Advanced Search (OLGA)

Gene: Polr3d (RNA polymerase III subunit D) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Polr3d

Name:

RNA polymerase III subunit D

RGD ID:

1311816

Description:

Predicted to enable chromatin binding activity. Predicted to be involved in positive regulation of innate immune response; positive regulation of interferon-beta production; and tRNA transcription by RNA polymerase III. Predicted to be located in cytosol and nucleoplasm. Predicted to be part of RNA polymerase III complex. Orthologous to human POLR3D (RNA polymerase III subunit D); PARTICIPATES IN RNA polymerase III transcription pathway; purine metabolic pathway; pyrimidine metabolic pathway; INTERACTS WITH (+)-schisandrin B; 2,4-dinitrotoluene; 4-amino-2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

DNA-directed RNA polymerase III subunit RPC4; LOC306012; MGC116334; polymerase (RNA) III (DNA directed) polypeptide D; polymerase (RNA) III (DNA directed) polypeptide D, 44kDa; polymerase (RNA) III subunit D

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	POLR3D (RNA polymerase III subunit D)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB
Mus musculus (house mouse):	Polr3d (polymerase (RNA) III (DNA directed) polypeptide D)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Polr3d (RNA polymerase III subunit D)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	POLR3D (RNA polymerase III subunit D)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	POLR3D (RNA polymerase III subunit D)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Polr3d (RNA polymerase III subunit D)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	POLR3D (RNA polymerase III subunit D)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	POLR3D (RNA polymerase III subunit D)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Polr3d (RNA polymerase III subunit D)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	POLR3D (RNA polymerase III subunit D)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Polr3d (polymerase (RNA) III (DNA directed) polypeptide D)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	polr3d (polymerase (RNA) III (DNA directed) polypeptide D)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	RpIIIC53	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):	RPC53	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	polr3d	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)

Related Pseudogenes:

