Symbol:
PTPN1
Name:
protein tyrosine phosphatase non-receptor type 1
RGD ID:
1343639
HGNC Page
HGNC:9642
Description:
Enables protein tyrosine phosphatase activity; signaling receptor binding activity; and zinc ion binding activity. Involved in several processes, including positive regulation of receptor catabolic process; regulation of protein kinase activity; and regulation of signal transduction. Located in several cellular components, including cytoplasmic side of endoplasmic reticulum membrane; cytosol; and early endosome. Part of protein-containing complex. Implicated in coronary artery disease; essential hypertension; and type 2 diabetes mellitus. Biomarker of diabetes mellitus and proliferative diabetic retinopathy.
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
protein tyrosine phosphatase 1B; protein tyrosine phosphatase, placental; protein-tyrosine phosphatase 1B; PTP1B; tyrosine-protein phosphatase non-receptor type 1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Mus musculus (house mouse):
Ptpn1 (protein tyrosine phosphatase, non-receptor type 1) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Ptpn1 (protein tyrosine phosphatase, non-receptor type 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Chinchilla lanigera (long-tailed chinchilla):
Ptpn1 (protein tyrosine phosphatase non-receptor type 1) NCBI
Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):
PTPN1 (protein tyrosine phosphatase non-receptor type 1) NCBI
Ortholog
Canis lupus familiaris (dog):
PTPN1 (protein tyrosine phosphatase non-receptor type 1) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Ptpn1 (protein tyrosine phosphatase non-receptor type 1) NCBI
Ortholog
Sus scrofa (pig):
PTPN1 (protein tyrosine phosphatase non-receptor type 1) HGNC
Ensembl, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Chlorocebus sabaeus (green monkey):
PTPN1 (protein tyrosine phosphatase non-receptor type 1) NCBI
Ortholog
Heterocephalus glaber (naked mole-rat):
Ptpn1 (protein tyrosine phosphatase non-receptor type 1) NCBI
Ortholog
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Ptpn1 (protein tyrosine phosphatase, non-receptor type 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Ptpn1 (protein tyrosine phosphatase, non-receptor type 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
ptpn1 (protein tyrosine phosphatase, non-receptor type 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|PANTHER|PhylomeDB|ZFIN)
Saccharomyces cerevisiae (baker's yeast):
PTP1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|SonicParanoid)
Drosophila melanogaster (fruit fly):
Ptp61F
Alliance
DIOPT (Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
sdf-9
Alliance
DIOPT (Ensembl Compara|OMA)
Xenopus laevis (African clawed frog):
ptpn1.S
Alliance
DIOPT (Xenbase)
Xenopus tropicalis (tropical clawed frog):
ptpn1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Xenopus laevis (African clawed frog):
ptpn1.L
Alliance
DIOPT (Xenbase)
Allele / Splice:
See ClinVar data
Latest Assembly:
GRCh38 - Human Genome Assembly GRCh38
Position:
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 20 50,510,383 - 50,585,241 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 20 50,510,321 - 50,585,241 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 20 49,126,920 - 49,201,778 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 20 48,560,298 - 48,634,495 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 20 48,560,297 - 48,634,491 NCBI Celera 20 45,831,156 - 45,905,376 (+) NCBI Celera Cytogenetic Map 20 q13.13 NCBI HuRef 20 45,875,585 - 45,950,061 (+) NCBI HuRef CHM1_1 20 49,031,996 - 49,106,433 (+) NCBI CHM1_1 T2T-CHM13v2.0 20 52,280,015 - 52,354,899 (+) NCBI T2T-CHM13v2.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
PTPN1 Human (+)-catechin multiple interactions EXP 6480464 [Catechin co-treated with Grape Seed Proanthocyanidins] results in increased expression of PTPN1 mRNA CTD PMID:24763279 PTPN1 Human 1,2-dimethylhydrazine increases expression ISO Ptpn1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of PTPN1 mRNA CTD PMID:22206623 PTPN1 Human 1,2-naphthoquinone decreases activity EXP 6480464 1 and 2-naphthoquinone results in decreased activity of PTPN1 protein CTD PMID:24067727 and PMID:33814511 PTPN1 Human 1,2-naphthoquinone multiple interactions EXP 6480464 1 more ... CTD PMID:33814511 PTPN1 Human 1,4-benzoquinone decreases activity EXP 6480464 quinone results in decreased activity of PTPN1 protein CTD PMID:33814511 PTPN1 Human 1,4-dithiothreitol multiple interactions ISO Ptpn1 (Rattus norvegicus) 6480464 Dithiothreitol inhibits the reaction [Hydrogen Peroxide results in increased glutathionylation of PTPN1 protein] CTD PMID:16781456 PTPN1 Human 1,4-dithiothreitol multiple interactions EXP 6480464 [9 more ... CTD PMID:32493877 PTPN1 Human 1,4-naphthoquinone multiple interactions EXP 6480464 1 more ... CTD PMID:33814511 PTPN1 Human 1-chloro-2,4-dinitrobenzene affects binding EXP 6480464 Dinitrochlorobenzene binds to PTPN1 protein CTD PMID:32991956 PTPN1 Human 17alpha-ethynylestradiol affects expression ISO Ptpn1 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of PTPN1 mRNA CTD PMID:17555576 PTPN1 Human 17alpha-ethynylestradiol increases expression ISO Ptpn1 (Rattus norvegicus) 6480464 Ethinyl Estradiol results in increased expression of PTPN1 mRNA CTD PMID:12075121 and PMID:12655037 PTPN1 Human 17alpha-ethynylestradiol multiple interactions ISO Ptpn1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PTPN1 mRNA CTD PMID:17942748 PTPN1 Human 17beta-estradiol affects expression EXP 6480464 Estradiol affects the expression of PTPN1 mRNA CTD PMID:22574217 PTPN1 Human 1H-[1,2,4]oxadiazolo[4,3-a]quinoxalin-1-one multiple interactions ISO Ptpn1 (Rattus norvegicus) 401965470 ODQ inhibits the reaction [SNAP increases activity of Ptpn1 protein in aortic smooth muscle cells] RGD PTPN1 Human 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Ptpn1 (Mus musculus) 6480464 [2 more ... CTD PMID:24978599 PTPN1 Human 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Ptpn1 (Mus musculus) 6480464 2 more ... CTD PMID:30294300 PTPN1 Human 2,2',5,5'-tetrachlorobiphenyl decreases expression ISO Ptpn1 (Rattus norvegicus) 6480464 2 more ... CTD PMID:23829299 PTPN1 Human 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of PTPN1 mRNA CTD PMID:12377990 PTPN1 Human 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Ptpn1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of PTPN1 mRNA CTD PMID:21570461 PTPN1 Human 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Ptpn1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PTPN1 mRNA CTD PMID:17942748 PTPN1 Human 2,3,7,8-Tetrachlorodibenzofuran decreases expression ISO Ptpn1 (Rattus norvegicus) 6480464 2 more ... CTD PMID:32109520 PTPN1 Human 2,4-dinitrotoluene affects expression ISO Ptpn1 (Rattus norvegicus) 6480464 2 and 4-dinitrotoluene affects the expression of PTPN1 mRNA CTD PMID:21346803 PTPN1 Human 2,6-dimethoxyphenol multiple interactions EXP 6480464 [Sodium Chloride co-treated with pyrogallol 1 and 3-dimethyl ether] results in increased expression of and affects the localization of PTPN1 protein CTD PMID:38598786 PTPN1 Human 2,6-dinitrotoluene affects expression ISO Ptpn1 (Rattus norvegicus) 6480464 2 and 6-dinitrotoluene affects the expression of PTPN1 mRNA CTD PMID:21346803 PTPN1 Human 2-methylcholine affects expression EXP 6480464 beta-methylcholine affects the expression of PTPN1 mRNA CTD PMID:21179406 PTPN1 Human 3,3',4,4',5-pentachlorobiphenyl increases expression ISO Ptpn1 (Rattus norvegicus) 6480464 3 more ... CTD PMID:23196670 PTPN1 Human 3,4-methylenedioxymethamphetamine increases expression ISO Ptpn1 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of PTPN1 mRNA CTD PMID:20188158 PTPN1 Human 3-chloropropane-1,2-diol increases expression ISO Ptpn1 (Rattus norvegicus) 6480464 alpha-Chlorohydrin analog results in increased expression of PTPN1 protein CTD PMID:26072098 PTPN1 Human 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO Ptpn1 (Rattus norvegicus) 