Symbol:
Arid1a
Name:
AT-rich interaction domain 1A
RGD ID:
1321438
MGI Page
MGI
Description:
Enables ATP-dependent chromatin remodeler activity. Contributes to nucleosome binding activity. Acts upstream of or within several processes, including circulatory system development; embryo implantation; and embryonic morphogenesis. Located in chromatin. Part of SWI/SNF complex; nBAF complex; and npBAF complex. Is expressed in several structures, including alimentary system; brain; early conceptus; genitourinary system; and sensory organ. Used to study Coffin-Siris syndrome. Human ortholog(s) of this gene implicated in Coffin-Siris syndrome 2; breast cancer; carcinoma (multiple); gastrointestinal system cancer (multiple); and neuroblastoma. Orthologous to human ARID1A (AT-rich interaction domain 1A).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
1110030E03Rik; ARID domain-containing protein 1A; AT rich interactive domain 1A (SWI-like); AT rich interactive domain 1A (Swi1 like); AT-rich interactive domain-containing protein 1A; BAF25; BAF250; BAF250a; BRG1-associated factor 250; BRG1-associated factor 250a; O; osa homolog 1; Osa1; Smar; Smarcf1; SWI-like protein; SWI-SNF complex protein p270; SWI/SNF complex protein p270; SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily f, member 1; SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatin subfamily F member 1; Swi1 like
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
ARID1A (AT-rich interaction domain 1A) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Arid1a (AT-rich interaction domain 1A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Arid1a (AT-rich interaction domain 1A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
ARID1A (AT-rich interaction domain 1A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
ARID1A (AT-rich interaction domain 1A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Arid1a (AT-rich interaction domain 1A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
ARID1A (AT-rich interaction domain 1A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
ARID1A (AT-rich interaction domain 1A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Arid1a (AT-rich interaction domain 1A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
ARID1B (AT-rich interaction domain 1B) HGNC
OrthoMCL
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Arid1a (AT-rich interaction domain 1A)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
ARID1A (AT-rich interaction domain 1A)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
arid1aa (AT rich interactive domain 1Aa (SWI-like))
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Danio rerio (zebrafish):
arid1ab (AT rich interactive domain 1Ab (SWI-like))
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Caenorhabditis elegans (roundworm):
let-526
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
osa
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
arid1a
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Related Pseudogenes:
Gm8134
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 133,406,319 - 133,484,682 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 133,406,319 - 133,484,080 (-) Ensembl GRCm39 Ensembl GRCm38 4 133,679,008 - 133,756,769 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 133,679,008 - 133,756,769 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 133,234,923 - 133,309,526 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 132,951,084 - 133,029,633 (-) NCBI MGSCv36 mm8 Celera 4 131,854,780 - 131,931,113 (-) NCBI Celera Cytogenetic Map 4 D2.3 NCBI cM Map 4 66.25 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Arid1a Mouse (1->4)-beta-D-glucan multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of ARID1A mRNA CTD PMID:36331819 Arid1a Mouse (S)-nicotine decreases expression EXP 6480464 Nicotine results in decreased expression of ARID1A mRNA CTD PMID:17997037 Arid1a Mouse 1,2-dichloroethane increases expression EXP 6480464 ethylene dichloride results in increased expression of ARID1A mRNA CTD PMID:28960355 Arid1a Mouse 1,2-dimethylhydrazine multiple interactions EXP 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of ARID1A mRNA CTD PMID:22206623 Arid1a Mouse 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of ARID1A mRNA CTD PMID:39298647 Arid1a Mouse 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions EXP 6480464 [2 more ... CTD PMID:25510870 Arid1a Mouse 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO ARID1A (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Arid1a Mouse 2,2',5,5'-tetrachlorobiphenyl multiple interactions EXP 6480464 [2 more ... CTD PMID:25510870 Arid1a Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Arid1a (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in increased expression of ARID1A mRNA CTD PMID:34747641 Arid1a Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Arid1a (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of ARID1A mRNA CTD PMID:33387578 Arid1a Mouse 2,4,6-tribromophenol decreases expression ISO ARID1A (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Arid1a Mouse 2,4-dinitrotoluene affects expression ISO Arid1a (Rattus norvegicus) 6480464 2 and 4-dinitrotoluene affects the expression of ARID1A mRNA CTD PMID:21346803 Arid1a Mouse 2,6-dinitrotoluene affects expression ISO Arid1a (Rattus norvegicus) 6480464 2 and 6-dinitrotoluene affects the expression of ARID1A mRNA CTD PMID:21346803 Arid1a Mouse 2-hydroxypropanoic acid increases expression ISO ARID1A (Homo sapiens) 6480464 Lactic Acid results in increased expression of ARID1A mRNA CTD PMID:30851411 Arid1a Mouse 3,3',5,5'-tetrabromobisphenol A decreases expression ISO ARID1A (Homo sapiens) 6480464 tetrabromobisphenol A results in decreased expression of ARID1A protein CTD PMID:31675489 Arid1a Mouse 4,4'-sulfonyldiphenol decreases expression EXP 6480464 bisphenol S results in decreased expression of ARID1A mRNA CTD PMID:39298647 Arid1a Mouse 4,4'-sulfonyldiphenol affects methylation EXP 6480464 bisphenol S affects the methylation of ARID1A gene CTD PMID:31683443 Arid1a Mouse 4,4'-sulfonyldiphenol multiple interactions ISO Arid1a (Rattus norvegicus) 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of ARID1A mRNA CTD PMID:36041667 Arid1a Mouse 4,4'-sulfonyldiphenol increases methylation EXP 6480464 bisphenol S results in increased methylation of ARID1A exon CTD PMID:33297965 Arid1a Mouse aflatoxin B1 decreases methylation ISO ARID1A (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of ARID1A gene and Aflatoxin B1 results in decreased methylation of ARID1A intron CTD PMID:27153756 and PMID:30157460 Arid1a Mouse aristolochic acid A decreases expression ISO ARID1A (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of ARID1A mRNA CTD PMID:33212167 Arid1a Mouse arsane multiple interactions ISO ARID1A (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of ARID1A mRNA CTD PMID:39836092 Arid1a Mouse arsenic atom multiple interactions ISO ARID1A (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of ARID1A mRNA CTD PMID:39836092 Arid1a Mouse arsenous acid increases sumoylation ISO ARID1A (Homo sapiens) 6480464 Arsenic Trioxide results in increased sumoylation of ARID1A protein CTD PMID:28318385 Arid1a Mouse arsenous acid increases response to substance ISO ARID1A (Homo sapiens) 6480464 ARID1A protein results in increased susceptibility to Arsenic Trioxide CTD PMID:20707922 Arid1a Mouse benzo[a]pyrene diol epoxide I decreases expression ISO ARID1A (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 more ... Arid1a Mouse beta-lapachone increases expression ISO ARID1A (Homo sapiens) 6480464 beta-lapachone results in increased expression of ARID1A mRNA CTD PMID:38218311 Arid1a Mouse bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of ARID1A mRNA CTD PMID:26063408 Arid1a Mouse bisphenol A multiple interactions ISO Arid1a (Rattus norvegicus) 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of ARID1A mRNA CTD PMID:36041667 Arid1a Mouse bisphenol A increases methylation ISO ARID1A (Homo sapiens) 6480464 bisphenol A results in increased methylation of ARID1A gene CTD PMID:31601247 Arid1a Mouse bisphenol A decreases expression ISO ARID1A (Homo sapiens) 6480464 bisphenol A results in decreased expression of ARID1A protein CTD PMID:31675489 Arid1a Mouse bisphenol A multiple interactions ISO ARID1A (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of ARID1A gene CTD PMID:31601247 Arid1a Mouse bisphenol A decreases expression ISO Arid1a (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of ARID1A mRNA CTD PMID:32145629 Arid1a Mouse bisphenol A increases expression ISO Arid1a (Rattus norvegicus) 6480464 bisphenol A results in increased expression of ARID1A mRNA CTD PMID:25181051 and PMID:30816183 Arid1a Mouse bisphenol F multiple interactions ISO Arid1a (Rattus norvegicus) 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of ARID1A mRNA CTD PMID:36041667 Arid1a Mouse buta-1,3-diene decreases expression EXP 6480464 1 and 3-butadiene results in decreased expression of ARID1A mRNA CTD PMID:29038090 Arid1a Mouse butanal decreases expression ISO ARID1A (Homo sapiens) 6480464 butyraldehyde results in decreased expression of ARID1A mRNA CTD PMID:26079696 Arid1a Mouse cadmium atom multiple interactions ISO ARID1A (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of ARID1A mRNA CTD PMID:35301059 Arid1a Mouse cadmium dichloride increases expression ISO ARID1A (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of ARID1A mRNA CTD PMID:38382870 Arid1a Mouse cadmium dichloride multiple interactions ISO ARID1A (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of ARID1A mRNA CTD PMID:35301059 Arid1a Mouse caffeine affects phosphorylation ISO ARID1A (Homo sapiens) 6480464 Caffeine affects the phosphorylation of ARID1A protein CTD PMID:35688186 Arid1a Mouse carbon nanotube decreases expression EXP 6480464 Nanotubes and Carbon analog results in decreased expression of ARID1A mRNA CTD PMID:25554681 Arid1a Mouse CGP 52608 multiple interactions ISO ARID1A (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to ARID1A gene] CTD PMID:28238834 Arid1a Mouse choline multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of ARID1A gene CTD PMID:20938992 Arid1a Mouse cisplatin decreases expression ISO ARID1A (Homo sapiens) 6480464 Cisplatin results in decreased expression of ARID1A mRNA CTD PMID:27594783 Arid1a Mouse clofibrate decreases expression EXP 6480464 Clofibrate results in decreased expression of ARID1A mRNA CTD PMID:17585979 Arid1a Mouse cobalt dichloride decreases expression ISO ARID1A (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of ARID1A mRNA CTD PMID:19376846 Arid1a Mouse coumarin affects phosphorylation ISO ARID1A (Homo sapiens) 6480464 coumarin affects the phosphorylation of ARID1A protein CTD PMID:35688186 Arid1a Mouse crocidolite asbestos affects expression ISO ARID1A (Homo sapiens) 6480464 Asbestos and Crocidolite affects the expression of ARID1A mRNA CTD PMID:17331233 Arid1a Mouse decabromodiphenyl ether decreases expression ISO ARID1A (Homo sapiens) 6480464 decabromobiphenyl ether results in decreased expression of ARID1A protein CTD PMID:31675489 Arid1a Mouse diarsenic trioxide increases sumoylation ISO ARID1A (Homo sapiens) 6480464 Arsenic Trioxide results in increased sumoylation of ARID1A protein CTD PMID:28318385 Arid1a Mouse diarsenic trioxide increases response to substance ISO ARID1A (Homo sapiens) 6480464 ARID1A protein results in increased susceptibility to Arsenic Trioxide CTD PMID:20707922 Arid1a Mouse diazinon increases methylation ISO ARID1A (Homo sapiens) 6480464 Diazinon results in increased methylation of ARID1A gene CTD PMID:22964155 Arid1a Mouse dicrotophos increases expression ISO ARID1A (Homo sapiens) 6480464 dicrotophos results in increased expression of ARID1A mRNA CTD PMID:28302478 Arid1a Mouse dioxygen multiple interactions EXP 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of ARID1A mRNA CTD PMID:30529165 Arid1a Mouse diuron decreases expression ISO ARID1A (Homo sapiens) 6480464 Diuron results in decreased expression of ARID1A mRNA CTD PMID:35967413 Arid1a Mouse dorsomorphin multiple interactions ISO ARID1A (Homo sapiens) 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ARID1A mRNA CTD PMID:27188386 Arid1a Mouse enzyme inhibitor multiple interactions ISO ARID1A (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of ARID1A protein CTD PMID:23301498 Arid1a Mouse ethanol affects splicing EXP 6480464 Ethanol affects the splicing of ARID1A mRNA CTD PMID:30319688 Arid1a Mouse folic acid multiple interactions EXP 6480464 [1 more ... CTD PMID:20938992 and PMID:22206623 Arid1a Mouse formaldehyde decreases expression ISO ARID1A (Homo sapiens) 6480464 Formaldehyde results in decreased expression of ARID1A mRNA CTD PMID:20655997 Arid1a Mouse FR900359 increases phosphorylation ISO ARID1A (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of ARID1A