Polr3d-ps1

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	51,921,283 - 51,925,952 (-)	NCBI		GRCr8
mRatBN7.2	15	45,511,587 - 45,516,256 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	45,511,589 - 45,516,353 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	15	49,629,449 - 49,634,118 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	15	50,740,946 - 50,745,615 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	15	47,600,253 - 47,604,922 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	15	52,129,471 - 52,134,140 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	52,129,471 - 52,134,140 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	15	55,852,988 - 55,857,657 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	15	50,838,153 - 50,842,822 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	15	50,854,526 - 50,858,347 (-)	NCBI
Celera	15	45,190,713 - 45,195,382 (-)	NCBI		Celera
Cytogenetic Map	15	p11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Polr3d	Rat	Conotruncal Cardiac Defects		ISO	POLR3D (Homo sapiens)	8554872	ClinVar Annotator: match by term: Conotruncal heart malformations	ClinVar	PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Polr3d	Rat	(+)-schisandrin B	multiple interactions	EXP		6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of POLR3D mRNA]	CTD	PMID:31150632
Polr3d	Rat	1,2-dimethylhydrazine	increases expression	ISO	Polr3d (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in increased expression of POLR3D mRNA	CTD	PMID:22206623
Polr3d	Rat	2,2',4,4'-Tetrabromodiphenyl ether	affects expression	ISO	Polr3d (Mus musculus)	6480464	2 more ...	CTD	PMID:30294300
Polr3d	Rat	2,4-dinitrotoluene	affects expression	EXP		6480464	2 and 4-dinitrotoluene affects the expression of POLR3D mRNA	CTD	PMID:21346803
Polr3d	Rat	4,4'-diaminodiphenylmethane	decreases expression	ISO	Polr3d (Mus musculus)	6480464	4 and 4'-diaminodiphenylmethane results in decreased expression of POLR3D mRNA	CTD	PMID:18648102
Polr3d	Rat	4,4'-sulfonyldiphenol	decreases methylation	ISO	Polr3d (Mus musculus)	6480464	bisphenol S results in decreased methylation of POLR3D exon	CTD	PMID:33297965
Polr3d	Rat	4-amino-2,6-dinitrotoluene	affects expression	EXP		6480464	4-amino-2 and 6-dinitrotoluene affects the expression of POLR3D mRNA	CTD	PMID:21346803
Polr3d	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of POLR3D mRNA	CTD	PMID:30047161
Polr3d	Rat	acrylamide	increases expression	EXP		6480464	Acrylamide results in increased expression of POLR3D mRNA	CTD	PMID:28959563
Polr3d	Rat	acrylamide	decreases expression	ISO	POLR3D (Homo sapiens)	6480464	Acrylamide results in decreased expression of POLR3D mRNA	CTD	PMID:32763439
Polr3d	Rat	aflatoxin B1	increases methylation	ISO	POLR3D (Homo sapiens)	6480464	Aflatoxin B1 results in increased methylation of POLR3D gene	CTD	PMID:27153756
Polr3d	Rat	all-trans-retinoic acid	decreases expression	ISO	POLR3D (Homo sapiens)	6480464	Tretinoin results in decreased expression of POLR3D mRNA	CTD	PMID:23724009 and PMID:33167477
Polr3d	Rat	arsane	affects methylation	ISO	POLR3D (Homo sapiens)	6480464	Arsenic affects the methylation of POLR3D gene	CTD	PMID:25304211
Polr3d	Rat	arsane	multiple interactions	ISO	POLR3D (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of POLR3D mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of POLR3D mRNA	CTD	PMID:39836092
Polr3d	Rat	arsenic atom	affects methylation	ISO	POLR3D (Homo sapiens)	6480464	Arsenic affects the methylation of POLR3D gene	CTD	PMID:25304211
Polr3d	Rat	arsenic atom	multiple interactions	ISO	POLR3D (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of POLR3D mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of POLR3D mRNA	CTD	PMID:39836092
Polr3d	Rat	arsenite(3-)	decreases expression	ISO	Polr3d (Mus musculus)	6480464	arsenite results in decreased expression of POLR3D mRNA	CTD	PMID:33053406
Polr3d	Rat	beta-lapachone	increases expression	ISO	POLR3D (Homo sapiens)	6480464	beta-lapachone results in increased expression of POLR3D mRNA	CTD	PMID:38218311
Polr3d	Rat	bisphenol A	affects expression	EXP		6480464	bisphenol A affects the expression of POLR3D mRNA	CTD	PMID:25181051
Polr3d	Rat	bisphenol A	decreases expression	ISO	Polr3d (Mus musculus)	6480464	bisphenol A results in decreased expression of POLR3D mRNA	CTD	PMID:35598803
Polr3d	Rat	bisphenol A	multiple interactions	ISO	POLR3D (Homo sapiens)	6480464	[bisphenol A co-treated with Fulvestrant] results in increased methylation of POLR3D gene	CTD	PMID:31601247
Polr3d	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of POLR3D mRNA	CTD	PMID:34947998
Polr3d	Rat	cadmium dichloride	decreases expression	ISO	POLR3D (Homo sapiens)	6480464	Cadmium Chloride results in decreased expression of POLR3D mRNA	CTD	PMID:38568856
Polr3d	Rat	caffeine	decreases phosphorylation	ISO	POLR3D (Homo sapiens)	6480464	Caffeine results in decreased phosphorylation of POLR3D protein	CTD	PMID:35688186
Polr3d	Rat	carbamazepine	affects expression	ISO	POLR3D (Homo sapiens)	6480464	Carbamazepine affects the expression of POLR3D mRNA	CTD	PMID:24752500
Polr3d	Rat	carbon nanotube	increases expression	ISO	Polr3d (Mus musculus)	6480464	Nanotubes more ...	CTD	PMID:25554681
Polr3d	Rat	choline	multiple interactions	ISO	Polr3d (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of POLR3D gene	CTD	PMID:20938992
Polr3d	Rat	copper(II) sulfate	decreases expression	ISO	POLR3D (Homo sapiens)	6480464	Copper Sulfate results in decreased expression of POLR3D mRNA	CTD	PMID:19549813
Polr3d	Rat	cyclosporin A	increases expression	ISO	POLR3D (Homo sapiens)	6480464	Cyclosporine results in increased expression of POLR3D mRNA	CTD	PMID:20106945 more ...
Polr3d	Rat	diclofenac	affects expression	ISO	POLR3D (Homo sapiens)	6480464	Diclofenac affects the expression of POLR3D mRNA	CTD	PMID:24752500
Polr3d	Rat	fluoranthene	multiple interactions	ISO	Polr3d (Mus musculus)	6480464	[1-methylanthracene co-treated with fluoranthene] results in increased expression of POLR3D mRNA	CTD	PMID:28329830
Polr3d	Rat	flutamide	increases expression	EXP		6480464	Flutamide results in increased expression of POLR3D mRNA	CTD	PMID:24136188
Polr3d	Rat	folic acid	multiple interactions	ISO	Polr3d (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of POLR3D gene	CTD	PMID:20938992
Polr3d	Rat	folic acid	decreases expression	ISO	Polr3d (Mus musculus)	6480464	Folic Acid results in decreased expression of POLR3D mRNA	CTD	PMID:25629700
Polr3d	Rat	fulvestrant	multiple interactions	ISO	POLR3D (Homo sapiens)	6480464	[bisphenol A co-treated with Fulvestrant] results in increased methylation of POLR3D gene	CTD	PMID:31601247
Polr3d	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of POLR3D mRNA	CTD	PMID:22061828 and PMID:33387578
Polr3d	Rat	glafenine	increases expression	EXP		6480464	Glafenine results in increased expression of POLR3D mRNA	CTD	PMID:24136188
Polr3d	Rat	hydrogen cyanide	decreases expression	ISO	Polr3d (Mus musculus)	6480464	Hydrogen Cyanide results in decreased expression of POLR3D mRNA	CTD	PMID:33914522
Polr3d	Rat	L-methionine	multiple interactions	ISO	Polr3d (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of POLR3D gene	CTD	PMID:20938992
Polr3d	Rat	manganese atom	multiple interactions	ISO	POLR3D (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of POLR3D mRNA	CTD	PMID:39836092
Polr3d	Rat	manganese(0)	multiple interactions	ISO	POLR3D (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of POLR3D mRNA	CTD	PMID:39836092
Polr3d	Rat	manganese(II) chloride	multiple interactions	ISO	POLR3D (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of POLR3D mRNA	CTD	PMID:39836092
Polr3d	Rat	methimazole	increases expression	EXP		6480464	Methimazole results in increased expression of POLR3D mRNA	CTD	PMID:30047161
Polr3d	Rat	nefazodone	increases expression	EXP		6480464	nefazodone results in increased expression of POLR3D mRNA	CTD	PMID:24136188
Polr3d	Rat	paracetamol	affects expression	ISO	Polr3d (Mus musculus)	6480464	Acetaminophen affects the expression of POLR3D mRNA	CTD	PMID:17562736
Polr3d	Rat	potassium cyanide	decreases expression	ISO	Polr3d (Mus musculus)	6480464	Potassium Cyanide results in decreased expression of POLR3D mRNA	CTD	PMID:33914522
Polr3d	Rat	quercetin	increases expression	ISO	POLR3D (Homo sapiens)	6480464	Quercetin results in increased expression of POLR3D mRNA	CTD	PMID:21632981
Polr3d	Rat	sodium arsenite	multiple interactions	ISO	POLR3D (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of POLR3D mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of POLR3D mRNA	CTD	PMID:39836092
Polr3d	Rat	sodium dichromate	increases expression	EXP		6480464	sodium bichromate results in increased expression of POLR3D mRNA	CTD	PMID:25993096
Polr3d	Rat	sulfadimethoxine	increases expression	EXP		6480464	Sulfadimethoxine results in increased expression of POLR3D mRNA	CTD	PMID:30047161
Polr3d	Rat	sunitinib	increases expression	ISO	POLR3D (Homo sapiens)	6480464	Sunitinib results in increased expression of POLR3D mRNA	CTD	PMID:31533062
Polr3d	Rat	temozolomide	increases expression	ISO	POLR3D (Homo sapiens)	6480464	Temozolomide results in increased expression of POLR3D mRNA	CTD	PMID:31758290
Polr3d	Rat	tetrachloromethane	multiple interactions	EXP		6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of POLR3D mRNA]	CTD	PMID:31150632
Polr3d	Rat	tetrachloromethane	increases expression	EXP		6480464	Carbon Tetrachloride results in increased expression of POLR3D mRNA	CTD	PMID:31150632
Polr3d	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of POLR3D mRNA	CTD	PMID:34492290
Polr3d	Rat	thiram	increases expression	ISO	POLR3D (Homo sapiens)	6480464	Thiram results in increased expression of POLR3D mRNA	CTD	PMID:38568856
Polr3d	Rat	titanium dioxide	increases expression	ISO	Polr3d (Mus musculus)	6480464	titanium dioxide results in increased expression of POLR3D mRNA	CTD	PMID:27760801
Polr3d	Rat	titanium dioxide	decreases methylation	ISO	Polr3d (Mus musculus)	6480464	titanium dioxide results in decreased methylation of POLR3D promoter and titanium dioxide results in decreased methylation of POLR3D promoter alternative form	CTD	PMID:35295148
Polr3d	Rat	triphenyl phosphate	affects expression	ISO	POLR3D (Homo sapiens)	6480464	triphenyl phosphate affects the expression of POLR3D mRNA	CTD	PMID:37042841
Polr3d	Rat	valproic acid	decreases expression	ISO	Polr3d (Mus musculus)	6480464	Valproic Acid results in decreased expression of POLR3D mRNA	CTD	PMID:21427059
Polr3d	Rat	valproic acid	affects expression	ISO	Polr3d (Mus musculus)	6480464	Valproic Acid affects the expression of POLR3D mRNA	CTD	PMID:17292431