6480464 [1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS protein] inhibits the reaction [TGFB1 protein results in increased expression of PTPN1 mRNA] more ... CTD PMID:26739621 PTPN1 Human 4,4'-sulfonyldiphenol decreases expression ISO Ptpn1 (Mus musculus) 6480464 bisphenol S results in decreased expression of PTPN1 mRNA CTD PMID:39298647 PTPN1 Human 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol S co-treated with Fulvestrant] results in increased methylation of PTPN1 gene CTD PMID:31601247 PTPN1 Human 4-hydroxynon-2-enal decreases expression EXP 6480464 4-hydroxy-2-nonenal results in decreased expression of PTPN1 mRNA CTD PMID:12419474 PTPN1 Human 4-hydroxyphenyl retinamide increases expression ISO Ptpn1 (Mus musculus) 6480464 Fenretinide results in increased expression of PTPN1 mRNA CTD PMID:28973697 PTPN1 Human 4-nitrophenyl phosphate multiple interactions EXP 6480464 Benzoic Acid analog inhibits the reaction [PTPN1 protein results in increased hydrolysis of nitrophenylphosphate] and Thiazolidines analog inhibits the reaction [PTPN1 protein results in increased hydrolysis of nitrophenylphosphate] CTD PMID:24287560 PTPN1 Human 4-nitrophenyl phosphate increases hydrolysis EXP 6480464 PTPN1 protein results in increased hydrolysis of nitrophenylphosphate CTD PMID:24287560 PTPN1 Human 6-propyl-2-thiouracil increases expression ISO Ptpn1 (Rattus norvegicus) 6480464 Propylthiouracil results in increased expression of PTPN1 mRNA CTD PMID:30047161 PTPN1 Human 9,10-phenanthroquinone multiple interactions EXP 6480464 [9 more ... CTD PMID:32493877 PTPN1 Human acetamide increases expression ISO Ptpn1 (Rattus norvegicus) 6480464 acetamide results in increased expression of PTPN1 mRNA CTD PMID:31881176 PTPN1 Human acrolein decreases activity EXP 6480464 Acrolein results in decreased activity of PTPN1 protein CTD PMID:17655273 PTPN1 Human acrolein multiple interactions EXP 6480464 Vanadates inhibits the reaction [Acrolein results in decreased activity of PTPN1 protein] CTD PMID:17655273 PTPN1 Human ADP increases glutathionylation ISO Ptpn1 (Rattus norvegicus) 6480464 Adenosine Diphosphate results in increased glutathionylation of PTPN1 protein CTD PMID:16781456 PTPN1 Human ADP multiple interactions ISO Ptpn1 (Rattus norvegicus) 6480464 CAT protein inhibits the reaction [Adenosine Diphosphate results in increased glutathionylation of PTPN1 protein] CTD PMID:16781456 PTPN1 Human aflatoxin B1 increases methylation EXP 6480464 Aflatoxin B1 results in increased methylation of PTPN1 intron CTD PMID:30157460 PTPN1 Human Aflatoxin B2 alpha increases methylation EXP 6480464 aflatoxin B2 results in increased methylation of PTPN1 intron CTD PMID:30157460 PTPN1 Human amitrole increases expression ISO Ptpn1 (Rattus norvegicus) 6480464 Amitrole results in increased expression of PTPN1 mRNA CTD PMID:30047161 PTPN1 Human ammonium chloride affects expression ISO Ptpn1 (Rattus norvegicus) 6480464 Ammonium Chloride affects the expression of PTPN1 mRNA CTD PMID:16483693 PTPN1 Human angiotensin II increases expression ISO Ptpn1 (Rattus norvegicus) 401976382 Angiotensin II increases expression of Ptpn1 protein in cardiac microvascular endothelial cells RGD PTPN1 Human anthranilic acid multiple interactions EXP 6480464 [oxovanadium IV binds to anthranilic acid analog] which results in decreased activity of PTPN1 protein CTD PMID:22864521 PTPN1 Human antirheumatic drug decreases expression EXP 6480464 Antirheumatic Agents results in decreased expression of PTPN1 mRNA CTD PMID:24449571 PTPN1 Human aristolochic acid A increases expression EXP 6480464 aristolochic acid I results in increased expression of PTPN1 mRNA CTD PMID:33212167 PTPN1 Human arsenous acid decreases expression EXP 6480464 Arsenic Trioxide results in decreased expression of PTPN1 mRNA CTD PMID:22521957 PTPN1 Human arsenous acid multiple interactions EXP 6480464 Acetylcysteine inhibits the reaction [Arsenic Trioxide promotes the reaction [Pamidronate results in decreased expression of and results in decreased activity of PTPN1 protein]] more ... CTD PMID:32337366 PTPN1 Human astragaloside IV increases expression ISO Ptpn1 (Rattus norvegicus) 401976390 Astragaloside IV increases expression of Ptpn1 protein in the hypothalamus RGD PTPN1 Human atrazine affects methylation ISO Ptpn1 (Rattus norvegicus) 6480464 Atrazine affects the methylation of PTPN1 gene CTD PMID:35440735 PTPN1 Human Bardoxolone methyl multiple interactions ISO Ptpn1 (Mus musculus) 6480464 bardoxolone methyl inhibits the reaction [Dietary Fats results in increased expression of PTPN1 protein] CTD PMID:27417254 PTPN1 Human benzo[a]pyrene increases expression ISO Ptpn1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of PTPN1 mRNA CTD PMID:22228805 PTPN1 Human benzo[a]pyrene affects methylation EXP 6480464 Benzo(a)pyrene affects the methylation of PTPN1 intron CTD PMID:30157460 PTPN1 Human benzo[a]pyrene diol epoxide I decreases expression EXP 6480464 7 more ... CTD PMID:19150397 PTPN1 Human benzoic acid decreases activity EXP 6480464 Benzoic Acid analog results in decreased activity of PTPN1 protein CTD PMID:24287560 PTPN1 Human benzoic acid multiple interactions EXP 6480464 Benzoic Acid analog inhibits the reaction [PTPN1 protein results in increased hydrolysis of nitrophenylphosphate] CTD PMID:24287560 PTPN1 Human bisphenol A increases expression ISO Ptpn1 (Rattus norvegicus) 6480464 bisphenol A results in increased expression of PTPN1 mRNA CTD PMID:12075121 more ... PTPN1 Human bisphenol A increases methylation ISO Ptpn1 (Rattus norvegicus) 6480464 bisphenol A results in increased methylation of PTPN1 gene CTD PMID:28505145 PTPN1 Human bisphenol F increases expression EXP 6480464 bisphenol F results in increased expression of PTPN1 protein CTD PMID:34186270 PTPN1 Human calcitriol increases expression EXP 6480464 Calcitriol results in increased expression of PTPN1 mRNA CTD PMID:16002434 PTPN1 Human carbon nanotube increases expression ISO Ptpn1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 PTPN1 Human chlordecone increases expression ISO Ptpn1 (Mus musculus) 6480464 Chlordecone results in increased expression of PTPN1 mRNA CTD PMID:29980752 PTPN1 Human chloride decreases activity EXP 401976384 Chloride decreases activity of PTPN1 protein in endothelial cell of umbilical vein RGD PTPN1 Human chloropicrin increases expression EXP 6480464 chloropicrin results in increased expression of PTPN1 mRNA CTD PMID:26352163 PTPN1 Human chromium atom multiple interactions ISO Ptpn1 (Rattus norvegicus) 6480464 Chromium results in decreased expression of and results in decreased activity of PTPN1 protein CTD PMID:16424121 PTPN1 Human copper atom decreases activity EXP 6480464 Copper results in decreased activity of PTPN1 protein CTD PMID:20383386 PTPN1 Human copper(0) decreases activity EXP 6480464 Copper results in decreased activity of PTPN1 protein CTD PMID:20383386 PTPN1 Human copper(II) chloride increases expression EXP 6480464 cupric chloride results in increased expression of PTPN1 mRNA CTD PMID:38568856 PTPN1 Human coumestrol decreases expression EXP 6480464 Coumestrol results in decreased expression of PTPN1 mRNA CTD PMID:19167446 PTPN1 Human Cryptotanshinone decreases activity EXP 6480464 cryptotanshinone results in decreased activity of PTPN1 protein CTD PMID:29031618 PTPN1 Human Cuprizon decreases expression ISO Ptpn1 (Rattus norvegicus) 6480464 Cuprizone results in decreased expression of PTPN1 mRNA CTD PMID:26577399 PTPN1 Human decabromodiphenyl ether increases expression ISO Ptpn1 (Rattus norvegicus) 6480464 decabromobiphenyl ether results in increased expression of PTPN1 mRNA CTD PMID:23640034 PTPN1 Human dexamethasone multiple interactions ISO Ptpn1 (Rattus norvegicus) 6480464 [1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS protein] inhibits the reaction [TGFB1 protein results in increased expression of PTPN1 mRNA] more ... CTD PMID:26739621 PTPN1 Human diarsenic trioxide decreases expression EXP 6480464 Arsenic Trioxide results in decreased expression of PTPN1 mRNA CTD PMID:22521957 