specific brain regions.
Alvarez-Dolado M, etal., J Neurochem. 1999 Dec;73(6):2240-9.
2.
Biogenesis of mitochondrial outer membrane proteins, problems and diseases.
Ellenrieder L, etal., Biol Chem. 2015 Oct 1;396(11):1199-213. doi: 10.1515/hsz-2015-0170.
3.
Phosphoproteome mapping of cardiomyocyte mitochondria in a rat model of heart failure.
Giorgianni F, etal., Mol Cell Biochem. 2014 Apr;389(1-2):159-67. doi: 10.1007/s11010-013-1937-7. Epub 2014 Jan 7.
4.
Assembly of beta-barrel proteins in the mitochondrial outer membrane.
Hohr AI, etal., Biochim Biophys Acta. 2015 Jan;1853(1):74-88. doi: 10.1016/j.bbamcr.2014.10.006. Epub 2014 Oct 8.
5.
Functional annotation of a full-length mouse cDNA collection.
Kawai J, etal., Nature. 2001 Feb 8;409(6821):685-90.
6.
Genome-wide mapping of unselected transcripts from extraembryonic tissue of 7.5-day mouse embryos reveals enrichment in the t-complex and under-representation on the X chromosome.
Ko MS, etal., Hum Mol Genet 1998 Nov;7(12):1967-78.
7.
Tom70 serves as a molecular switch to determine pathological cardiac hypertrophy.
Li J, etal., Cell Res. 2014 Aug;24(8):977-93. doi: 10.1038/cr.2014.94. Epub 2014 Jul 15.
8.
MGDs mouse GO annotations
MGD data from the GO Consortium
9.
Integrated analysis of protein composition, tissue diversity, and gene regulation in mouse mitochondria.
Mootha VK, etal., Cell 2003 Nov 26;115(5):629-40.
10.
Prediction of the coding sequences of mouse homologues of KIAA gene: II. The complete nucleotide sequences of 400 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries.
Okazaki N, etal., DNA Res 2003 Feb 28;10(1):35-48.
11.
Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.
Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
12.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
13.
Impaired transport of mitochondrial transcription factor A (TFAM) and the metabolic memory phenomenon associated with the progression of diabetic retinopathy.
Santos JM and Kowluru RA, Diabetes Metab Res Rev. 2013 Mar;29(3):204-13. doi: 10.1002/dmrr.2384.
14.
Unlocking the presequence import pathway.
Schulz C, etal., Trends Cell Biol. 2015 May;25(5):265-75. doi: 10.1016/j.tcb.2014.12.001. Epub 2014 Dec 23.
15.
Cooperation of protein machineries in mitochondrial protein sorting.
Wenz LS, etal., Biochim Biophys Acta. 2015 May;1853(5):1119-29. doi: 10.1016/j.bbamcr.2015.01.012. Epub 2015 Jan 26.
Tomm70a Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 16 56,942,077 - 56,974,893 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 16 56,942,066 - 56,977,068 (+) Ensembl GRCm39 Ensembl GRCm38 16 57,121,714 - 57,154,530 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 16 57,121,703 - 57,156,705 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 16 57,121,827 - 57,154,643 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 16 57,043,073 - 57,075,889 (+) NCBI MGSCv36 mm8 Celera 16 57,455,013 - 57,487,868 (+) NCBI Celera Cytogenetic Map 16 C1.1 NCBI cM Map 16 34.22 NCBI
TOMM70 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 100,363,431 - 100,401,089 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 100,363,431 - 100,401,089 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 100,082,275 - 100,119,933 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 101,564,997 - 101,602,915 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 3 101,564,998 - 101,602,915 NCBI Celera 3 98,473,164 - 98,511,084 (-) NCBI Celera Cytogenetic Map 3 q12.2 NCBI HuRef 3 97,450,096 - 97,488,049 (-) NCBI HuRef CHM1_1 3 100,045,331 - 100,083,272 (-) NCBI CHM1_1 T2T-CHM13v2.0 3 103,068,774 - 103,106,448 (-) NCBI T2T-CHM13v2.0