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Polr3d	Rat	biological_process		ND		1598407	02/2015: no relevant rat data	RGD
Polr3d	Rat	positive regulation of innate immune response	involved_in	ISO	POLR3D (Homo sapiens)	1624291	PMID:19631370	RGD	PMID:19631370
Polr3d	Rat	positive regulation of innate immune response	involved_in	IEA	UniProtKB:P05423 and ensembl:ENSP00000303088	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Polr3d	Rat	positive regulation of interferon-beta production	involved_in	ISO	POLR3D (Homo sapiens)	1624291	PMID:19631370	RGD	PMID:19631370
Polr3d	Rat	positive regulation of interferon-beta production	involved_in	IEA	UniProtKB:P05423 and ensembl:ENSP00000303088	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Polr3d	Rat	transcription by RNA polymerase III	involved_in	IEA	InterPro:IPR007811	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Polr3d	Rat	tRNA transcription by RNA polymerase III	involved_in	IBA	PANTHER:PTN000334172 and SGD:S000002309	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Polr3d	Rat	cytosol	located_in	ISO	POLR3D (Homo sapiens)	1624291		RGD	GO_REF:0000052
Polr3d	Rat	cytosol	located_in	IEA	UniProtKB:P05423 and ensembl:ENSP00000303088	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Polr3d	Rat	DNA-directed RNA polymerase complex	part_of	IEA	UniProtKB-KW:KW-0240	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Polr3d	Rat	nucleoplasm	located_in	ISO	POLR3D (Homo sapiens)	1624291		RGD	GO_REF:0000052
Polr3d	Rat	nucleoplasm	located_in	IEA	UniProtKB:P05423 and ensembl:ENSP00000303088	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Polr3d	Rat	nucleus	located_in	IEA	UniProtKB-SubCell:SL-0191	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Polr3d	Rat	nucleus	located_in	IEA	UniProtKB-KW:KW-0539	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Polr3d	Rat	RNA polymerase III complex	part_of	ISO	POLR3D (Homo sapiens)	1624291	PMID:24107381 more ...	RGD	PMID:24107381 more ...
Polr3d	Rat	RNA polymerase III complex	part_of	IEA	InterPro:IPR007811	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Polr3d	Rat	RNA polymerase III complex	part_of	IEA	UniProtKB:P05423 and ensembl:ENSP00000303088	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Polr3d	Rat	RNA polymerase III complex	part_of	IBA	PANTHER:PTN000334172 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Polr3d	Rat	chromatin binding	enables	ISO	POLR3D (Homo sapiens)	1624291	PMID:24107381	RGD	PMID:24107381
Polr3d	Rat	chromatin binding	enables	IEA	UniProtKB:Q91WD1 and ensembl:ENSMUSP00000137614	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Polr3d	Rat	chromatin binding	enables	ISO	Polr3d (Mus musculus)	1624291	PMID:22287103 and PMID:24107381	RGD	PMID:22287103 and PMID:24107381
Polr3d	Rat	chromatin binding	enables	IEA	UniProtKB:P05423 and ensembl:ENSP00000303088	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Polr3d	Rat	DNA binding	enables	IEA	InterPro:IPR007811	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

RGD Manual Annotations

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Polr3d	Rat	RNA polymerase III transcription pathway		ISO	POLR3D (Homo sapiens)	9685217		RGD
Polr3d	Rat	RNA polymerase III transcription pathway		ISO	POLR3D (Homo sapiens)	9685218		RGD