protein CTD PMID:37730182 Arid1a Mouse fulvestrant increases expression ISO ARID1A (Homo sapiens) 6480464 fulvestrant results in increased expression of ARID1A protein CTD PMID:24169358 Arid1a Mouse fulvestrant multiple interactions ISO ARID1A (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of ARID1A gene CTD PMID:31601247 Arid1a Mouse fulvestrant decreases response to substance ISO ARID1A (Homo sapiens) 6480464 ARID1A gene mutant form results in decreased susceptibility to Fulvestrant CTD PMID:31932695 Arid1a Mouse furan increases methylation ISO Arid1a (Rattus norvegicus) 6480464 furan results in increased methylation of ARID1A gene CTD PMID:22079235 Arid1a Mouse gentamycin increases expression ISO Arid1a (Rattus norvegicus) 6480464 Gentamicins results in increased expression of ARID1A mRNA CTD PMID:22061828 Arid1a Mouse hexadecanoic acid decreases phosphorylation ISO ARID1A (Homo sapiens) 6480464 Palmitic Acid results in decreased phosphorylation of ARID1A protein CTD PMID:28073184 Arid1a Mouse indometacin decreases expression ISO ARID1A (Homo sapiens) 6480464 Indomethacin results in decreased expression of ARID1A mRNA CTD PMID:16984733 Arid1a Mouse inulin multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of ARID1A mRNA CTD PMID:36331819 Arid1a Mouse L-methionine multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of ARID1A gene CTD PMID:20938992 Arid1a Mouse Lasiocarpine multiple interactions ISO ARID1A (Homo sapiens) 6480464 [CYP3A4 protein results in increased metabolism of lasiocarpine] which results in decreased expression of ARID1A mRNA CTD PMID:33884520 Arid1a Mouse manganese atom multiple interactions ISO ARID1A (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in decreased expression of ARID1A mRNA CTD PMID:39836092 Arid1a Mouse manganese(0) multiple interactions ISO ARID1A (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in decreased expression of ARID1A mRNA CTD PMID:39836092 Arid1a Mouse manganese(II) chloride multiple interactions ISO ARID1A (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in decreased expression of ARID1A mRNA CTD PMID:39836092 Arid1a Mouse mercury atom increases expression ISO ARID1A (Homo sapiens) 6480464 Mercury results in increased expression of ARID1A mRNA CTD PMID:19937285 Arid1a Mouse mercury(0) increases expression ISO ARID1A (Homo sapiens) 6480464 Mercury results in increased expression of ARID1A mRNA CTD PMID:19937285 Arid1a Mouse methamphetamine increases expression EXP 6480464 Methamphetamine results in increased expression of ARID1A mRNA CTD PMID:26307267 Arid1a Mouse methamphetamine increases methylation EXP 6480464 Methamphetamine results in increased methylation of ARID1A promoter CTD PMID:26307267 Arid1a Mouse methidathion increases expression EXP 6480464 methidathion results in increased expression of ARID1A mRNA CTD PMID:34813904 Arid1a Mouse methotrexate affects expression EXP 6480464 Methotrexate affects the expression of ARID1A mRNA CTD PMID:18502557 Arid1a Mouse methylmercury chloride increases expression ISO ARID1A (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of ARID1A mRNA CTD PMID:26272509 Arid1a Mouse methylmercury chloride multiple interactions ISO ARID1A (Homo sapiens) 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ARID1A mRNA CTD PMID:27188386 Arid1a Mouse monocrotaline multiple interactions ISO ARID1A (Homo sapiens) 6480464 [CYP3A4 protein results in increased metabolism of Monocrotaline] which results in decreased expression of ARID1A mRNA CTD PMID:33884520 Arid1a Mouse nefazodone decreases expression ISO Arid1a (Rattus norvegicus) 6480464 nefazodone results in decreased expression of ARID1A mRNA CTD PMID:24136188 Arid1a Mouse nicotine decreases expression EXP 6480464 Nicotine results in decreased expression of ARID1A mRNA CTD PMID:17997037 Arid1a Mouse paracetamol decreases expression ISO ARID1A (Homo sapiens) 6480464 Acetaminophen results in decreased expression of ARID1A mRNA CTD PMID:21420995 Arid1a Mouse paracetamol decreases expression ISO Arid1a (Rattus norvegicus) 6480464 Acetaminophen results in decreased expression of ARID1A mRNA CTD PMID:33387578 Arid1a Mouse PCB138 multiple interactions EXP 6480464 [2 more ... CTD PMID:25510870 Arid1a Mouse perfluorooctane-1-sulfonic acid multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of ARID1A mRNA and [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of ARID1A mRNA CTD PMID:36331819 Arid1a Mouse perfluorooctanoic acid decreases expression ISO ARID1A (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of ARID1A protein CTD PMID:26879310 Arid1a Mouse phenobarbital affects expression EXP 6480464 Phenobarbital affects the expression of ARID1A mRNA CTD PMID:23091169 Arid1a Mouse profenofos decreases expression ISO Arid1a (Rattus norvegicus) 6480464 profenofos results in decreased expression of ARID1A mRNA CTD PMID:17569032 Arid1a Mouse promegestone multiple interactions ISO ARID1A (Homo sapiens) 6480464 Promegestone promotes the reaction [ARID1A protein binds to PGR protein] CTD PMID:19609353 Arid1a Mouse quercetin decreases phosphorylation ISO ARID1A (Homo sapiens) 6480464 Quercetin results in decreased phosphorylation of ARID1A protein CTD PMID:35688186 Arid1a Mouse rac-lactic acid increases expression ISO ARID1A (Homo sapiens) 6480464 Lactic Acid results in increased expression of ARID1A mRNA CTD PMID:30851411 Arid1a Mouse resveratrol multiple interactions ISO ARID1A (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of ARID1A mRNA CTD PMID:23557933 Arid1a Mouse SB 431542 multiple interactions ISO ARID1A (Homo sapiens) 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ARID1A mRNA CTD PMID:27188386 Arid1a Mouse sodium arsenite increases expression ISO ARID1A (Homo sapiens) 6480464 sodium arsenite results in increased expression of ARID1A mRNA CTD PMID:38568856 Arid1a Mouse sodium arsenite multiple interactions ISO ARID1A (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of ARID1A mRNA CTD PMID:39836092 Arid1a Mouse thioacetamide increases expression ISO Arid1a (Rattus norvegicus) 6480464 Thioacetamide results in increased expression of ARID1A mRNA CTD PMID:34492290 Arid1a Mouse titanium dioxide increases methylation EXP 6480464 titanium dioxide results in increased methylation of ARID1A promoter CTD PMID:35295148 Arid1a Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of ARID1A gene and titanium dioxide results in decreased methylation of ARID1A promoter CTD PMID:35295148 Arid1a