PTPN1 Human diarsenic trioxide multiple interactions EXP 6480464 Acetylcysteine inhibits the reaction [Arsenic Trioxide promotes the reaction [Pamidronate results in decreased expression of and results in decreased activity of PTPN1 protein]] more ... CTD PMID:32337366 PTPN1 Human Dibutyl phosphate affects expression EXP 6480464 di-n-butylphosphoric acid affects the expression of PTPN1 mRNA CTD PMID:37042841 PTPN1 Human dibutyl phthalate increases expression ISO Ptpn1 (Rattus norvegicus) 6480464 Dibutyl Phthalate results in increased expression of PTPN1 mRNA CTD PMID:21266533 PTPN1 Human diclofenac increases expression ISO Ptpn1 (Mus musculus) 6480464 Diclofenac results in increased expression of PTPN1 mRNA CTD PMID:26934552 PTPN1 Human Didymin decreases activity EXP 6480464 didymin results in decreased activity of PTPN1 protein CTD PMID:30928401 PTPN1 Human Didymin multiple interactions EXP 6480464 didymin inhibits the reaction [INS protein results in increased expression of PTPN1 protein] CTD PMID:30928401 PTPN1 Human dimethylarsinous acid affects binding EXP 6480464 dimethylarsinous acid binds to PTPN1 protein CTD PMID:22771847 PTPN1 Human dimethylarsinous acid decreases activity EXP 6480464 dimethylarsinous acid results in decreased activity of PTPN1 protein CTD PMID:22771847 PTPN1 Human disodium selenite increases expression ISO Ptpn1 (Mus musculus) 6480464 Sodium Selenite results in increased expression of PTPN1 mRNA CTD PMID:16443359 PTPN1 Human disodium selenite decreases activity EXP 401959220 Selenite decreases activity of PTPN1 protein in vitro RGD PTPN1 Human disodium selenite decreases activity EXP 6480464 Sodium Selenite results in decreased activity of PTPN1 protein CTD PMID:22366233 PTPN1 Human elemental selenium increases expression ISO Ptpn1 (Rattus norvegicus) 6480464 Selenium results in increased expression of PTPN1 protein CTD PMID:19022953 PTPN1 Human elemental selenium multiple interactions ISO Ptpn1 (Rattus norvegicus) 6480464 Selenium inhibits the reaction [Potassium Iodide results in decreased expression of PTPN1 mRNA] CTD PMID:38013145 PTPN1 Human elemental selenium decreases glutathionylation ISO Ptpn1 (Rattus norvegicus) 6480464 Selenium results in decreased glutathionylation of PTPN1 protein CTD PMID:19022953 PTPN1 Human ethanol increases expression ISO Ptpn1 (Mus musculus) 6480464 Ethanol results in increased expression of PTPN1 mRNA and Ethanol results in increased expression of PTPN1 protein CTD PMID:31711802 PTPN1 Human ethanol multiple interactions ISO Ptpn1 (Mus musculus) 6480464 [Ethanol co-treated with Lipopolysaccharides] results in increased expression of PTPN1 mRNA more ... CTD PMID:31711802 PTPN1 Human fenthion decreases expression ISO Ptpn1 (Mus musculus) 6480464 Fenthion results in decreased expression of PTPN1 mRNA CTD PMID:34813904 PTPN1 Human flavonoids decreases expression ISO Ptpn1 (Rattus norvegicus) 6480464 Flavonoids results in decreased expression of PTPN1 mRNA CTD PMID:18035473 PTPN1 Human folic acid decreases expression ISO Ptpn1 (Mus musculus) 6480464 Folic Acid results in decreased expression of PTPN1 mRNA CTD PMID:25629700 PTPN1 Human FR900359 affects phosphorylation EXP 6480464 FR900359 affects the phosphorylation of PTPN1 protein CTD PMID:37730182 PTPN1 Human fucosterol decreases activity EXP 6480464 fucosterol results in decreased activity of PTPN1 protein CTD PMID:23994501 PTPN1 Human fulvestrant multiple interactions EXP 6480464 [bisphenol S co-treated with Fulvestrant] results in increased methylation of PTPN1 gene CTD PMID:31601247 PTPN1 Human furfural multiple interactions EXP 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of PTPN1 protein CTD PMID:38598786 PTPN1 Human genistein increases expression ISO Ptpn1 (Rattus norvegicus) 6480464 Genistein results in increased expression of PTPN1 mRNA CTD PMID:12075121 PTPN1 Human gentamycin increases expression ISO Ptpn1 (Rattus norvegicus) 6480464 Gentamicins results in increased expression of PTPN1 mRNA CTD PMID:33387578 PTPN1 Human glucose increases expression ISO Ptpn1 (Mus musculus) 401976377 Glucose increases expression of Ptpn1 protein in photoreceptor cells RGD PTPN1 Human glycidol increases expression ISO Ptpn1 (Rattus norvegicus) 6480464 glycidol results in increased expression of PTPN1 mRNA CTD PMID:24915197 PTPN1 Human hexadecanoic acid increases expression ISO Ptpn1 (Mus musculus) 6480464 Palmitic Acid results in increased expression of PTPN1 protein CTD PMID:22509299 PTPN1 Human hydrogen peroxide multiple interactions ISO Ptpn1 (Rattus norvegicus) 6480464 Dithiothreitol inhibits the reaction [Hydrogen Peroxide results in increased glutathionylation of PTPN1 protein] CTD PMID:16781456 PTPN1 Human hydrogen peroxide increases glutathionylation ISO Ptpn1 (Rattus norvegicus) 6480464 Hydrogen Peroxide results in increased glutathionylation of PTPN1 protein CTD PMID:16781456 PTPN1 Human isoliquiritigenin multiple interactions ISO Ptpn1 (Mus musculus) 6480464 isoliquiritigenin inhibits the reaction [INS1 protein results in decreased activity of and results in increased oxidation of PTPN1 protein] CTD PMID:27117918 PTPN1 Human isosilybin A multiple interactions EXP 6480464 isosilybin A binds to and results in decreased activity of PTPN1 protein CTD PMID:30160205 PTPN1 Human ivermectin decreases expression EXP 6480464 Ivermectin results in decreased expression of PTPN1 protein CTD PMID:32959892 PTPN1 Human Kuwanon L decreases activity EXP 6480464 kuwanon-L results in decreased activity of PTPN1 protein CTD PMID:16356713 PTPN1 Human L-1,4-dithiothreitol multiple interactions ISO Ptpn1 (Rattus norvegicus) 6480464 Dithiothreitol inhibits the reaction [Hydrogen Peroxide results in increased glutathionylation of PTPN1 protein] CTD PMID:16781456 PTPN1 Human L-1,4-dithiothreitol multiple interactions EXP 6480464 [9 more ... CTD PMID:32493877 PTPN1 Human lipopolysaccharide multiple interactions ISO Ptpn1 (Mus musculus) 6480464 [Ethanol co-treated with Lipopolysaccharides] results in increased expression of PTPN1 mRNA more ... CTD PMID:31711802 PTPN1 Human LY294002 multiple interactions EXP 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one affects the reaction [1-Methyl-4-phenylpyridinium affects the expression of PTPN1 mRNA] CTD PMID:12710931 PTPN1 Human metformin multiple interactions EXP 6480464 Metformin inhibits the reaction [INS protein results in increased expression of PTPN1 protein] CTD PMID:30928401 PTPN1 Human methimazole increases expression ISO Ptpn1 (Rattus norvegicus) 6480464 Methimazole results in increased expression of PTPN1 mRNA CTD PMID:30047161 PTPN1 Human methylglyoxal increases expression EXP 6480464 Pyruvaldehyde results in increased expression of PTPN1 protein CTD PMID:22917016 PTPN1 Human methylglyoxal multiple interactions EXP 6480464 Acetylcysteine inhibits the reaction [Pyruvaldehyde results in increased expression of PTPN1 protein] more ... CTD PMID:22917016 PTPN1 Human methylmercury chloride decreases activity EXP 6480464 methylmercuric chloride results in decreased activity of PTPN1 protein CTD PMID:28958600 PTPN1 Human methylmercury chloride increases expression ISO Ptpn1 (Mus musculus) 6480464 methylmercuric chloride results in increased expression of PTPN1 protein CTD PMID:33338554 PTPN1 Human molybdate multiple interactions EXP 6480464 [sodium molybdate(VI) results in increased abundance of molybdate] which results in decreased activity of PTPN1 protein CTD PMID:34320920 PTPN1 Human morin decreases activity EXP 6480464 morin results in decreased activity of PTPN1 protein CTD PMID:29175190 PTPN1 Human mulberrofuran C decreases activity EXP 6480464 mulberrofuran C results in decreased activity of PTPN1 protein CTD PMID:16356713 PTPN1 Human N-acetyl-L-cysteine multiple interactions EXP 6480464 Acetylcysteine inhibits the reaction [Arsenic Trioxide promotes the reaction [Pamidronate results in decreased expression of and results in decreased activity of PTPN1 protein]] more ... CTD PMID:22917016 and PMID:32337366 PTPN1 Human N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions EXP 6480464 PTPN1 protein affects the reaction [benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in increased phosphorylation of EIF2S1 protein] CTD PMID:28359145 PTPN1 Human N-methyl-4-phenylpyridinium multiple interactions EXP 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one affects the reaction [1-Methyl-4-phenylpyridinium affects the expression of PTPN1 mRNA] CTD PMID:12710931 PTPN1 Human N-nitrosodiethylamine multiple interactions ISO Ptpn1 (Rattus norvegicus) 6480464 [Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in increased expression of PTPN1 mRNA CTD PMID:20360939 PTPN1 Human nitrates multiple interactions ISO Ptpn1 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of PTPN1 mRNA CTD PMID:35964746 PTPN1 Human nitrofen decreases expression ISO Ptpn1 (Rattus norvegicus) 6480464 nitrofen results in decreased expression of PTPN1 mRNA CTD PMID:33484710 PTPN1 Human oxidised LDL increases expression EXP 401976383 Oxidized-LDL increases expression of PTPN1 mRNA and protein in endothelial cell of umbilical vein RGD PTPN1 Human ozone multiple interactions ISO Ptpn1 (Rattus norvegicus) 6480464 [Air Pollutants results in increased abundance of Ozone] which results in increased expression of PTPN1 mRNA CTD PMID:37088303 PTPN1 Human pamidronate multiple interactions EXP 6480464 Acetylcysteine inhibits the reaction [Arsenic Trioxide promotes the reaction [Pamidronate results in decreased expression of and results in decreased activity of PTPN1 protein]] more ... CTD PMID:32337366 PTPN1 Human paracetamol affects expression ISO Ptpn1 (Mus musculus) 6480464 Acetaminophen affects the expression of PTPN1 mRNA CTD PMID:17562736 PTPN1 Human phenethyl caffeate multiple interactions ISO Ptpn1 (Rattus norvegicus) 6480464 [Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in increased expression of PTPN1 mRNA CTD PMID:20360939 PTPN1 Human pirinixic acid multiple interactions ISO Ptpn1 (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of PTPN1 mRNA CTD PMID:19710929 PTPN1 Human pirinixic acid increases expression ISO Ptpn1 (Mus musculus) 6480464 pirinixic acid results in increased expression of PTPN1 mRNA CTD PMID:18301758 PTPN1 Human potassium iodide multiple interactions ISO Ptpn1 (Rattus norvegicus) 6480464 Selenium inhibits the reaction [Potassium Iodide results in decreased expression of PTPN1 mRNA] CTD PMID:38013145 PTPN1 Human potassium iodide decreases expression ISO Ptpn1 (Rattus norvegicus) 6480464 Potassium Iodide results in decreased expression of PTPN1 mRNA CTD PMID:38013145 PTPN1 Human procyanidin B1 decreases activity EXP 6480464 procyanidin B1 results in decreased activity of PTPN1 protein CTD PMID:33992895 PTPN1 Human procyanidin B1 decreases expression EXP 6480464 procyanidin B1 results in decreased expression of PTPN1 mRNA and procyanidin B1 results in decreased expression of PTPN1 protein CTD PMID:33992895 PTPN1 Human procyanidin B1 affects binding EXP 6480464 procyanidin B1 binds to PTPN1 protein CTD PMID:33992895 PTPN1 Human procyanidin B2 affects binding EXP 6480464 procyanidin B2 binds to PTPN1 protein CTD PMID:33992895 PTPN1 Human procyanidin B2 decreases activity EXP 6480464 procyanidin B2 results in decreased activity of PTPN1 protein CTD PMID:33992895 PTPN1 Human procyanidin B2 decreases expression EXP 6480464 procyanidin B2 results in decreased expression of PTPN1 mRNA and procyanidin B2 results in decreased expression of PTPN1 protein CTD PMID:33992895 PTPN1 Human pyrithione multiple interactions ISO Ptpn1 (Mus musculus) 6480464 [Zinc co-treated with pyrithione] results in decreased activity of PTPN1 protein CTD PMID:22374166 PTPN1 Human resveratrol increases response to substance ISO Ptpn1 (Mus musculus) 6480464 PTPN1 protein results in increased susceptibility to resveratrol CTD PMID:20026400 PTPN1 Human resveratrol multiple interactions ISO Ptpn1 (Mus musculus) 6480464 resveratrol inhibits the reaction [IRS2 gene mutant form results in increased activity of PTPN1 protein] more ... CTD PMID:20028942 and PMID:25808216 PTPN1 Human resveratrol multiple interactions EXP 6480464 NFE2L2 protein affects the reaction [resveratrol inhibits the reaction [Pyruvaldehyde results in increased expression of PTPN1 protein]] CTD PMID:22917016 PTPN1 Human resveratrol increases expression ISO Ptpn1 (Mus musculus) 6480464 resveratrol results in increased expression of PTPN1 protein CTD PMID:25505154 PTPN1 Human rotenone multiple interactions EXP 6480464 PTPN1 protein affects the reaction [Rotenone results in increased phosphorylation of EIF2AK3 protein] and PTPN1 protein affects the reaction [Rotenone results in increased phosphorylation of EIF2S1 protein] CTD PMID:28359145 PTPN1 Human rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of PTPN1 mRNA CTD PMID:33512557 PTPN1 Human S-butyl-DL-homocysteine (S,R)-sulfoximine increases oxidation ISO Ptpn1 (Rattus norvegicus) 6480464 Buthionine Sulfoximine results in increased oxidation of PTPN1 protein CTD PMID:20482862 PTPN1 Human S-nitroso-N-acetyl-D-penicillamine increases activity ISO Ptpn1 (Rattus norvegicus) 401965470 SNAP increases activity of Ptpn1 protein in aortic smooth muscle cells RGD PTPN1 Human Sanggenon C decreases activity EXP 6480464 sanggenone C results in decreased activity of PTPN1 protein CTD PMID:16356713 PTPN1 Human Sanggenon G decreases activity EXP 6480464 sanggenon G results in decreased activity of PTPN1 protein CTD PMID:16356713 PTPN1 Human selenic acid increases expression ISO Ptpn1 (Mus musculus) 6480464 Selenic Acid results in increased expression of PTPN1 mRNA CTD PMID:16443359 PTPN1 Human selenic acid decreases activity EXP 6480464 Selenic Acid results in decreased activity of PTPN1 protein CTD PMID:22366233 PTPN1 Human selenium atom increases expression ISO Ptpn1 (Rattus norvegicus) 6480464 Selenium results in increased expression of PTPN1 protein CTD PMID:19022953 PTPN1 Human selenium atom multiple interactions ISO Ptpn1 (Rattus norvegicus) 6480464 Selenium inhibits the reaction [Potassium Iodide results in decreased expression of PTPN1 mRNA] CTD PMID:38013145 PTPN1 Human selenium atom decreases glutathionylation ISO Ptpn1 (Rattus norvegicus) 6480464 Selenium results in decreased glutathionylation of PTPN1 protein CTD PMID:19022953 PTPN1 Human silibinin multiple interactions EXP 6480464 Silybin binds to and results in decreased activity of PTPN1 protein CTD PMID:30160205 PTPN1 Human silicon dioxide increases expression ISO Ptpn1 (Mus musculus) 6480464 Silicon Dioxide results in increased expression of PTPN1 mRNA CTD PMID:23221170 PTPN1 Human sodium arsenite decreases expression ISO Ptpn1 (Mus musculus) 6480464 sodium arsenite results in decreased expression of PTPN1 protein CTD PMID:29044176 PTPN1 Human sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of PTPN1 mRNA CTD PMID:38568856 PTPN1 Human sodium chloride multiple interactions EXP 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of PTPN1 protein more ... CTD PMID:38598786 PTPN1 Human sodium molybdate (anhydrous) multiple interactions EXP 6480464 [sodium molybdate(VI) results in increased abundance of molybdate] which results in decreased activity of PTPN1 protein CTD PMID:34320920 PTPN1 Human sodium tungstate multiple interactions EXP 6480464 [sodium tungstate(VI) results in increased abundance of Tungsten] which results in decreased activity of PTPN1 protein CTD PMID:34320920 PTPN1 Human somatostatin multiple interactions ISO Ptpn1 (Mus musculus) 401976377 Somatostatin inhibits the reaction [Glucose increases expression of Ptpn1 protein in photoreceptor cells] RGD PTPN1 Human streptozocin multiple interactions ISO Ptpn1 (Mus musculus) 6480464 resveratrol inhibits the reaction [Streptozocin results in increased expression of PTPN1 protein] CTD PMID:25808216 PTPN1 Human streptozocin increases expression ISO Ptpn1 (Mus musculus) 6480464 Streptozocin results in increased expression of PTPN1 protein CTD PMID:25808216 PTPN1 Human sulfadimethoxine increases expression ISO Ptpn1 (Rattus norvegicus) 6480464 Sulfadimethoxine results in increased