Imported Annotations - KEGG (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Polr3d	Rat	purine metabolic pathway		IEA		6907045		KEGG	rno:00230
Polr3d	Rat	pyrimidine metabolic pathway		IEA		6907045		KEGG	rno:00240

#	Reference Title	Reference Citation
1.	Cell growth- and differentiation-dependent regulation of RNA polymerase III transcription.	Dumay-Odelot H, etal., Cell Cycle. 2010 Sep 15;9(18):3687-99. Epub 2010 Sep 1.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Characterization of human RNA polymerase III identifies orthologues for Saccharomyces cerevisiae RNA polymerase III subunits.	Hu P, etal., Mol Cell Biol. 2002 Nov;22(22):8044-55.
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
7.	GOA pipeline	RGD automated data pipeline
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	Comprehensive gene review and curation	RGD comprehensive gene curation

PMID:12477932	PMID:19631370	PMID:22287103	PMID:24107381

Polr3d
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	51,921,283 - 51,925,952 (-)	NCBI		GRCr8
mRatBN7.2	15	45,511,587 - 45,516,256 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	45,511,589 - 45,516,353 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	15	49,629,449 - 49,634,118 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	15	50,740,946 - 50,745,615 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	15	47,600,253 - 47,604,922 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	15	52,129,471 - 52,134,140 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	52,129,471 - 52,134,140 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	15	55,852,988 - 55,857,657 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	15	50,838,153 - 50,842,822 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	15	50,854,526 - 50,858,347 (-)	NCBI
Celera	15	45,190,713 - 45,195,382 (-)	NCBI		Celera
Cytogenetic Map	15	p11	NCBI

POLR3D
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	8	22,245,133 - 22,254,601 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	8	22,245,133 - 22,254,601 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	8	22,102,646 - 22,112,114 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	8	22,158,564 - 22,164,625 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	8	22,158,563 - 22,164,624	NCBI
Celera	8	21,064,952 - 21,071,014 (+)	NCBI		Celera
Cytogenetic Map	8	p21.3	NCBI
HuRef	8	20,644,813 - 20,650,874 (+)	NCBI		HuRef
CHM1_1	8	22,304,282 - 22,310,343 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	8	22,519,087 - 22,528,555 (+)	NCBI		T2T-CHM13v2.0

Polr3d
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	14	70,676,188 - 70,680,911 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	14	70,676,197 - 70,680,887 (-)	Ensembl		GRCm39 Ensembl
GRCm38	14	70,438,748 - 70,443,471 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	14	70,438,757 - 70,443,447 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	14	70,838,555 - 70,843,278 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	14	69,173,876 - 69,178,527 (-)	NCBI		MGSCv36	mm8
Celera	14	67,980,237 - 67,984,960 (-)	NCBI		Celera
Cytogenetic Map	14	D2	NCBI
cM Map	14	36.32	NCBI

Polr3d
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955403	45,721,266 - 45,727,214 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955403	45,721,266 - 45,727,214 (+)	NCBI	ChiLan1.0	ChiLan1.0

POLR3D
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	7	40,744,924 - 40,752,918 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	8	16,470,123 - 16,478,117 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	8	21,489,492 - 21,499,948 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	8	18,429,013 - 18,435,060 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	8	18,429,013 - 18,435,060 (+)	Ensembl	panpan1.1		panPan2

POLR3D
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	25	35,011,189 - 35,016,617 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	25	35,011,861 - 35,016,605 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	25	35,599,339 - 35,606,355 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	25	35,221,091 - 35,228,107 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	25	35,220,227 - 35,228,098 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	25	35,166,570 - 35,173,586 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	25	35,021,103 - 35,028,122 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	25	35,176,601 - 35,183,620 (-)	NCBI		UU_Cfam_GSD_1.0

Polr3d
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404943	12,513,348 - 12,519,015 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936555	6,051,476 - 6,057,164 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936555	6,051,528 - 6,057,165 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

POLR3D
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	6,521,024 - 6,532,156 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	14	6,520,962 - 6,529,526 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	6,955,056 - 6,963,574 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

POLR3D
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	8	20,314,020 - 20,320,118 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	8	20,314,081 - 20,319,455 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666052	21,916,062 - 21,922,148 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Polr3d
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624758	17,817,690 - 17,824,427 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624758	17,817,716 - 17,823,442 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Polr3d
7 total Variants