Mouse trichostatin A affects expression ISO ARID1A (Homo sapiens) 6480464 trichostatin A affects the expression of ARID1A mRNA CTD PMID:28542535 Arid1a Mouse triphenyl phosphate affects expression ISO ARID1A (Homo sapiens) 6480464 triphenyl phosphate affects the expression of ARID1A mRNA CTD PMID:37042841 Arid1a Mouse Triptolide increases expression EXP 6480464 triptolide results in increased expression of ARID1A mRNA CTD PMID:32835833 Arid1a Mouse triptonide increases expression EXP 6480464 triptonide results in increased expression of ARID1A mRNA CTD PMID:33045310 Arid1a Mouse troglitazone decreases expression EXP 6480464 troglitazone results in decreased expression of ARID1A mRNA CTD PMID:28973697 Arid1a Mouse tungsten decreases expression EXP 6480464 Tungsten results in decreased expression of ARID1A mRNA CTD PMID:30912803 Arid1a Mouse valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of ARID1A mRNA CTD PMID:21427059 Arid1a Mouse valproic acid increases methylation ISO ARID1A (Homo sapiens) 6480464 Valproic Acid results in increased methylation of ARID1A gene CTD PMID:29154799 Arid1a Mouse vinclozolin increases expression ISO Arid1a (Rattus norvegicus) 6480464 vinclozolin results in increased expression of ARID1A mRNA CTD PMID:23034163 Arid1a Mouse zinc atom increases expression ISO ARID1A (Homo sapiens) 6480464 Zinc deficiency results in increased expression of ARID1A mRNA CTD PMID:18356318 Arid1a Mouse zinc(0) increases expression ISO ARID1A (Homo sapiens) 6480464 Zinc deficiency results in increased expression of ARID1A mRNA CTD PMID:18356318
(1->4)-beta-D-glucan (EXP) (S)-nicotine (EXP) 1,2-dichloroethane (EXP) 1,2-dimethylhydrazine (EXP) 17beta-estradiol (EXP) 2,2',4,4',5,5'-hexachlorobiphenyl (EXP) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,2',5,5'-tetrachlorobiphenyl (EXP) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4,6-tribromophenol (ISO) 2,4-dinitrotoluene (ISO) 2,6-dinitrotoluene (ISO) 2-hydroxypropanoic acid (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) aflatoxin B1 (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) benzo[a]pyrene diol epoxide I (ISO) beta-lapachone (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) buta-1,3-diene (EXP) butanal (ISO) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (ISO) carbon nanotube (EXP) CGP 52608 (ISO) choline (EXP) cisplatin (ISO) clofibrate (EXP) cobalt dichloride (ISO) coumarin (ISO) crocidolite asbestos (ISO) decabromodiphenyl ether (ISO) diarsenic trioxide (ISO) diazinon (ISO) dicrotophos (ISO) dioxygen (EXP) diuron (ISO) dorsomorphin (ISO) enzyme inhibitor (ISO) ethanol (EXP) folic acid (EXP) formaldehyde (ISO) FR900359 (ISO) fulvestrant (ISO) furan (ISO) gentamycin (ISO) hexadecanoic acid (ISO) indometacin (ISO) inulin (EXP) L-methionine (EXP) Lasiocarpine (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) mercury atom (ISO) mercury(0) (ISO) methamphetamine (EXP) methidathion (EXP) methotrexate (EXP) methylmercury chloride (ISO) monocrotaline (ISO) nefazodone (ISO) nicotine (EXP) paracetamol (ISO) PCB138 (EXP) perfluorooctane-1-sulfonic acid (EXP) perfluorooctanoic acid (ISO) phenobarbital (EXP) profenofos (ISO) promegestone (ISO) quercetin (ISO) rac-lactic acid (ISO) resveratrol (ISO) SB 431542 (ISO) sodium arsenite (ISO) thioacetamide (ISO) titanium dioxide (EXP) trichostatin A (ISO) triphenyl phosphate (ISO) Triptolide (EXP) triptonide (EXP) troglitazone (EXP) tungsten (EXP) valproic acid (EXP,ISO) vinclozolin (ISO) zinc atom (ISO) zinc(0) (ISO)
Cellular Component
bBAF complex (NAS) brahma complex (NAS) chromatin (IDA,ISO,NAS) nBAF complex (IBA,IDA,NAS) npBAF complex (IDA,NAS) nucleoplasm (IBA,ISO,TAS) SWI/SNF complex (IBA,IDA,ISO,ISS,NAS)
1.
High Beclin-1 and ARID1A expression corelates with poor survival and high recurrence in intrahepatic cholangiocarcinoma: a histopathological retrospective study.
Bi C, etal., BMC Cancer. 2019 Mar 8;19(1):213. doi: 10.1186/s12885-019-5429-3.
2.
Hepatocyte-Specific Arid1a Deficiency Initiates Mouse Steatohepatitis and Hepatocellular Carcinoma.
Fang JZ, etal., PLoS One. 2015 Nov 16;10(11):e0143042. doi: 10.1371/journal.pone.0143042. eCollection 2015.
3.
AT-rich interactive domain 1A protein expression in normal and pathological pregnancies complicated by preeclampsia.
Fantone S, etal., Histochem Cell Biol. 2020 Sep;154(3):339-346. doi: 10.1007/s00418-020-01892-8. Epub 2020 Jun 11.
4.
Comprehensive analysis of genomic alterations of Chinese hilar cholangiocarcinoma patients.
Feng F, etal., Int J Clin Oncol. 2021 Apr;26(4):717-727. doi: 10.1007/s10147-020-01846-z. Epub 2021 Jan 2.
5.
Mouse brain organization revealed through direct genome-scale TF expression analysis.
Gray PA, etal., Science 2004 Dec 24;306(5705):2255-7.
6.
ARID1A, a factor that promotes formation of SWI/SNF-mediated chromatin remodeling, is a tumor suppressor in gynecologic cancers.
Guan B, etal., Cancer Res. 2011 Nov 1;71(21):6718-27. doi: 10.1158/0008-5472.CAN-11-1562. Epub 2011 Sep 7.
7.
ATP-dependent chromatin remodeling: genetics, genomics and mechanisms.
Hargreaves DC and Crabtree GR, Cell Res. 2011 Mar;21(3):396-420. doi: 10.1038/cr.2011.32. Epub 2011 Mar 1.
8.
Decreased expression of ARID1A associates with poor prognosis and promotes metastases of hepatocellular carcinoma.
He F, etal., J Exp Clin Cancer Res. 2015 May 15;34:47. doi: 10.1186/s13046-015-0164-3.
9.
Arid1a regulates response to anti-angiogenic therapy in advanced hepatocellular carcinoma.
Hu C, etal., J Hepatol. 2018 Mar;68(3):465-475. doi: 10.1016/j.jhep.2017.10.028. Epub 2017 Nov 4.
10.
ARID1A expression in gastric adenocarcinoma: clinicopathological significance and correlation with DNA mismatch repair status.
Inada R, etal., World J Gastroenterol. 2015 Feb 21;21(7):2159-68. doi: 10.3748/wjg.v21.i7.2159.
11.
Functional annotation of a full-length mouse cDNA collection.
Kawai J, etal., Nature. 2001 Feb 8;409(6821):685-90.
12.
Associations Between Loss of ARID1A Expression and Clinicopathologic and Genetic Variables in T1 Early Colorectal Cancer.
Kishida Y, etal., Am J Clin Pathol. 2019 Sep 9;152(4):463-470. doi: 10.1093/ajcp/aqz062.
13.
MGDs mouse GO annotations
MGD data from the GO Consortium
14.
Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.
Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
15.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
16.
AT-rich Interaction Domain 1A Gene Variations: Genetic Associations and Susceptibility to Gastric Cancer Risk.