expression of PTPN1 mRNA CTD PMID:30047161 PTPN1 Human tamoxifen affects expression ISO Ptpn1 (Mus musculus) 6480464 Tamoxifen affects the expression of PTPN1 mRNA CTD PMID:17555576 PTPN1 Human tetrachloromethane increases expression ISO Ptpn1 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of PTPN1 mRNA and Carbon Tetrachloride results in increased expression of PTPN1 protein CTD PMID:26739621 PTPN1 Human tetrathiomolybdate(2-) multiple interactions EXP 6480464 tetrathiomolybdate inhibits the reaction [EGF protein results in increased oxidation of PTPN1 protein] CTD PMID:18480265 PTPN1 Human thapsigargin multiple interactions ISO Ptpn1 (Mus musculus) 6480464 PTPN1 gene mutant form promotes the reaction [Thapsigargin results in increased activity of and results in increased phosphorylation of EIF2AK3 protein] more ... CTD PMID:22509299 PTPN1 Human thapsigargin decreases expression ISO Ptpn1 (Rattus norvegicus) 6480464 Thapsigargin results in decreased expression of PTPN1 protein CTD PMID:35544339 PTPN1 Human thapsigargin increases response to substance ISO Ptpn1 (Mus musculus) 6480464 PTPN1 gene mutant form results in increased susceptibility to Thapsigargin CTD PMID:22509299 PTPN1 Human thiazolidines multiple interactions EXP 6480464 Thiazolidines analog inhibits the reaction [PTPN1 protein results in increased hydrolysis of nitrophenylphosphate] CTD PMID:24287560 PTPN1 Human thiazolidines decreases activity EXP 6480464 Thiazolidines analog results in decreased activity of PTPN1 protein CTD PMID:24287560 PTPN1 Human thioacetamide increases expression ISO Ptpn1 (Rattus norvegicus) 6480464 Thioacetamide results in increased expression of PTPN1 mRNA CTD PMID:34492290 PTPN1 Human titanium dioxide decreases methylation ISO Ptpn1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of PTPN1 gene CTD PMID:35295148 PTPN1 Human titanium dioxide decreases expression ISO Ptpn1 (Mus musculus) 6480464 titanium dioxide results in decreased expression of PTPN1 mRNA CTD PMID:35295148 PTPN1 Human triadimefon increases expression ISO Ptpn1 (Rattus norvegicus) 6480464 triadimefon results in increased expression of PTPN1 mRNA CTD PMID:30047161 PTPN1 Human triptonide increases expression ISO Ptpn1 (Mus musculus) 6480464 triptonide results in increased expression of PTPN1 mRNA CTD PMID:33045310 PTPN1 Human tris(picolinato)chromium multiple interactions ISO Ptpn1 (Rattus norvegicus) 6480464 chromium tripicolinate results in decreased expression of and results in decreased activity of PTPN1 protein CTD PMID:16424121 PTPN1 Human triticonazole decreases expression ISO Ptpn1 (Rattus norvegicus) 6480464 triticonazole results in decreased expression of PTPN1 mRNA CTD PMID:36084822 PTPN1 Human tungsten multiple interactions EXP 6480464 [sodium tungstate(VI) results in increased abundance of Tungsten] which results in decreased activity of PTPN1 protein CTD PMID:34320920 PTPN1 Human tunicamycin multiple interactions ISO Ptpn1 (Mus musculus) 6480464 PTPN1 gene mutant form promotes the reaction [Tunicamycin results in increased activity of and results in increased phosphorylation of EIF2AK3 protein] more ... CTD PMID:22509299 and PMID:29894845 PTPN1 Human tunicamycin multiple interactions EXP 6480464 PTPN1 protein affects the reaction [Tunicamycin results in increased phosphorylation of EIF2S1 protein] CTD PMID:28359145 PTPN1 Human tunicamycin decreases expression EXP 6480464 Tunicamycin results in decreased expression of PTPN1 mRNA CTD PMID:29453283 PTPN1 Human tunicamycin increases response to substance ISO Ptpn1 (Mus musculus) 6480464 PTPN1 gene mutant form results in increased susceptibility to Tunicamycin CTD PMID:22509299 PTPN1 Human ursolic acid decreases activity EXP 6480464 Ursolic Acid results in decreased activity of PTPN1 protein CTD PMID:27085377 more ... PTPN1 Human Ursonic acid multiple interactions ISO Ptpn1 (Mus musculus) 6480464 ursonic acid inhibits the reaction [INS1 protein results in increased expression of PTPN1 protein] CTD PMID:36933777 PTPN1 Human Ursonic acid decreases activity EXP 6480464 ursonic acid results in decreased activity of PTPN1 protein CTD PMID:36933777 PTPN1 Human valproic acid increases expression ISO Ptpn1 (Mus musculus) 6480464 Valproic Acid results in increased expression of PTPN1 mRNA CTD PMID:20546886 PTPN1 Human valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of PTPN1 mRNA CTD PMID:23179753 PTPN1 Human vanadyl sulfate decreases activity EXP 6480464 vanadyl sulfate results in decreased activity of PTPN1 protein CTD PMID:10460753 PTPN1 Human vinclozolin decreases expression ISO Ptpn1 (Rattus norvegicus) 6480464 vinclozolin results in decreased expression of PTPN1 mRNA CTD PMID:23034163 PTPN1 Human vorinostat increases expression EXP 6480464 vorinostat results in increased expression of PTPN1 mRNA CTD PMID:26238599 PTPN1 Human zinc atom multiple interactions ISO Ptpn1 (Mus musculus) 6480464 [Zinc co-treated with pyrithione] results in decreased activity of PTPN1 protein CTD PMID:22374166 PTPN1 Human zinc atom decreases activity EXP 6480464 Zinc results in decreased activity of PTPN1 protein CTD PMID:14644152 PTPN1 Human zinc sulfate decreases activity EXP 6480464 Zinc Sulfate results in decreased activity of PTPN1 protein CTD PMID:10460753 PTPN1 Human zinc(0) multiple interactions ISO Ptpn1 (Mus musculus) 6480464 [Zinc co-treated with pyrithione] results in decreased activity of PTPN1 protein CTD PMID:22374166 PTPN1 Human zinc(0) decreases activity EXP 6480464 Zinc results in decreased activity of PTPN1 protein CTD PMID:14644152
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(+)-catechin (EXP) 1,2-dimethylhydrazine (ISO) 1,2-naphthoquinone (EXP) 1,4-benzoquinone (EXP) 1,4-dithiothreitol (EXP,ISO) 1,4-naphthoquinone (EXP) 1-chloro-2,4-dinitrobenzene (EXP) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP) 1H-[1,2,4]oxadiazolo[4,3-a]quinoxalin-1-one (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (ISO) 2,4-dinitrotoluene (ISO) 2,6-dimethoxyphenol (EXP) 2,6-dinitrotoluene (ISO) 2-methylcholine (EXP) 3,3',4,4',5-pentachlorobiphenyl (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3-chloropropane-1,2-diol (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 4-hydroxynon-2-enal (EXP) 4-hydroxyphenyl retinamide (ISO) 4-nitrophenyl phosphate (EXP) 6-propyl-2-thiouracil (ISO) 9,10-phenanthroquinone (EXP) acetamide (ISO) acrolein (EXP) ADP (ISO) aflatoxin B1 (EXP) Aflatoxin B2 alpha (EXP) amitrole (ISO) ammonium chloride (ISO) angiotensin II (ISO) anthranilic acid (EXP) antirheumatic drug (EXP) aristolochic acid A (EXP) arsenous acid (EXP) astragaloside IV (ISO) atrazine (ISO) Bardoxolone methyl (ISO) benzo[a]pyrene (EXP,ISO) benzo[a]pyrene diol epoxide I (EXP) benzoic acid (EXP) bisphenol A (ISO) bisphenol F (EXP) calcitriol (EXP) carbon nanotube (ISO) chlordecone (ISO) chloride (EXP) chloropicrin (EXP) chromium atom (ISO) copper atom (EXP) copper(0) (EXP) copper(II) chloride (EXP) coumestrol (EXP) Cryptotanshinone (EXP) Cuprizon (ISO) decabromodiphenyl ether (ISO) dexamethasone (ISO) diarsenic trioxide (EXP) Dibutyl phosphate (EXP) dibutyl phthalate (ISO) diclofenac (ISO) Didymin (EXP) dimethylarsinous acid (EXP) disodium selenite (EXP,ISO) elemental selenium (ISO) ethanol (ISO) fenthion (ISO) flavonoids (ISO) folic acid (ISO) FR900359 (EXP) fucosterol (EXP) fulvestrant (EXP) furfural (EXP) genistein (ISO) gentamycin (ISO) glucose (ISO) glycidol (ISO) hexadecanoic acid (ISO) hydrogen peroxide (ISO) isoliquiritigenin (ISO) isosilybin A (EXP) ivermectin (EXP) Kuwanon L (EXP) L-1,4-dithiothreitol (EXP,ISO) lipopolysaccharide (ISO) LY294002 (EXP) metformin (EXP) methimazole (ISO) methylglyoxal (EXP) methylmercury chloride (EXP,ISO) molybdate (EXP) morin (EXP) mulberrofuran C (EXP) N-acetyl-L-cysteine (EXP) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (EXP) N-methyl-4-phenylpyridinium (EXP) N-nitrosodiethylamine (ISO) nitrates (ISO) nitrofen (ISO) oxidised LDL (EXP) ozone (ISO) pamidronate (EXP) paracetamol (ISO) phenethyl caffeate (ISO) pirinixic acid (ISO) potassium iodide (ISO) procyanidin B1 (EXP) procyanidin B2 (EXP) pyrithione (ISO) resveratrol (EXP,ISO) rotenone (EXP) S-butyl-DL-homocysteine (S,R)-sulfoximine (ISO) S-nitroso-N-acetyl-D-penicillamine (ISO) Sanggenon C (EXP) Sanggenon G (EXP) selenic acid (EXP,ISO) selenium atom (ISO) silibinin (EXP) silicon dioxide (ISO) sodium arsenite (EXP,ISO) sodium chloride (EXP) sodium molybdate (anhydrous) (EXP) sodium tungstate (EXP) somatostatin (ISO) streptozocin (ISO) sulfadimethoxine (ISO) tamoxifen (ISO) tetrachloromethane (ISO) tetrathiomolybdate(2-) (EXP) thapsigargin (ISO) thiazolidines (EXP) thioacetamide (ISO) titanium dioxide (ISO) triadimefon (ISO) triptonide (ISO) tris(picolinato)chromium (ISO) triticonazole (ISO) tungsten (EXP) tunicamycin (EXP,ISO) ursolic acid (EXP) Ursonic acid (EXP,ISO) valproic acid (EXP,ISO) vanadyl sulfate (EXP) vinclozolin (ISO) vorinostat (EXP) zinc atom (EXP,ISO) zinc sulfate (EXP) zinc(0) (EXP,ISO)