Name	Type	Condition(s)	Position(s)	Clinical significance
GRCh38/hg38 1q32.3-44(chr1:214023812-248918469)x3	copy number gain	See cases [RCV000050981]	Chr1:214023812..248918469 [GRCh38] Chr1:214197155..249212668 [GRCh37] Chr1:212263778..247179291 [NCBI36] Chr1:1q32.3-44	pathogenic
GRCh38/hg38 1q41-44(chr1:223347693-248918469)x3	copy number gain	See cases [RCV000050581]	Chr1:223347693..248918469 [GRCh38] Chr1:223521035..249212668 [GRCh37] Chr1:221587658..247179291 [NCBI36] Chr1:1q41-44	pathogenic
GRCh38/hg38 1q41-44(chr1:221902539-248918469)x3	copy number gain	Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000051875]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000051875]\|See cases [RCV000051875]	Chr1:221902539..248918469 [GRCh38] Chr1:222075881..249212668 [GRCh37] Chr1:220142504..247179291 [NCBI36] Chr1:1q41-44	pathogenic
GRCh38/hg38 1q41-44(chr1:223828500-248891309)x3	copy number gain	See cases [RCV000051878]	Chr1:223828500..248891309 [GRCh38] Chr1:224016202..249185508 [GRCh37] Chr1:222082825..247152131 [NCBI36] Chr1:1q41-44	pathogenic
GRCh38/hg38 1q41-44(chr1:223887780-248891309)x3	copy number gain	See cases [RCV000051880]	Chr1:223887780..248891309 [GRCh38] Chr1:224075482..249185508 [GRCh37] Chr1:222142105..247152131 [NCBI36] Chr1:1q41-44	pathogenic
GRCh38/hg38 1q42.11-44(chr1:224096488-248918469)x3	copy number gain	See cases [RCV000051882]	Chr1:224096488..248918469 [GRCh38] Chr1:224284190..249212668 [GRCh37] Chr1:222350813..247179291 [NCBI36] Chr1:1q42.11-44	pathogenic
GRCh38/hg38 1q32.2-44(chr1:209646207-248931113)x3	copy number gain	See cases [RCV000051861]	Chr1:209646207..248931113 [GRCh38] Chr1:209819552..249225312 [GRCh37] Chr1:207886175..247191935 [NCBI36] Chr1:1q32.2-44	pathogenic
GRCh38/hg38 1q42.11-42.13(chr1:224096288-227859548)x1	copy number loss	See cases [RCV000052311]	Chr1:224096288..227859548 [GRCh38] Chr1:224283990..228047249 [GRCh37] Chr1:222350613..226113872 [NCBI36] Chr1:1q42.11-42.13	pathogenic
GRCh38/hg38 1q41-42.13(chr1:221519280-228862141)x1	copy number loss	Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000053955]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000053955]\|See cases [RCV000053955]	Chr1:221519280..228862141 [GRCh38] Chr1:221692622..228997888 [GRCh37] Chr1:219759245..227064511 [NCBI36] Chr1:1q41-42.13	pathogenic
GRCh38/hg38 1q32.2-44(chr1:209963625-248918469)x3	copy number gain	See cases [RCV000134979]	Chr1:209963625..248918469 [GRCh38] Chr1:210136970..249212668 [GRCh37] Chr1:208203593..247179291 [NCBI36] Chr1:1q32.2-44	pathogenic
GRCh38/hg38 1q41-44(chr1:223815147-248918469)x3	copy number gain	See cases [RCV000135839]	Chr1:223815147..248918469 [GRCh38] Chr1:224002849..249212668 [GRCh37] Chr1:222069472..247179291 [NCBI36] Chr1:1q41-44	pathogenic
GRCh38/hg38 1q42.12-42.2(chr1:226185124-232872488)x1	copy number loss	See cases [RCV000135796]	Chr1:226185124..232872488 [GRCh38] Chr1:226372825..233008234 [GRCh37] Chr1:224439448..231074857 [NCBI36] Chr1:1q42.12-42.2	pathogenic
GRCh38/hg38 1q41-42.13(chr1:223347693-228556332)x1	copy number loss	See cases [RCV000136636]	Chr1:223347693..228556332 [GRCh38] Chr1:223521035..228744033 [GRCh37] Chr1:221587658..226810656 [NCBI36] Chr1:1q41-42.13	pathogenic
GRCh38/hg38 1q42.11-44(chr1:224022862-248918469)x3	copy number gain	See cases [RCV000137769]	Chr1:224022862..248918469 [GRCh38] Chr1:224210564..249212668 [GRCh37] Chr1:222277187..247179291 [NCBI36] Chr1:1q42.11-44	pathogenic
GRCh38/hg38 1q42.12-44(chr1:225438480-248787200)x3	copy number gain	See cases [RCV000142448]	Chr1:225438480..248787200 [GRCh38] Chr1:225626182..249060210 [GRCh37] Chr1:223692805..247048022 [NCBI36] Chr1:1q42.12-44	pathogenic
GRCh38/hg38 1q42.12-42.13(chr1:225382172-230418801)x1	copy number loss	See cases [RCV000143223]	Chr1:225382172..230418801 [GRCh38] Chr1:225569874..230554547 [GRCh37] Chr1:223636497..228621170 [NCBI36] Chr1:1q42.12-42.13	pathogenic
GRCh38/hg38 1q32.2-44(chr1:207346642-248930485)x3	copy number gain	See cases [RCV000143727]	Chr1:207346642..248930485 [GRCh38] Chr1:207519987..249224684 [GRCh37] Chr1:205586610..247191307 [NCBI36] Chr1:1q32.2-44	pathogenic
GRCh37/hg19 1q31.3-42.13(chr1:197811907-228997888)x3	copy number gain	See cases [RCV000240137]	Chr1:197811907..228997888 [GRCh37] Chr1:1q31.3-42.13	pathogenic