Qadir J, etal., Pathol Oncol Res. 2020 Oct;26(4):2237-2246. doi: 10.1007/s12253-020-00815-1. Epub 2020 May 6.
17.
Mouse MP Annotation Import Pipeline
RGD automated import pipeline
18.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
19.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
20.
Heterogeneity of ARID1A expression in gastric cancer may affect patient survival and therapeutic efficacy.
Saito M, etal., Hum Pathol. 2020 Jul;101:80-81. doi: 10.1016/j.humpath.2020.04.009. Epub 2020 May 7.
21.
Integrated genomic analyses identify ARID1A and ARID1B alterations in the childhood cancer neuroblastoma.
Sausen M, etal., Nat Genet. 2013 Jan;45(1):12-7. doi: 10.1038/ng.2493. Epub 2012 Dec 2.
22.
Loss of the SWI/SNF-ATPase subunit members SMARCF1 (ARID1A), SMARCA2 (BRM), SMARCA4 (BRG1) and SMARCB1 (INI1) in oesophageal adenocarcinoma.
Schallenberg S, etal., BMC Cancer. 2020 Jan 6;20(1):12. doi: 10.1186/s12885-019-6425-3.
23.
The spectrum of SWI/SNF mutations, ubiquitous in human cancers.
Shain AH and Pollack JR, PLoS One. 2013;8(1):e55119. doi: 10.1371/journal.pone.0055119. Epub 2013 Jan 23.
24.
ARID1A Deficiency Impairs the DNA Damage Checkpoint and Sensitizes Cells to PARP Inhibitors.
Shen J, etal., Cancer Discov. 2015 Jul;5(7):752-67. doi: 10.1158/2159-8290.CD-14-0849. Epub 2015 Jun 11.
25.
Subunits of ARID1 serve as novel biomarkers for the sensitivity to immune checkpoint inhibitors and prognosis of advanced non-small cell lung cancer.
Sun D, etal., Mol Med. 2020 Aug 13;26(1):78. doi: 10.1186/s10020-020-00208-9.
26.
Arid1a Has Context-Dependent Oncogenic and Tumor Suppressor Functions in Liver Cancer.
Sun X, etal., Cancer Cell. 2017 Nov 13;32(5):574-589.e6. doi: 10.1016/j.ccell.2017.10.007.
27.
Decreased expression of the ARID1A gene is associated with poor prognosis in primary gastric cancer.
Wang DD, etal., PLoS One. 2012;7(7):e40364. doi: 10.1371/journal.pone.0040364. Epub 2012 Jul 13.
28.
Clinicopathologic and prognostic relevance of ARID1A protein loss in colorectal cancer.
Wei XL, etal., World J Gastroenterol. 2014 Dec 28;20(48):18404-12. doi: 10.3748/wjg.v20.i48.18404.
29.
NF-κB/miR-223-3p/ARID1A axis is involved in Helicobacter pylori CagA-induced gastric carcinogenesis and progression.
Yang F, etal., Cell Death Dis. 2018 Jan 9;9(1):12. doi: 10.1038/s41419-017-0020-9.
30.
Low expression of ARID1A correlates with poor prognosis in intrahepatic cholangiocarcinoma.
Yang SZ, etal., World J Gastroenterol. 2016 Jul 7;22(25):5814-21. doi: 10.3748/wjg.v22.i25.5814.
31.
Loss of ARID1A promotes proliferation, migration and invasion via the Akt signaling pathway in NPC.
Yang Y, etal., Cancer Manag Res. 2019 May 29;11:4931-4946. doi: 10.2147/CMAR.S207329. eCollection 2019.
32.
Loss of ARID1A induces a stemness gene ALDH1A1 expression with histone acetylation in the malignant subtype of cholangiocarcinoma.
Yoshino J, etal., Carcinogenesis. 2020 Jul 10;41(6):734-742. doi: 10.1093/carcin/bgz179.
33.
Chromatin remodeling gene AT-rich interactive domain-containing protein 1A suppresses gastric cancer cell proliferation by targeting PIK3CA and PDK1.
Zhang Q, etal., Oncotarget. 2016 Jul 19;7(29):46127-46141. doi: 10.18632/oncotarget.10060.
34.
[Expression and clinical significance of ARID1A in gastric cancer and paired adjacent noncancerous tissues].
Zhang X, etal., Xi Bao Yu Fen Zi Mian Yi Xue Za Zhi. 2017 Jan;33(1):77-80.
35.
ARID1A is downregulated in non-small cell lung cancer and regulates cell proliferation and apoptosis.
Zhang Y, etal., Tumour Biol. 2014 Jun;35(6):5701-7. doi: 10.1007/s13277-014-1755-x. Epub 2014 Feb 26.
36.
The Clinicopathologic Significance of BAF250a (ARID1A) Expression in Hepatocellular Carcinoma.
Zhao J, etal., Pathol Oncol Res. 2016 Jul;22(3):453-9. doi: 10.1007/s12253-015-0022-9. Epub 2015 Nov 20.
37.
Expression and significance of EBV, ARID1A and PIK3CA in gastric carcinoma.
Zhou H, etal., Mol Med Rep. 2019 Mar;19(3):2125-2136. doi: 10.3892/mmr.2019.9886. Epub 2019 Jan 22.
38.
Loss of ARID1A expression is associated with poor prognosis in patients with gastric cancer.
Zhu YP, etal., Hum Pathol. 2018 Aug;78:28-35. doi: 10.1016/j.humpath.2018.04.003. Epub 2018 Apr 22.