Biological Process
actin cytoskeleton organization (IMP) cellular response to angiotensin (IEA,ISO) cellular response to fibroblast growth factor stimulus (IEA,ISO) cellular response to hypoxia (IEA,ISO) cellular response to insulin stimulus (IEA,ISO) cellular response to nerve growth factor stimulus (IEA,ISO) cellular response to nitric oxide (IEA,ISO) cellular response to platelet-derived growth factor stimulus (IEA,ISO) cellular response to unfolded protein (TAS) dephosphorylation (ISO) endoplasmic reticulum unfolded protein response (IDA) growth hormone receptor signaling pathway via JAK-STAT (TAS) insulin receptor recycling (IEA) insulin receptor signaling pathway (IEA) IRE1-mediated unfolded protein response (IEA,ISS) negative regulation of cell population proliferation (IEA,ISO) negative regulation of cell-substrate adhesion (IEA,ISO) negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway (IEA,ISS) negative regulation of ERK1 and ERK2 cascade (IBA,IEA,ISS) negative regulation of insulin receptor signaling pathway (NAS) negative regulation of MAP kinase activity (IMP) negative regulation of neuron projection development (IEA,ISO) negative regulation of peptidyl-tyrosine phosphorylation (ISO) negative regulation of PERK-mediated unfolded protein response (IBA,IDA,IEA) negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction (IEA,ISO) negative regulation of protein phosphorylation (ISO) negative regulation of signal transduction (TAS) negative regulation of vascular associated smooth muscle cell migration (IEA,ISO) negative regulation of vascular endothelial growth factor receptor signaling pathway (IEA,ISS) peptidyl-tyrosine dephosphorylation (IDA,IMP) platelet-derived growth factor receptor-beta signaling pathway (IEA,IMP) positive regulation of cardiac muscle cell apoptotic process (IEA,ISO) positive regulation of endothelial cell apoptotic process (IEA,ISO) positive regulation of heart rate (IEA,ISO) positive regulation of IRE1-mediated unfolded protein response (TAS) positive regulation of JUN kinase activity (ISS) positive regulation of protein tyrosine kinase activity (IDA) positive regulation of receptor catabolic process (IMP) positive regulation of systemic arterial blood pressure (IEA,ISO) protein dephosphorylation (IMP,ISO) regulation of endocytosis (IDA) regulation of hepatocyte growth factor receptor signaling pathway (IMP) regulation of insulin receptor signaling pathway (IEA,ISO) regulation of intracellular protein transport (IMP) regulation of postsynapse assembly (IEA) regulation of proteolysis (IEA,ISO) regulation of signal transduction (IMP) regulation of type I interferon-mediated signaling pathway (TAS) response to angiotensin (IEA,ISO) response to endoplasmic reticulum stress (IEA) response to nutrient levels (IEA,ISO) vascular endothelial cell response to oscillatory fluid shear stress (TAS)
1.
Purification, identification and subcellular distribution of three predominant protein-tyrosine phosphatase enzymes in skeletal muscle tissue.
Ahmad F and Goldstein BJ, Biochim Biophys Acta. 1995 Apr 5;1248(1):57-69.
2.
Selenate enhances STAT3 transcriptional activity in endothelial cells: differential actions of selenate and selenite on LIF cytokine signaling and cell viability.
Alturkmani HJ, etal., J Inorg Biochem. 2012 Apr;109:9-15. doi: 10.1016/j.jinorgbio.2012.01.008. Epub 2012 Jan 28.
3.
Somatostatin protects photoreceptor cells against high glucose-induced apoptosis.
Arroba AI, etal., Mol Vis. 2016 Dec 30;22:1522-1531. eCollection 2016.
4.
Association of protein tyrosine phosphatase-N1 polymorphisms with coronary calcified plaque in the Diabetes Heart Study.
Burdon KP, etal., Diabetes. 2006 Mar;55(3):651-8. doi: 10.2337/diabetes.55.03.06.db05-0058.
5.
Increase of PTP levels in vascular injury and in cultured aortic smooth muscle cells treated with specific growth factors.
Chang Y, etal., Am J Physiol Heart Circ Physiol. 2004 Nov;287(5):H2201-8. doi: 10.1152/ajpheart.00520.2004. Epub 2004 Jul 22.
6.
Counter-regulatory function of protein tyrosine phosphatase 1B in platelet-derived growth factor- or fibroblast growth factor-induced motility and proliferation of cultured smooth muscle cells and in neointima formation.
Chang Y, etal., Arterioscler Thromb Vasc Biol. 2006 Mar;26(3):501-7. doi: 10.1161/01.ATV.0000201070.71787.b8. Epub 2005 Dec 22.
7.
Neuronal protein-tyrosine phosphatase 1B hinders sensory-motor functional recovery and causes affective disorders in two different focal ischemic stroke models.
Cruz SA, etal., Neural Regen Res. 2021 Jan;16(1):129-136. doi: 10.4103/1673-5374.286970.
8.
A variation in 3' UTR of hPTP1B increases specific gene expression and associates with insulin resistance.
Di Paola R, etal., Am J Hum Genet. 2002 Mar;70(3):806-12. Epub 2002 Feb 6.
9.
Mechanisms involved in the development and healing of diabetic foot ulceration.
Dinh T, etal., Diabetes. 2012 Nov;61(11):2937-47. doi: 10.2337/db12-0227. Epub 2012 Jun 11.
10.
A P387L variant in protein tyrosine phosphatase-1B (PTP-1B) is associated with type 2 diabetes and impaired serine phosphorylation of PTP-1B in vitro.
Echwald SM, etal., Diabetes. 2002 Jan;51(1):1-6. doi: 10.2337/diabetes.51.1.1.
11.
βA1-crystallin regulates glucose metabolism and mitochondrial function in mouse retinal astrocytes by modulating PTP1B activity.
Ghosh S, etal., Commun Biol. 2021 Feb 24;4(1):248. doi: 10.1038/s42003-021-01763-5.
12.
GOAs Human GO annotations
GOA_HUMAN data from the GO Consortium
13.
The Pro387Leu variant of protein tyrosine phosphatase-1B is not associated with diabetes mellitus type 2 in a German population.
Gouni-Berthold I, etal., J Intern Med. 2005 Mar;257(3):272-80. doi: 10.1111/j.1365-2796.2004.01446.x.
14.
Protein tyrosine phosphatase 1B gene polymorphisms and essential hypertension: a case-control study in Chinese population.
Gu P, etal., J Endocrinol Invest. 2010 Jul-Aug;33(7):483-8. doi: 10.1007/BF03346629. Epub 2010 Jan 22.
15.
NO alters cell shape and motility in aortic smooth muscle cells via protein tyrosine phosphatase 1B activation.
Hassid A, etal., Am J Physiol. 1999 Sep;277(3):H1014-26. doi: 10.1152/ajpheart.1999.277.3.H1014.
16.
Modulation of IR/PTP1B interaction and downstream signaling in insulin sensitive tissues of MSG-rats.
Hirata AE, etal., Life Sci. 2003 Aug 1;73(11):1369-81.
17.
Astragaloside IV Prevents Obesity-Associated Hypertension by Improving Pro-Inflammatory Reaction and Leptin Resistance.
Jiang P, etal., Mol Cells. 2018 Mar 31;41(3):244-255. doi: 10.14348/molcells.2018.2156. Epub 2018 Mar 20.
18.
Reduced intracellular chloride concentration impairs angiogenesis by inhibiting oxidative stress-mediated VEGFR2 activation.
Li K, etal., Acta Pharmacol Sin. 2021 Apr;42(4):560-572. doi: 10.1038/s41401-020-0458-7. Epub 2020 Jul 21.
19.
PTP1B Inhibition Improves Mitochondrial Dynamics to Alleviate Calcific Aortic Valve Disease Via Regulating OPA1 Homeostasis.
Liu F, etal., JACC Basic Transl Sci. 2022 Jul 25;7(7):697-712. doi: 10.1016/j.jacbts.2022.03.002. eCollection 2022 Jul.
20.
Mechanism of protein tyrosine phosphatase 1B-mediated inhibition of leptin signalling.