GRCh37/hg19 1q42.12-42.13(chr1:226871745-229906954)x1	copy number loss	See cases [RCV000240001]	Chr1:226871745..229906954 [GRCh37] Chr1:1q42.12-42.13	uncertain significance
GRCh37/hg19 1q31.3-44(chr1:195483439-249213000)x3	copy number gain	See cases [RCV000449172]	Chr1:195483439..249213000 [GRCh37] Chr1:1q31.3-44	pathogenic
GRCh37/hg19 1q41-44(chr1:214697099-249224684)x3	copy number gain	See cases [RCV000449210]	Chr1:214697099..249224684 [GRCh37] Chr1:1q41-44	pathogenic
GRCh37/hg19 1p36.33-q44(chr1:849467-249224684)x3	copy number gain	See cases [RCV000510383]	Chr1:849467..249224684 [GRCh37] Chr1:1p36.33-q44	pathogenic
GRCh37/hg19 1q42.11-44(chr1:224105294-249224684)x3	copy number gain	See cases [RCV000510981]	Chr1:224105294..249224684 [GRCh37] Chr1:1q42.11-44	pathogenic
GRCh37/hg19 1p36.33-q44(chr1:849467-249224684)	copy number gain	See cases [RCV000510926]	Chr1:849467..249224684 [GRCh37] Chr1:1p36.33-q44	pathogenic
NM_002221.4(ITPKB):c.310G>A (p.Gly104Ser)	single nucleotide variant	not specified [RCV004306551]	Chr1:226737149 [GRCh38] Chr1:226924850 [GRCh37] Chr1:1q42.12	uncertain significance
NM_002221.4(ITPKB):c.130C>T (p.Pro44Ser)	single nucleotide variant	not specified [RCV004288910]	Chr1:226737329 [GRCh38] Chr1:226925030 [GRCh37] Chr1:1q42.12	uncertain significance
GRCh37/hg19 1q41-44(chr1:218252551-249224684)x3	copy number gain	not provided [RCV000684700]	Chr1:218252551..249224684 [GRCh37] Chr1:1q41-44	pathogenic
GRCh37/hg19 1p36.33-q44(chr1:47851-249228449)x3	copy number gain	not provided [RCV000736295]	Chr1:47851..249228449 [GRCh37] Chr1:1p36.33-q44	pathogenic
GRCh37/hg19 1p36.33-q44(chr1:82154-249218992)x3	copy number gain	not provided [RCV000736305]	Chr1:82154..249218992 [GRCh37] Chr1:1p36.33-q44	pathogenic
GRCh37/hg19 1q42.12(chr1:226810146-226836190)x3	copy number gain	not provided [RCV000736886]	Chr1:226810146..226836190 [GRCh37] Chr1:1q42.12	benign
GRCh37/hg19 1q41-42.2(chr1:223653722-234591807)x1	copy number loss	not provided [RCV001005180]	Chr1:223653722..234591807 [GRCh37] Chr1:1q41-42.2	pathogenic
NM_002221.4(ITPKB):c.2640C>G (p.Ser880=)	single nucleotide variant	not provided [RCV000964850]	Chr1:226634872 [GRCh38] Chr1:226822573 [GRCh37] Chr1:1q42.12	benign
NM_002221.4(ITPKB):c.959A>C (p.Asp320Ala)	single nucleotide variant	not provided [RCV000884163]	Chr1:226736500 [GRCh38] Chr1:226924201 [GRCh37] Chr1:1q42.12	benign
GRCh37/hg19 1q42.12-42.13(chr1:226853676-227246753)x1	copy number loss	not provided [RCV000845932]	Chr1:226853676..227246753 [GRCh37] Chr1:1q42.12-42.13	uncertain significance
GRCh37/hg19 1q42.12(chr1:226064744-226924455)x3	copy number gain	not provided [RCV001005183]	Chr1:226064744..226924455 [GRCh37] Chr1:1q42.12	uncertain significance
GRCh37/hg19 1q41-42.13(chr1:222641389-228137574)x1	copy number loss	not provided [RCV001005178]	Chr1:222641389..228137574 [GRCh37] Chr1:1q41-42.13	pathogenic
GRCh37/hg19 1q41-43(chr1:219916966-239004378)x3	copy number gain	not provided [RCV001005175]	Chr1:219916966..239004378 [GRCh37] Chr1:1q41-43	pathogenic
GRCh37/hg19 1q25.3-44(chr1:182388773-249111240)x3	copy number gain	not provided [RCV000845852]	Chr1:182388773..249111240 [GRCh37] Chr1:1q25.3-44	pathogenic
NM_002221.4(ITPKB):c.1655C>A (p.Pro552Gln)	single nucleotide variant	Myeloproliferative neoplasm, unclassifiable [RCV002284271]\|not specified [RCV003491071]	Chr1:226735804 [GRCh38] Chr1:226923505 [GRCh37] Chr1:1q42.12	likely pathogenic\|benign
NM_002221.4(ITPKB):c.1776C>T (p.Asn592=)	single nucleotide variant	not provided [RCV000957792]	Chr1:226735683 [GRCh38] Chr1:226923384 [GRCh37] Chr1:1q42.12	benign
NM_002221.4(ITPKB):c.591C>A (p.Ser197Arg)	single nucleotide variant	not provided [RCV000957793]	Chr1:226736868 [GRCh38] Chr1:226924569 [GRCh37] Chr1:1q42.12	benign
GRCh37/hg19 1q32.2-44(chr1:210152794-249218992)x3	copy number gain	See cases [RCV001194578]	Chr1:210152794..249218992 [GRCh37] Chr1:1q32.2-44	pathogenic
GRCh37/hg19 1q32.1-44(chr1:204045948-249218992)x3	copy number gain	See cases [RCV001007407]	Chr1:204045948..249218992 [GRCh37] Chr1:1q32.1-44	pathogenic
NM_002221.4(ITPKB):c.220G>A (p.Gly74Ser)	single nucleotide variant	Myeloproliferative neoplasm, unclassifiable [RCV002284266]\|not specified [RCV003491070]	Chr1:226737239 [GRCh38] Chr1:226924940 [GRCh37] Chr1:1q42.12	benign\|likely benign