Arid1a Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 133,406,319 - 133,484,682 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 133,406,319 - 133,484,080 (-) Ensembl GRCm39 Ensembl GRCm38 4 133,679,008 - 133,756,769 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 133,679,008 - 133,756,769 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 133,234,923 - 133,309,526 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 132,951,084 - 133,029,633 (-) NCBI MGSCv36 mm8 Celera 4 131,854,780 - 131,931,113 (-) NCBI Celera Cytogenetic Map 4 D2.3 NCBI cM Map 4 66.25 NCBI
ARID1A Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 26,696,015 - 26,782,104 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 26,693,236 - 26,782,104 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 27,022,506 - 27,108,595 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 26,895,109 - 26,981,188 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 26,706,666 - 26,792,737 NCBI Celera 1 25,419,777 - 25,505,606 (+) NCBI Celera Cytogenetic Map 1 p36.11 NCBI HuRef 1 25,309,350 - 25,361,809 (+) NCBI HuRef CHM1_1 1 27,135,825 - 27,221,852 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 26,533,960 - 26,620,059 (+) NCBI T2T-CHM13v2.0
Arid1a Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 151,192,014 - 151,269,291 (-) NCBI GRCr8 mRatBN7.2 5 145,908,173 - 145,981,552 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 145,908,181 - 145,985,564 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 148,610,576 - 148,683,764 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 150,380,181 - 150,453,373 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 150,366,738 - 150,439,933 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 151,904,687 - 151,977,973 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 151,904,684 - 151,977,636 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 155,592,617 - 155,665,889 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 151,355,617 - 151,398,647 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 151,335,330 - 151,408,688 (+) NCBI Celera 5 144,329,185 - 144,372,216 (-) NCBI Celera Cytogenetic Map 5 q36 NCBI
Arid1a Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955452 6,068,631 - 6,120,759 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955452 6,068,631 - 6,120,759 (+) NCBI ChiLan1.0 ChiLan1.0
ARID1A Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 200,085,631 - 200,171,818 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 199,189,927 - 199,276,131 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 25,960,868 - 26,047,057 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 27,019,596 - 27,103,239 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 27,018,616 - 27,103,239 (+) Ensembl panpan1.1 panPan2
ARID1A Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 2 73,331,606 - 73,401,151 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 2 73,324,852 - 73,401,102 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 2 69,909,026 - 69,978,542 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 2 73,894,794 - 73,964,327 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 2 73,895,984 - 73,965,235 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 2 70,719,680 - 70,789,191 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 2 71,725,226 - 71,794,735 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 2 72,728,646 - 72,798,165 (-) NCBI UU_Cfam_GSD_1.0
Arid1a
ARID1A Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 84,049,087 - 84,123,349 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 84,049,729 - 84,124,302 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 77,607,507 - 77,623,800 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ARID1A Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 105,981,549 - 106,066,093 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 105,981,290 - 106,065,672 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666033 10,365,063 - 10,448,898 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Arid1a
.
Predicted Target Of
Count of predictions: 1561 Count of miRNA genes: 565 Interacting mature miRNAs: 664 Transcripts: ENSMUST00000008024, ENSMUST00000105897, ENSMUST00000138473, ENSMUST00000139709, ENSMUST00000145664, ENSMUST00000168582 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1301267 Bcmd2_m B cell maturation defect 2 (mouse) Not determined 4 133154678 150789451 Mouse 4142139 Adip12_m adiposity 12 (mouse) Not determined 4 124621281 156860686 Mouse 25394567 Skmw55_m skeletal muscle weight 55, gastroc (mouse) 4 131437804 133710576 Mouse 10047132 Albq19_m albuminuria QTL 19 (mouse) Not determined 4 112824389 146824389 Mouse 1301525 Lmb1_m lupus in MRL and B6 F2 cross (mouse) Not determined 4 124264957 150676858 Mouse 14746982 Manh56_m mandible shape 56 (mouse) 4 117815917 151815917 Mouse 4141623 W6q13_m weight 6 weeks QTL 13 (mouse) Not determined 88982069 140468203 Mouse 12910797 Pwgrq4_m pre-weaning growth rate QTL 4 (mouse) 4 105835310 141433838 Mouse 14696808 Rbcn1_m rod bipolar cell number 1 (mouse) 4 131947311 134047311 Mouse 25314312 Syncl2_m synaptonemal complex length 2 (mouse) 4 65718237 146584457 Mouse 25394568 Skmw56_m skeletal muscle weight 56, EDL (mouse) 4 129859344 133710576 Mouse 12904009 Cfq9_m conditioned fear QTL 9 (mouse) 4 130036287 133772722 Mouse 12910794 Pwbwq8_m post-weaning body weight QTL 8 (mouse) 4 105835310 141433838 Mouse 1300743 Skull6_m skull morphology 6 (mouse) Not determined 4 111009051 145009280 Mouse 1301382 Arvm2_m autoimmune renal vasculitis 2 (mouse) Not determined 4 107791564 141791756 Mouse 1302149 Tlsr2_m thymic lymphoma suppressor region 2 (mouse) Not determined 4 124264957 142230960 Mouse 12910813 Pwbwq4_m pre-weaning body weight QTL 4 (mouse) 4 105835310 141433838 Mouse 1300874 Gasa2_m gastritis type A susceptibility locus 2 (mouse) Not determined 4 133010494 156860686 Mouse 4141093 W3q17_m weight 3 weeks QTL 17 (mouse) Not determined 88982069 140468203 Mouse 27226757 Femd1_m femur midshaft diameter 1, 5 week (mouse) 4 123993793 144326570 Mouse 12910808 Pwbwq9_m post-weaning body weight QTL 9 (mouse) 4 105835310 141433838 Mouse 1300621 Tpnr1_m thermal pain response 1 (mouse) Not determined 4 125230872 156860686 Mouse 11567249 