Lund IK, etal., J Mol Endocrinol. 2005 Apr;34(2):339-51.
21.
Role of protein tyrosine phosphatase 1B in vascular endothelial growth factor signaling and cell-cell adhesions in endothelial cells.
Nakamura Y, etal., Circ Res. 2008 May 23;102(10):1182-91. doi: 10.1161/CIRCRESAHA.107.167080. Epub 2008 May 1.
22.
Increased Protein Tyrosine Phosphatase 1B (PTP1B) Activity and Cardiac Insulin Resistance Precede Mitochondrial and Contractile Dysfunction in Pressure-Overloaded Hearts.
Nguyen TD, etal., J Am Heart Assoc. 2018 Jun 21;7(13):e008865. doi: 10.1161/JAHA.118.008865.
23.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
24.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
25.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
26.
Chronic insulin treatment suppresses PTP1B function, induces increased PDGF signaling, and amplifies neointima formation in the balloon-injured rat artery.
Pu Q, etal., Am J Physiol Heart Circ Physiol. 2009 Jan;296(1):H132-9. doi: 10.1152/ajpheart.00370.2008. Epub 2008 Nov 14.
27.
Diabetes reduces autophosphorylation of retinal insulin receptor and increases protein-tyrosine phosphatase-1B activity.
Rajala RV, etal., Invest Ophthalmol Vis Sci. 2009 Mar;50(3):1033-40. doi: 10.1167/iovs.08-2851. Epub 2008 Nov 21.
28.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
29.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
30.
JAK/STAT signal transduction: regulators and implication in hematological malignancies.
Valentino L and Pierre J, Biochem Pharmacol. 2006 Mar 14;71(6):713-21. Epub 2006 Jan 19.
31.
Angiotensin II induces apoptosis of cardiac microvascular endothelial cells via regulating PTP1B/PI3K/Akt pathway.
Wang Y, etal., In Vitro Cell Dev Biol Anim. 2019 Dec;55(10):801-811. doi: 10.1007/s11626-019-00395-8. Epub 2019 Sep 9.
32.
Protein-tyrosine phosphatases in the vessel wall: differential expression after acute arterial injury.
Wright MB, etal., Arterioscler Thromb Vasc Biol. 2000 May;20(5):1189-98.
33.
Regulation of insulin receptor function.
Youngren JF Cell Mol Life Sci. 2007 Apr;64(7-8):873-91.
34.
Protein tyrosine phosphatase 1B impairs diabetic wound healing through vascular endothelial growth factor receptor 2 dephosphorylation.
Zhang J, etal., Arterioscler Thromb Vasc Biol. 2015 Jan;35(1):163-74. doi: 10.1161/ATVBAHA.114.304705. Epub 2014 Nov 13.
35.
PTP1B inhibition ameliorates inflammatory injury and dysfunction in ox-LDL-induced HUVECs by activating the AMPK/SIRT1 signaling pathway via negative regulation of KLF2.
Zhang Y, etal., Exp Ther Med. 2022 May 25;24(1):467. doi: 10.3892/etm.2022.11394. eCollection 2022 Jul.
36.
The 981C>T polymorphism in protein tyrosine phosphatase 1B is associated with decreased risk of coronary artery disease in Chinese Han population.
Zhou X, etal., Atherosclerosis. 2011 Sep;218(1):147-50. doi: 10.1016/j.atherosclerosis.2011.05.021. Epub 2011 May 27.
37.
Qing Gan Zi Shen Tang alleviates adipose tissue dysfunction with up-regulation of SIRT1 in spontaneously hypertensive rat.
Zhu Y, etal., Biomed Pharmacother. 2018 Sep;105:246-255. doi: 10.1016/j.biopha.2018.05.022. Epub 2018 May 31.
PTPN1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 20 50,510,383 - 50,585,241 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 20 50,510,321 - 50,585,241 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 20 49,126,920 - 49,201,778 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 20 48,560,298 - 48,634,495 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 20 48,560,297 - 48,634,491 NCBI Celera 20 45,831,156 - 45,905,376 (+) NCBI Celera Cytogenetic Map 20 q13.13 NCBI HuRef 20 45,875,585 - 45,950,061 (+) NCBI HuRef CHM1_1 20 49,031,996 - 49,106,433 (+) NCBI CHM1_1 T2T-CHM13v2.0 20 52,280,015 - 52,354,899 (+) NCBI T2T-CHM13v2.0
Ptpn1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 167,772,670 - 167,821,305 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 167,773,977 - 167,821,305 (+) Ensembl GRCm39 Ensembl GRCm38 2 167,930,750 - 167,979,385 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 167,932,057 - 167,979,385 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 167,757,827 - 167,804,885 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 167,623,579 - 167,668,124 (+) NCBI MGSCv36 mm8 Celera 2 173,874,374 - 173,921,508 (+) NCBI Celera Cytogenetic Map 2 H3 NCBI cM Map 2 87.99 NCBI
Ptpn1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 177,056,588 - 177,106,424 (+) NCBI GRCr8 mRatBN7.2 3 156,638,811 - 156,687,503 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 156,638,769 - 156,687,504 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 160,433,645 - 160,479,965 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 168,932,730 - 168,979,050 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 166,674,429 - 166,720,749 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 164,665,462 - 164,711,936 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 164,665,532 - 164,711,848 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 170,816,897 - 170,866,071 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 159,070,473 - 159,116,792 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 158,976,466 - 159,025,198 (+) NCBI Celera 3 155,215,176 - 155,261,496 (+) NCBI Celera Cytogenetic Map 3 q42 NCBI
Ptpn1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955445 7,754,319 - 7,819,275 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955445 7,754,313 - 7,819,229 (-) NCBI ChiLan1.0 ChiLan1.0
PTPN1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 21 56,258,978 - 56,333,733 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 20 56,252,091 - 56,326,654 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 20 46,854,918 - 46,929,509 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 20 47,983,098 - 48,057,421 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 20 47,983,098 - 48,057,421 (+) Ensembl panpan1.1 panPan2
PTPN1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 24 36,936,469 - 37,010,929 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 24 36,936,298 - 37,003,720 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 24 36,179,442 - 36,246,435 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 24 37,642,503 - 37,713,189 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 24 37,642,561 - 37,712,561 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 24 36,882,533 - 36,949,558 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 24 37,016,127 - 37,083,208 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 24 37,560,457 - 37,627,492 (+) NCBI UU_Cfam_GSD_1.0
Ptpn1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 188,603,904 - 188,630,208 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936514 4,068,238 - 4,084,009 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936514 4,065,455 - 4,083,847 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PTPN1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 17 52,017,130 - 52,086,736 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 17 52,017,100 - 52,086,747 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 17 58,450,256 - 58,474,772 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PTPN1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 2 13,385,681 - 13,459,180 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 2 13,387,727 - 13,459,105 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666050 61,816,170 - 61,890,307 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ptpn1
.