Tomm70 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 11 56,847,837 - 56,886,302 (-) NCBI GRCr8 mRatBN7.2 11 43,378,719 - 43,417,166 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 11 43,377,216 - 43,417,202 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 11 52,153,913 - 52,192,339 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 11 44,815,517 - 44,853,943 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 11 43,939,611 - 43,978,037 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 11 45,477,053 - 45,511,409 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 11 45,480,250 - 45,510,961 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 11 48,669,804 - 48,706,365 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 11 44,302,535 - 44,341,250 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 11 44,360,417 - 44,398,702 (-) NCBI Celera 11 43,168,344 - 43,206,551 (-) NCBI Celera Cytogenetic Map 11 q12 NCBI
Tomm70 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955427 1,876,222 - 1,908,737 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955427 1,874,277 - 1,908,245 (-) NCBI ChiLan1.0 ChiLan1.0
TOMM70 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 98,306,633 - 98,344,497 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 98,311,415 - 98,348,981 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 97,459,180 - 97,497,175 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 104,139,473 - 104,177,061 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 3 104,139,473 - 104,178,074 (-) Ensembl panpan1.1 panPan2
TOMM70 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 33 6,976,322 - 7,009,618 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 33 6,976,934 - 7,009,594 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 33 7,130,612 - 7,165,083 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 33 7,114,093 - 7,148,576 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 33 7,114,753 - 7,148,568 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 33 7,001,694 - 7,036,139 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 33 7,050,040 - 7,084,498 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 33 7,379,916 - 7,414,382 (-) NCBI UU_Cfam_GSD_1.0
Tomm70 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 150,008,687 - 150,042,592 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936630 2,906,581 - 2,940,608 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936630 2,906,573 - 2,938,837 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
TOMM70 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 158,577,379 - 158,628,262 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 158,577,026 - 158,629,878 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 168,193,917 - 168,218,856 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TOMM70 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 22 80,477,429 - 80,516,536 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 22 80,477,872 - 80,516,670 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666041 86,056,352 - 86,094,501 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Tomm70
.
Predicted Target Of
Count of predictions: 414 Count of miRNA genes: 325 Interacting mature miRNAs: 351 Transcripts: ENSMUST00000166897 Prediction methods: Miranda Result types: miRGate_prediction
11059560 Lmr12b_m leishmaniasis resistance 12b (mouse) 16 28792813 62792952 Mouse 1301138 Pcd4ts3_m p-glycoprotein positive CD4 T cell subset 3 (mouse) Not determined 16 40593923 74594076 Mouse 1301394 Eae11_m susceptibility to experimental allergic encephalomyelitis 11 (mouse) Not determined 16 53561891 87562035 Mouse 26884376 Skwq4_m skull length QTL 4, 5 week (mouse) 16 8417864 90896888 Mouse 1302096 Aod1a_m autoimmune ovarian dysgenesis 1a (mouse) Not determined 16 35446643 92573008 Mouse 4141179 Ipng3_m imprinted postnatal growth 3 (mouse) Not determined 22775252 57594076 Mouse 1301719 Remslp3_m rapid eye movement sleep 3 (mouse) Not determined 16 44383350 78383506 Mouse 1357778 Diobq_m diet-induced obesity QTL (mouse) Not determined 16 42197817 82331174 Mouse 14696806 Smcl1_m smoke-mediated chord length 1 (mouse) 16 54015309 58330871 Mouse 26884432 Zlq7_m zygomatic length QTL 7, 10 week (mouse) 16 3817864 64620363 Mouse 11049571 Lmr12c_m leishmaniasis resistance 12c (mouse) 16 28792813 62792952 Mouse 11059559 Lmr12a_m leishmaniasis resistance 12a (mouse) 16 28792813 62792952 Mouse 4142187 Arrd3_m age-related retinal degeneration 3 (mouse) Not determined 32522909 65466552 Mouse 11522747 Eae41_m experimental allergic encephalomyelitis susceptibility 41 (mouse) 16 40399134 78015472 Mouse 14928310 Manh80_m mandible shape 80 (mouse) 16 48219841 82219841 Mouse 1357763 Lp1_m lymphocyte proliferation 1 (mouse) Not determined 16 6542979 65466552 Mouse 1357517 Bwtn1_m body weight at necropsy 1 (mouse) Not determined 16 20019329 85600826 Mouse 26884416 Bzwq5_m bi-zygomatic width QTL 5, 5 week (mouse) 16 37320362 84696888 Mouse 1301070 Cypr1_m cytokine production 1 (mouse) Not determined 16 32312795 66312933 Mouse 4142112 Skts-fp3_m skin tumor susceptibility in FVB and PWK 3 (mouse) Not determined 16 40053881 72924385 Mouse 1300915 Lmr12_m leishmaniasis resistance 12 (mouse) Not determined 16 28792813 62792952 Mouse 4141212 Imraq3_m immune response to AAV2 QTL 3 (mouse) Not determined 16 44383350 78383506 Mouse 1558836 Dice1b_m determination of interleukin 4 commitment 1b (mouse) Not determined 16 45511000 72274485 Mouse 1301364 Lith14_m lithogenic gene 14 (mouse) Not determined 16 55661846 89661961 Mouse 27226785 Feml12_m femur length 12, 5 week (mouse) 16 3317864 64620363 Mouse
Tomm70a
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 16 C1.1 UniSTS
RH125842
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 16 57,152,725 - 57,152,974 UniSTS GRCm38 MGSCv37 16 57,152,838 - 57,153,087 UniSTS GRCm37 Celera 16 57,486,066 - 57,486,315 UniSTS Cytogenetic Map 16 C1.1 UniSTS cM Map 16 36.9 UniSTS cM Map 16 38.0 UniSTS Whitehead/MRC_RH 16 597.84 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000166897 ⟹ ENSMUSP00000129186
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 16 56,942,066 - 56,977,068 (+) Ensembl GRCm38.p6 Ensembl 16 57,121,703 - 57,156,705 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000231298
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 16 56,957,861 - 56,962,030 (+) Ensembl GRCm38.p6 Ensembl 16 57,137,498 - 57,141,667 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000231901
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 16 56,973,623 - 56,976,248 (+) Ensembl GRCm38.p6 Ensembl 16 57,153,260 - 57,155,885 (+) Ensembl
RefSeq Acc Id:
NM_138599 ⟹ NP_613065
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 16 56,942,077 - 56,974,893 (+) NCBI GRCm38 16 57,121,714 - 57,154,530 (+) ENTREZGENE MGSCv37 16 57,121,827 - 57,154,643 (+) RGD Celera 16 57,455,013 - 57,487,868 (+) RGD cM Map 16 ENTREZGENE
Sequence:
GACCTCTGGCCCTTTTCTGTCGTCCGCTCCTGCTGCTTAGCGTGCTCGCTCGCGCGTTGCTTTCCCTCCACGCTCCCGGCTTCCTCCCCACGCTGCCCGGTGACCGTGGCGCCCGCGACCGGCGCGGC
hide sequence
RefSeq Acc Id:
NP_613065 ⟸ NM_138599
- UniProtKB:
Q8BNI6 (UniProtKB/Swiss-Prot), Q9CZW5 (UniProtKB/Swiss-Prot), Q3TSX8 (UniProtKB/TrEMBL)
- Sequence:
MAASKPIEAAMAAAAAPGSGNGVGGGGGTAGPGSGAGTLPRWHVALAIGAPLLLGAGAMYLWSRRRRRREAGGRGDASGLKRNSERKTPEGRASPALGSGHHDGSGDSLEMSSLDRAQAAKNKGNKYF
hide sequence
Ensembl Acc Id:
ENSMUSP00000129186 ⟸ ENSMUST00000166897
RGD ID: 6827581 Promoter ID: MM_KWN:21273 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day4, 3T3L1_Day6, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen Transcripts: ENSMUST00000023433 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 16 57,121,341 - 57,122,312 (+) MPROMDB
RGD ID: 8686398 Promoter ID: EPDNEW_M21229 Type: initiation region Name: Tomm70a_1 Description: Mus musculus translocase of outer mitochondrial membrane 70A, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 16 57,121,735 - 57,121,795 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2018-03-27
Tomm70a
translocase of outer mitochondrial membrane 70A
translocase of outer mitochondrial membrane 70 homolog A (yeast)
Symbol and/or name change
5135510 APPROVED