Elorr3_m ethanol induced loss of righting response 3 (mouse) 4 3722677 156268235 Mouse 4142493 Femwf13_m femur work to failure 13 (mouse) Not determined 116154678 150154782 Mouse 1301815 Sles2_m systemic lupus erythmatosus suppressor 2 (mouse) Not determined 4 94957579 150676858 Mouse 1300663 Start2_m startle response 2 (mouse) Not determined 4 107264957 141265153 Mouse 1300917 Gasa1_m gastritis type A susceptibility locus 1 (mouse) Not determined 4 124055093 142438020 Mouse 1301823 Bmd7_m bone mineral density 7 (mouse) Not determined 4 88982069 151654550 Mouse 10412210 Cypr6_m cytokine production 6 (mouse) Not determined 4 120617848 154617995 Mouse 1302078 Sluc21_m susceptibility to lung cancer 21 (mouse) Not determined 4 117401141 151401275 Mouse 10045620 Heal22_m wound healing/regeneration 22 (mouse) Not determined 4 125230872 156860686 Mouse 4142481 Gct1_m granulosa cell tumorigenesis 1 (mouse) Not determined 4 127784226 156860686 Mouse 1301793 Tlsr3_m thymic lymphoma suppressor region 3 (mouse) Not determined 4 129465811 136864536 Mouse 4141065 Shali2_m survival time to hyperoxic acute lung injury 2 (mouse) Not determined 124055093 141572792 Mouse 13503348 Bntq18_m bone traits QTL 18 (mouse) 4 120617848 154617995 Mouse 13208562 Wght7_m weight 7 (mouse) 4 90888237 148084457 Mouse 4142082 Psds2_m psoriasis-like skin disease severity 2 (mouse) Not determined 4 133154678 137617995 Mouse 1300781 Lith8_m lithogenic gene 8 (mouse) Not determined 4 107264957 141265153 Mouse 39128212 Lwq21_m liver weight QTL 21 (mouse) 4 88982069 140468203 Mouse 4141180 Ssic1_m susceptibility to small intestinal cancer 1 (mouse) Not determined 120674005 154674151 Mouse 1301584 Lrdg2_m light induced retinal degeneration 2 (mouse) Not determined 4 129465811 151654550 Mouse 1301847 Fecq2_m fecundity QTL 2 (mouse) Not determined 4 100071971 134072206 Mouse 1302102 Bis1_m beta-carboline-induced seizures 1 (mouse) Not determined 4 119864433 153864536 Mouse 10043996 Gct5_m granulosa cell tumorigenesis 5 (mouse) Not determined 4 127784226 156860686 Mouse 26884445 Sklq7_m skull length QTL 7, 10 week (mouse) 4 68018237 150884457 Mouse 10043985 Stheal12_m soft tissue heal 12 (mouse) Not determined 4 121342649 155342753 Mouse 1301982 Pltiq1_m phospholipid transfer protein inducibility QTL 1 (mouse) Not determined 4 124621281 156860686 Mouse 26884437 Sklq13_m skull length QTL 13, 16 week (mouse) 4 57700000 155684457 Mouse 1300803 Sluc6_m susceptibility to lung cancer 6 (mouse) Not determined 4 120674005 154674151 Mouse 4141549 W10q10_m weight 10 weeks QTL 10 (mouse) Not determined 88982069 140468203 Mouse 4142061 Chlq16_m circulating hormone level QTL 16 (mouse) Not determined 4 121342649 155342753 Mouse 1357895 Ctrcts_m cataract severity (mouse) Not determined 4 45709925 138342753 Mouse 1300933 Cdcs9_m cytokine deficiency colitis susceptibility 9 (mouse) Not determined 4 125230872 156860686 Mouse 1300809 Ccrs2_m corpus callosum hemisphere surface size 2 (mouse) Not determined 4 107264957 141265153 Mouse 4141154 Nba1_m New Zealand Black autoimmunity 1 (mouse) Not determined 131650724 140879275 Mouse 1301964 Bw8q2_m body weight at 8 weeks QTL 2 (mouse) Not determined 4 119864433 153864536 Mouse 1301452 Elsgp1_m elevated serum gp70 1 (mouse) Not determined 4 121342649 155342753 Mouse 1301106 Skts7_m skin tumor susceptibility 7 (mouse) Not determined 4 100071971 134072206 Mouse 10755520 Rbc1_m red blood cell count 1 (mouse) 4 108477692 142477692 Mouse 10755521 Hct1_m hematocrit 1 (mouse) 4 108477692 142477692 Mouse 10755522 Hgb1_m hemoglobin 1 (mouse) 4 108477692 142477692 Mouse 1300858 Tafat_m tally ho associated mesenteric fat pad weight (mouse) Not determined 4 124621281 156860686 Mouse 10755531 Lymph3_m lymphocyte differential 3 (mouse) 4 124553483 156860686 Mouse 15039382 Ltgq7_m liver triglyceride QTL 7 (mouse) 4 105705794 139705794 Mouse 11533916 Mts1_m mammary tumor susceptibility 1 (mouse) 4 125289325 156860686 Mouse 15039377 Bw45_m body weight QTL 45 (mouse) 4 105705794 139705794 Mouse 1300839 Dyscalc2_m dystrophic cardiac calcinosis 2 (mouse) Not determined 4 111009051 145009280 Mouse 12880433 Fgf23lq1_m FGF23 serum level QTL 1 (mouse) 4 101157197 135157197 Mouse 4141001 Tgq17_m triglyceride QTL 17 (mouse) Not determined 112523489 146523489 Mouse 15039378 Adip30_m adiposity 30 (mouse) 4 105705794 139705794 Mouse 1357800 Tgq3_m triglyceride QTL 3 (mouse) Not determined 4 107055093 141055180 Mouse 15039385 Mvlq3_m macrovesicular liver lesion QTL 3 (mouse) 4 112182386 146182386 Mouse
Smarcf1
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 4 D3 UniSTS cM Map 4 UniSTS
AA818481
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 4 133,679,711 - 133,679,923 UniSTS GRCm38 MGSCv37 4 133,235,626 - 133,235,838 UniSTS GRCm37 Celera 4 131,855,483 - 131,855,695 UniSTS Cytogenetic Map 4 D3 UniSTS
MARC_6181-6182:992006984:1
Mouse Assembly Chr Position (strand) Source JBrowse MGSCv37 4 133,235,939 - 133,236,333 UniSTS GRCm37 MGSCv37 14 88,036,795 - 88,037,186 UniSTS GRCm37 Celera 14 85,171,448 - 85,171,839 UniSTS Celera 4 131,855,796 - 131,856,190 UniSTS
MARC_11851-11852:1029349291:1
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 4 133,680,793 - 133,681,193 UniSTS GRCm38 GRCm38 16 23,093,665 - 23,094,050 UniSTS GRCm38 MGSCv37 16 23,093,738 - 23,094,123 UniSTS GRCm37 MGSCv37 4 133,236,708 - 133,237,108 UniSTS GRCm37 Celera 16 23,652,680 - 23,653,065 UniSTS Celera 4 131,856,565 - 131,856,965 UniSTS Cytogenetic Map 4 D3 UniSTS Cytogenetic Map 16 B1 UniSTS
Arid1a
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 4 D3 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000008024 ⟹ ENSMUSP00000008024
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 133,407,252 - 133,484,080 (-) Ensembl GRCm38.p6 Ensembl 4 133,679,941 - 133,756,769 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000105897 ⟹ ENSMUSP00000101517
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 133,406,319 - 133,480,922 (-) Ensembl GRCm38.p6 Ensembl 4 133,679,008 - 133,753,611 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000138473
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 133,416,798 - 133,481,293 (-) Ensembl GRCm38.p6 Ensembl 4 133,689,487 - 133,753,982 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000139709 ⟹ ENSMUSP00000131950