Confirmed Target Of
MIR122 hsa-miR-122-5p Mirtarbase external_info Luciferase reporter assay Functional MTI 22807119 MIR210 hsa-miR-210-3p Mirtarbase external_info 2DGE//immunoprecipitaion//Luciferase reporter assa Functional MTI 19826008 MIR210 hsa-miR-210-3p OncomiRDB external_info NA NA 22962263
Predicted Target Of
Count of predictions: 1268 Count of miRNA genes: 760 Interacting mature miRNAs: 858 Transcripts: ENST00000371621, ENST00000541713 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
597298939 GWAS1395013_H lymphocyte count QTL GWAS1395013 (human) 3e-13 lymphocyte count blood lymphocyte count (CMO:0000031) 20 50568886 50568887 Human 2292864 PRSTS43_H Prostate tumor susceptibility QTL 43 (human) 0.62 0.05 Prostate tumor susceptibility 20 47303039 64444167 Human 597057972 GWAS1154046_H basophil count QTL GWAS1154046 (human) 8e-10 basophil quantity (VT:0002607) blood basophil count (CMO:0000034) 20 50533973 50533974 Human 597229626 GWAS1325700_H heel bone mineral density QTL GWAS1325700 (human) 5e-09 heel bone mineral density bone mineral density (CMO:0001226) 20 50575775 50575776 Human 597472091 GWAS1568165_H appendicular lean mass QTL GWAS1568165 (human) 2e-19 appendicular lean mass 20 50572631 50572632 Human 597054687 GWAS1150761_H eosinophil count QTL GWAS1150761 (human) 6e-18 eosinophil quantity (VT:0002602) blood eosinophil count (CMO:0000033) 20 50517998 50517999 Human 597053567 GWAS1149641_H eosinophil count QTL GWAS1149641 (human) 2e-18 eosinophil quantity (VT:0002602) blood eosinophil count (CMO:0000033) 20 50545649 50545650 Human 597050559 GWAS1146633_H Duchenne muscular dystrophy, disease progression measurement QTL GWAS1146633 (human) 0.000001 Duchenne muscular dystrophy, disease progression measurement disease progression measurement (CMO:0001110) 20 50575367 50575368 Human 597057018 GWAS1153092_H eosinophil count QTL GWAS1153092 (human) 1e-19 eosinophil quantity (VT:0002602) blood eosinophil count (CMO:0000033) 20 50517998 50517999 Human 1300007 BP29_H Blood pressure QTL 29 (human) Blood pressure hypertension susceptibility 20 36536005 62536005 Human 597050467 GWAS1146541_H Duchenne muscular dystrophy, disease progression measurement QTL GWAS1146541 (human) 0.000008 Duchenne muscular dystrophy, disease progression measurement disease progression measurement (CMO:0001110) 20 50575367 50575368 Human 597145537 GWAS1241611_H smoking initiation QTL GWAS1241611 (human) 2e-12 smoking initiation 20 50511703 50511704 Human 597145536 GWAS1241610_H smoking initiation QTL GWAS1241610 (human) 2e-12 smoking initiation 20 50511483 50511484 Human 597287310 GWAS1383384_H eosinophil count QTL GWAS1383384 (human) 9e-13 eosinophil quantity (VT:0002602) blood eosinophil count (CMO:0000033) 20 50517998 50517999 Human 597243342 GWAS1339416_H IGF-1 measurement QTL GWAS1339416 (human) 2e-14 IGF-1 measurement blood insulin-like growth factor 1 level (CMO:0001297) 20 50536135 50536136 Human 597085423 GWAS1181497_H lymphocyte percentage of leukocytes QTL GWAS1181497 (human) 2e-12 lymphocyte quantity (VT:0000717) blood lymphocyte count to total leukocyte count ratio (CMO:0000371) 20 50579747 50579748 Human 406939130 GWAS588106_H eosinophil percentage of leukocytes QTL GWAS588106 (human) 1e-20 eosinophil quantity (VT:0002602) blood eosinophil count to total leukocyte count ratio (CMO:0000369) 20 50545649 50545650 Human 407110360 GWAS759336_H eosinophil count QTL GWAS759336 (human) 4e-19 eosinophil quantity (VT:0002602) blood eosinophil count (CMO:0000033) 20 50545649 50545650 Human 596955561 GWAS1075080_H lymphocyte measurement, neutrophil measurement QTL GWAS1075080 (human) 9e-10 lymphocyte measurement, neutrophil measurement 20 50580062 50580063 Human 597293031 GWAS1389105_H lymphocyte measurement, neutrophil measurement QTL GWAS1389105 (human) 9e-10 lymphocyte measurement, neutrophil measurement 20 50580062 50580063 Human
AL034534
Human Assembly Chr Position (strand) Source JBrowse GRCh37 20 49,153,102 - 49,153,227 UniSTS GRCh37 Build 36 20 48,586,509 - 48,586,634 RGD NCBI36 Celera 20 45,857,387 - 45,857,512 RGD Cytogenetic Map 20 q13.1-q13.2 UniSTS HuRef 20 45,901,865 - 45,901,990 UniSTS
STS-M31724
Human Assembly Chr Position (strand) Source JBrowse GRCh37 20 49,199,241 - 49,199,485 UniSTS GRCh37 Build 36 20 48,632,648 - 48,632,892 RGD NCBI36 Celera 20 45,903,529 - 45,903,773 RGD Cytogenetic Map 20 q13.1-q13.2 UniSTS HuRef 20 45,948,003 - 45,948,247 UniSTS GeneMap99-GB4 RH Map 20 304.23 UniSTS NCBI RH Map 20 518.2 UniSTS
PMC117295P1
Human Assembly Chr Position (strand) Source JBrowse GRCh37 20 49,196,252 - 49,196,358 UniSTS GRCh37 Build 36 20 48,629,659 - 48,629,765 RGD NCBI36 Celera 20 45,900,540 - 45,900,646 RGD Cytogenetic Map 20 q13.1-q13.2 UniSTS HuRef 20 45,945,014 - 45,945,120 UniSTS
PMC117295P2
Human Assembly Chr Position (strand) Source JBrowse GRCh37 20 49,196,274 - 49,196,358 UniSTS GRCh37 Build 36 20 48,629,681 - 48,629,765 RGD NCBI36 Celera 20 45,900,562 - 45,900,646 RGD Cytogenetic Map 20 q13.1-q13.2 UniSTS HuRef 20 45,945,036 - 45,945,120 UniSTS
PTPN1_1850
Human Assembly Chr Position (strand) Source JBrowse GRCh37 20 49,200,306 - 49,201,087 UniSTS GRCh37 Build 36 20 48,633,713 - 48,634,494 RGD NCBI36 Celera 20 45,904,594 - 45,905,375 RGD HuRef 20 45,949,068 - 45,949,849 UniSTS
RH45266
Human Assembly Chr Position (strand) Source JBrowse GRCh37 20 49,198,470 - 49,198,597 UniSTS GRCh37 Build 36 20 48,631,877 - 48,632,004 RGD NCBI36 Celera 20 45,902,758 - 45,902,885 RGD Cytogenetic Map 20 q13.1-q13.2 UniSTS HuRef 20 45,947,232 - 45,947,359 UniSTS GeneMap99-GB4 RH Map 20 305.19 UniSTS
RH11093
Human Assembly Chr Position (strand) Source JBrowse GRCh37 20 49,199,005 - 49,199,245 UniSTS GRCh37 Build 36 20 48,632,412 - 48,632,652 RGD NCBI36 Celera 20 45,903,293 - 45,903,533 RGD Cytogenetic Map 20 q13.1-q13.2 UniSTS HuRef 20 45,947,767 - 45,948,007 UniSTS GeneMap99-GB4 RH Map 20 305.19 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
entire extraembryonic component
1204
2439
2788
2253
4974
1726
2351
6
624
1951
465
2270
7306
6472
53
3734
1
852
1744
1617
175
1
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENST00000371621 ⟹ ENSP00000360683
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 20 50,510,383 - 50,585,241 (+) Ensembl
Ensembl Acc Id:
ENST00000541713 ⟹ ENSP00000437732
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 20 50,510,321 - 50,584,760 (+) Ensembl
RefSeq Acc Id:
NM_001278618 ⟹ NP_001265547
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 20 50,510,383 - 50,585,241 (+) NCBI GRCh37 20 49,126,858 - 49,201,299 (+) NCBI HuRef 20 45,875,585 - 45,950,061 (+) NCBI CHM1_1 20 49,031,996 - 49,106,433 (+) NCBI T2T-CHM13v2.0 20 52,280,015 - 52,354,899 (+) NCBI
Sequence:
ATGAAGAAGCAGCAGCGGCTAGGGCGGCGGTAGCTGCAGGGGTCGGGGATTGCAGCGGGCCTCGGGGCTAAGAGCGCGACGCGGCCTAGAGCGGCAGACGGCGCAGTGGGCCGAGAAGGAGGCGCAGC
hide sequence
RefSeq Acc Id:
NM_002827 ⟹ NP_002818
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 20 50,510,383 - 50,585,241 (+) NCBI GRCh37 20 49,126,858 - 49,201,299 (+) NCBI Build 36 20 48,560,298 - 48,634,495 (+) NCBI Archive HuRef 20 45,875,585 - 45,950,061 (+) NCBI CHM1_1 20 49,031,996 - 49,106,433 (+) NCBI T2T-CHM13v2.0 20 52,280,015 - 52,354,899 (+) NCBI
Sequence:
ATGAAGAAGCAGCAGCGGCTAGGGCGGCGGTAGCTGCAGGGGTCGGGGATTGCAGCGGGCCTCG
hide sequence
RefSeq Acc Id:
NP_002818 ⟸ NM_002827
- Peptide Label:
isoform 1
- UniProtKB:
Q9BQV9 (UniProtKB/Swiss-Prot), Q5TGD8 (UniProtKB/Swiss-Prot), Q9NQQ4 (UniProtKB/Swiss-Prot), P18031 (UniProtKB/Swiss-Prot), A8K3M3 (UniProtKB/TrEMBL)
- Sequence:
MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQK
hide sequence
RefSeq Acc Id:
NP_001265547 ⟸ NM_001278618
- Peptide Label:
isoform 2
- UniProtKB:
B4DSN5 (UniProtKB/TrEMBL)
- Sequence:
MEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFED
hide sequence
Ensembl Acc Id:
ENSP00000437732 ⟸ ENST00000541713
Ensembl Acc Id:
ENSP00000360683 ⟸ ENST00000371621
RGD ID: 6798920 Promoter ID: HG_KWN:39808 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: CD4+TCell, CD4+TCell_12Hour, CD4+TCell_2Hour, HeLa_S3, Jurkat, K562, Lymphoblastoid, NB4 Transcripts: OTTHUMT00000079694 Position: Human Assembly Chr Position (strand) Source Build 36 20 48,560,116 - 48,560,616 (+) MPROMDB
RGD ID: 13207287 Promoter ID: EPDNEW_H27225 Type: initiation region Name: PTPN1_1 Description: protein tyrosine phosphatase, non-receptor type 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 20 50,510,383 - 50,510,443 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2019-02-19
PTPN1
protein tyrosine phosphatase non-receptor type 1
PTPN1
protein tyrosine phosphatase, non-receptor type 1
Symbol and/or name change
5135510 APPROVED