NM_002221.4(ITPKB):c.1222T>G (p.Ser408Ala)	single nucleotide variant	Myeloproliferative neoplasm, unclassifiable [RCV002284273]\|not specified [RCV003491073]	Chr1:226736237 [GRCh38] Chr1:226923938 [GRCh37] Chr1:1q42.12	likely pathogenic\|benign
NM_002221.4(ITPKB):c.964G>A (p.Ala322Thr)	single nucleotide variant	Myeloproliferative neoplasm, unclassifiable [RCV002284263]\|not specified [RCV003491069]	Chr1:226736495 [GRCh38] Chr1:226924196 [GRCh37] Chr1:1q42.12	pathogenic\|benign
NM_002221.4(ITPKB):c.518G>A (p.Arg173His)	single nucleotide variant	Myeloproliferative neoplasm, unclassifiable [RCV002284272]\|not specified [RCV003491072]	Chr1:226736941 [GRCh38] Chr1:226924642 [GRCh37] Chr1:1q42.12	benign\|uncertain significance
NM_002221.4(ITPKB):c.267CAGCGGCAG[1] (p.91GSS[1])	microsatellite	Myeloproliferative neoplasm, unclassifiable [RCV002284270]	Chr1:226737175..226737183 [GRCh38] Chr1:226924876..226924884 [GRCh37] Chr1:1q42.12	likely pathogenic
NC_000001.10:g.(?_130980840)_(248900000_?)dup	duplication	Gastrointestinal stromal tumor [RCV001300221]\|Parathyroid carcinoma [RCV001341077]	Chr1:130980840..248900000 [GRCh37] Chr1:1q12-44	uncertain significance
NM_002221.4(ITPKB):c.1133C>T (p.Pro378Leu)	single nucleotide variant	not specified [RCV004325333]	Chr1:226736326 [GRCh38] Chr1:226924027 [GRCh37] Chr1:1q42.12	uncertain significance
NM_002221.4(ITPKB):c.1273G>A (p.Glu425Lys)	single nucleotide variant	not specified [RCV004325334]	Chr1:226736186 [GRCh38] Chr1:226923887 [GRCh37] Chr1:1q42.12	uncertain significance
NC_000001.10:g.(?_225591005)_(227174438_?)dup	duplication	not provided [RCV001928108]	Chr1:225591005..227174438 [GRCh37] Chr1:1q42.12-42.13	uncertain significance
GRCh37/hg19 1q41-42.13(chr1:221303919-227461343)	copy number gain	not specified [RCV002052845]	Chr1:221303919..227461343 [GRCh37] Chr1:1q41-42.13	pathogenic
GRCh37/hg19 1q42.12-42.2(chr1:226131690-231908227)	copy number loss	not specified [RCV002052878]	Chr1:226131690..231908227 [GRCh37] Chr1:1q42.12-42.2	likely pathogenic
GRCh37/hg19 1q31.3-44(chr1:197867914-249224684)x3	copy number gain	See cases [RCV002287837]	Chr1:197867914..249224684 [GRCh37] Chr1:1q31.3-44	pathogenic
NM_002221.4(ITPKB):c.1906A>G (p.Thr636Ala)	single nucleotide variant	not specified [RCV004324178]	Chr1:226735553 [GRCh38] Chr1:226923254 [GRCh37] Chr1:1q42.12	uncertain significance
NM_002221.4(ITPKB):c.758C>T (p.Ala253Val)	single nucleotide variant	not specified [RCV004144517]	Chr1:226736701 [GRCh38] Chr1:226924402 [GRCh37] Chr1:1q42.12	uncertain significance
NM_002221.4(ITPKB):c.1280G>C (p.Arg427Pro)	single nucleotide variant	not specified [RCV004138197]	Chr1:226736179 [GRCh38] Chr1:226923880 [GRCh37] Chr1:1q42.12	uncertain significance
NM_002221.4(ITPKB):c.1634C>T (p.Pro545Leu)	single nucleotide variant	not specified [RCV004240137]	Chr1:226735825 [GRCh38] Chr1:226923526 [GRCh37] Chr1:1q42.12	uncertain significance
NM_002221.4(ITPKB):c.796C>T (p.Arg266Cys)	single nucleotide variant	not specified [RCV004219889]	Chr1:226736663 [GRCh38] Chr1:226924364 [GRCh37] Chr1:1q42.12	likely benign
NM_002221.4(ITPKB):c.1171A>G (p.Lys391Glu)	single nucleotide variant	not specified [RCV004233693]	Chr1:226736288 [GRCh38] Chr1:226923989 [GRCh37] Chr1:1q42.12	likely benign
NM_002221.4(ITPKB):c.428T>G (p.Val143Gly)	single nucleotide variant	not specified [RCV004126545]	Chr1:226737031 [GRCh38] Chr1:226924732 [GRCh37] Chr1:1q42.12	uncertain significance
GRCh37/hg19 1q41-44(chr1:223972939-249224684)x3	copy number gain	not provided [RCV002475745]	Chr1:223972939..249224684 [GRCh37] Chr1:1q41-44	pathogenic
GRCh38/hg38 1q32.2-42.13(chr1:228006998-228061271)x2	copy number loss	Orofacial cleft 2 [RCV002481175]	Chr1:228006998..228061271 [GRCh38] Chr1:1q32.2-42.13	association
NM_002221.4(ITPKB):c.566G>A (p.Arg189Lys)	single nucleotide variant	not specified [RCV004194637]	Chr1:226736893 [GRCh38] Chr1:226924594 [GRCh37] Chr1:1q42.12	uncertain significance
NM_002221.4(ITPKB):c.2126G>A (p.Arg709Lys)	single nucleotide variant	not specified [RCV004190152]	Chr1:226647287 [GRCh38] Chr1:226834988 [GRCh37] Chr1:1q42.12	likely benign
NM_002221.4(ITPKB):c.2740G>A (p.Val914Ile)	single nucleotide variant	not specified [RCV004134829]	Chr1:226634772 [GRCh38] Chr1:226822473 [GRCh37] Chr1:1q42.12	uncertain significance
NM_002221.4(ITPKB):c.1615A>T (p.Ser539Cys)	single nucleotide variant	not specified [RCV004229643]	Chr1:226735844 [GRCh38] Chr1:226923545 [GRCh37] Chr1:1q42.12	uncertain significance