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 133,448,090 - 133,451,190 (-) Ensembl GRCm38.p6 Ensembl 4 133,720,779 - 133,723,879 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000145664 ⟹ ENSMUSP00000122354
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 133,406,319 - 133,480,922 (-) Ensembl GRCm38.p6 Ensembl 4 133,679,008 - 133,753,611 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000168582
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 133,446,671 - 133,448,087 (-) Ensembl GRCm38.p6 Ensembl 4 133,719,360 - 133,720,776 (-) Ensembl
RefSeq Acc Id:
NM_001080819 ⟹ NP_001074288
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 133,406,319 - 133,481,296 (-) NCBI GRCm38 4 133,679,008 - 133,753,985 (-) NCBI MGSCv37 4 133,234,923 - 133,309,526 (-) RGD Celera 4 131,854,780 - 131,931,113 (-) RGD cM Map 4 ENTREZGENE
Sequence:
AGCAGAAAGCGGAGAGTCACAGCGGGGCCAGGCCCTGGGGAGCGGAGCCTCCACCGCCCCCCTCATTCCCAGGCAAGGGCTTGGGGGGAATGAGCCGGGAGAGCCGGGTCCCGAGCCGCCAGAGCCCG
hide sequence
RefSeq Acc Id:
NM_001363070 ⟹ NP_001349999
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 133,406,319 - 133,484,100 (-) NCBI GRCm38 4 133,679,008 - 133,756,769 (-) NCBI
Sequence:
CTGCCGGTGGCAGAGGCGCTTTCGAGAGGAGAGCGCTGTCCTAACCCTATAATCTGCGCCGGGATTCCTGAGCTGCCTGGGTGTGGGGTGAAAAGGCAGGGGCTGTGGGGGAAAAATACCCACCGAGG
hide sequence
RefSeq Acc Id:
NM_001401271 ⟹ NP_001388200
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 133,406,319 - 133,481,296 (-) NCBI
RefSeq Acc Id:
NM_001401273 ⟹ NP_001388202
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 133,406,319 - 133,481,296 (-) NCBI
RefSeq Acc Id:
NM_001401275 ⟹ NP_001388204
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 133,406,319 - 133,481,296 (-) NCBI
RefSeq Acc Id:
NM_001401276 ⟹ NP_001388205
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 133,406,319 - 133,484,100 (-) NCBI
RefSeq Acc Id:
XM_006539327 ⟹ XP_006539390
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 133,406,970 - 133,481,307 (-) NCBI GRCm38 4 133,679,008 - 133,753,994 (-) NCBI
Sequence:
CTTTCTCCGGCAGCAGAAAGCGGAGAGTCACAGCGGGGCCAGGCCCTGGGGAGCGGAGCCTCCACCGCCCCCCTCATTCCCAGTCATCCAGTCCAATGGATCAGATGGGAAAGATGAGACCTCAGCCG
hide sequence
RefSeq Acc Id:
XM_030253943 ⟹ XP_030109803
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 133,407,053 - 133,484,682 (-) NCBI GRCm38 4 133,679,008 - 133,755,152 (-) NCBI
Sequence:
CGGCGGGAATGTGCGGGGGCCACGGCCCGGCTCCGCACGTCTCAGCCCGGAGCAGGCAGAACCCTCCCTCTGCCTCTGCTAGCAAGCGTCCTGCCCCGAGTCCAGTAAGGGAGAGAGGTCTGCGGGGC
hide sequence
RefSeq Acc Id:
NP_001074288 ⟸ NM_001080819
- Peptide Label:
isoform 1
- UniProtKB:
Q640Q1 (UniProtKB/Swiss-Prot), Q925Q1 (UniProtKB/Swiss-Prot), A2BH40 (UniProtKB/Swiss-Prot)
- Sequence:
MAAQVAPAAASSLGNPPPPPSELKKAEQQQREEAGGEAAAAAAERGEMKAAAGQESEGPAVGPPQPLGKELQDGAESNGGGGGGGAGSGGGPGAEPDLKNSNGNAGPRPALNNNLPEPPGGGGGGGSS
hide sequence
RefSeq Acc Id:
XP_006539390 ⟸ XM_006539327
- Peptide Label:
isoform X3
- UniProtKB:
A2BH40 (UniProtKB/Swiss-Prot)
- Sequence:
MDQMGKMRPQPYGGTNPYSQQQGPPSGPQQGHGYPGQPYGSQTPQRYPMTMQGRAQSAMGSLSYAQQIPPYGQQGPSAYGQQGQTPYYNQQSPHPQQQPPYAQQPPSQTPHAQPSYQQQPQTQQPQLQ
hide sequence
RefSeq Acc Id:
NP_001349999 ⟸ NM_001363070
- Peptide Label:
isoform 2
RefSeq Acc Id:
XP_030109803 ⟸ XM_030253943
- Peptide Label:
isoform X3
Ensembl Acc Id:
ENSMUSP00000131950 ⟸ ENSMUST00000139709
Ensembl Acc Id:
ENSMUSP00000101517 ⟸ ENSMUST00000105897
Ensembl Acc Id:
ENSMUSP00000008024 ⟸ ENSMUST00000008024
Ensembl Acc Id:
ENSMUSP00000122354 ⟸ ENSMUST00000145664
RefSeq Acc Id:
NP_001388205 ⟸ NM_001401276
- Peptide Label:
isoform 2
RefSeq Acc Id:
NP_001388204 ⟸ NM_001401275
- Peptide Label:
isoform 2
RefSeq Acc Id:
NP_001388202 ⟸ NM_001401273
- Peptide Label:
isoform 4
- UniProtKB:
E9QAQ7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001388200 ⟸ NM_001401271
- Peptide Label:
isoform 3
RGD ID: 6834906 Promoter ID: MM_KWN:40035 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, Lung Transcripts: OTTMUST00000025858 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 4 133,242,691 - 133,243,417 (-) MPROMDB
RGD ID: 6834904 Promoter ID: MM_KWN:40036 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: BoneMarrow_2Hour, BoneMarrow_4Hour, Liver, MEF_B6 Transcripts: OTTMUST00000025854 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 4 133,251,396 - 133,252,062 (-) MPROMDB
RGD ID: 6834903 Promoter ID: MM_KWN:40037 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day2, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Lung Transcripts: ENSMUST00000105896, OTTMUST00000026047 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 4 133,278,616 - 133,280,017 (-) MPROMDB
RGD ID: 6834905 Promoter ID: MM_KWN:40038 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day6, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, Spleen Transcripts: OTTMUST00000025855, UC008VDI.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 4 133,308,621 - 133,310,517 (-) MPROMDB
RGD ID: 6834908 Promoter ID: MM_KWN:40039 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day6, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen Transcripts: OTTMUST00000025853, UC008VDJ.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 4 133,312,306 - 133,313,407 (-) MPROMDB
RGD ID: 6884970 Promoter ID: EPDNEW_M5936 Type: initiation region Name: Arid1a_3 Description: Mus musculus AT rich interactive domain 1A (SWI-like) , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M5937 EPDNEW_M5938 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 4 133,753,632 - 133,753,692 EPDNEW
RGD ID: 6884972 Promoter ID: EPDNEW_M5937 Type: multiple initiation site Name: Arid1a_1 Description: Mus musculus AT rich interactive domain 1A (SWI-like) , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M5936 EPDNEW_M5938 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 4 133,753,982 - 133,754,042 EPDNEW
RGD ID: 6884974 Promoter ID: EPDNEW_M5938 Type: initiation region Name: Arid1a_2 Description: Mus musculus AT rich interactive domain 1A (SWI-like) , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M5936 EPDNEW_M5937 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 4 133,756,789 - 133,756,849 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2023-06-27
Arid1a
AT-rich interaction domain 1A
Arid1a
AT rich interactive domain 1A (SWI-like)
Symbol and/or name change
5135510 APPROVED