NM_002221.4(ITPKB):c.2716G>C (p.Glu906Gln)	single nucleotide variant	not provided [RCV004691527]\|not specified [RCV004171682]	Chr1:226634796 [GRCh38] Chr1:226822497 [GRCh37] Chr1:1q42.12	uncertain significance
NM_002221.4(ITPKB):c.2323G>A (p.Glu775Lys)	single nucleotide variant	not specified [RCV004226739]	Chr1:226642049 [GRCh38] Chr1:226829750 [GRCh37] Chr1:1q42.12	uncertain significance
NM_002221.4(ITPKB):c.1027G>A (p.Val343Met)	single nucleotide variant	not specified [RCV004134291]	Chr1:226736432 [GRCh38] Chr1:226924133 [GRCh37] Chr1:1q42.12	uncertain significance
NM_002221.4(ITPKB):c.2029G>A (p.Ala677Thr)	single nucleotide variant	not specified [RCV004113795]	Chr1:226648675 [GRCh38] Chr1:226836376 [GRCh37] Chr1:1q42.12	uncertain significance
NM_002221.4(ITPKB):c.1373C>T (p.Ser458Leu)	single nucleotide variant	not specified [RCV004135389]	Chr1:226736086 [GRCh38] Chr1:226923787 [GRCh37] Chr1:1q42.12	uncertain significance
GRCh37/hg19 1q42.11-43(chr1:224230307-243181599)x3	copy number gain	not provided [RCV002509019]	Chr1:224230307..243181599 [GRCh37] Chr1:1q42.11-43	not provided
NM_002221.4(ITPKB):c.1085G>A (p.Gly362Glu)	single nucleotide variant	not specified [RCV004182087]	Chr1:226736374 [GRCh38] Chr1:226924075 [GRCh37] Chr1:1q42.12	uncertain significance
NM_002221.4(ITPKB):c.1414T>G (p.Ser472Ala)	single nucleotide variant	not specified [RCV004241191]	Chr1:226736045 [GRCh38] Chr1:226923746 [GRCh37] Chr1:1q42.12	uncertain significance
NM_002221.4(ITPKB):c.749G>A (p.Gly250Asp)	single nucleotide variant	not specified [RCV004222609]	Chr1:226736710 [GRCh38] Chr1:226924411 [GRCh37] Chr1:1q42.12	uncertain significance
NM_002221.4(ITPKB):c.1817C>T (p.Thr606Met)	single nucleotide variant	not specified [RCV004091526]	Chr1:226735642 [GRCh38] Chr1:226923343 [GRCh37] Chr1:1q42.12	uncertain significance
NM_002221.4(ITPKB):c.1768C>T (p.Arg590Trp)	single nucleotide variant	not specified [RCV004241661]	Chr1:226735691 [GRCh38] Chr1:226923392 [GRCh37] Chr1:1q42.12	uncertain significance
NM_002221.4(ITPKB):c.1564C>T (p.Arg522Cys)	single nucleotide variant	not specified [RCV004099283]	Chr1:226735895 [GRCh38] Chr1:226923596 [GRCh37] Chr1:1q42.12	likely benign
NM_002221.4(ITPKB):c.896G>A (p.Ser299Asn)	single nucleotide variant	not specified [RCV004239272]	Chr1:226736563 [GRCh38] Chr1:226924264 [GRCh37] Chr1:1q42.12	likely benign
NM_002221.4(ITPKB):c.615G>C (p.Trp205Cys)	single nucleotide variant	not specified [RCV004091273]	Chr1:226736844 [GRCh38] Chr1:226924545 [GRCh37] Chr1:1q42.12	uncertain significance
NM_002221.4(ITPKB):c.979T>C (p.Ser327Pro)	single nucleotide variant	not specified [RCV004097684]	Chr1:226736480 [GRCh38] Chr1:226924181 [GRCh37] Chr1:1q42.12	uncertain significance
NM_002221.4(ITPKB):c.992G>T (p.Arg331Leu)	single nucleotide variant	not specified [RCV004115270]	Chr1:226736467 [GRCh38] Chr1:226924168 [GRCh37] Chr1:1q42.12	uncertain significance
NM_002221.4(ITPKB):c.913G>A (p.Glu305Lys)	single nucleotide variant	not specified [RCV004134572]	Chr1:226736546 [GRCh38] Chr1:226924247 [GRCh37] Chr1:1q42.12	uncertain significance
NM_002221.4(ITPKB):c.1703C>T (p.Ala568Val)	single nucleotide variant	not specified [RCV004185023]	Chr1:226735756 [GRCh38] Chr1:226923457 [GRCh37] Chr1:1q42.12	uncertain significance
NM_002221.4(ITPKB):c.1775A>G (p.Asn592Ser)	single nucleotide variant	not specified [RCV004215762]	Chr1:226735684 [GRCh38] Chr1:226923385 [GRCh37] Chr1:1q42.12	likely benign
NM_002221.4(ITPKB):c.1907C>T (p.Thr636Ile)	single nucleotide variant	not specified [RCV004095704]	Chr1:226735552 [GRCh38] Chr1:226923253 [GRCh37] Chr1:1q42.12	uncertain significance
NM_002221.4(ITPKB):c.455C>G (p.Ala152Gly)	single nucleotide variant	not specified [RCV004096257]	Chr1:226737004 [GRCh38] Chr1:226924705 [GRCh37] Chr1:1q42.12	uncertain significance
NM_002221.4(ITPKB):c.2269A>G (p.Thr757Ala)	single nucleotide variant	not specified [RCV004252234]	Chr1:226642103 [GRCh38] Chr1:226829804 [GRCh37] Chr1:1q42.12	uncertain significance
NM_002221.4(ITPKB):c.385A>G (p.Arg129Gly)	single nucleotide variant	not specified [RCV004275569]	Chr1:226737074 [GRCh38] Chr1:226924775 [GRCh37] Chr1:1q42.12	uncertain significance
NM_002221.4(ITPKB):c.709C>T (p.Leu237Phe)	single nucleotide variant	not specified [RCV004311179]	Chr1:226736750 [GRCh38] Chr1:226924451 [GRCh37] Chr1:1q42.12	uncertain significance
NM_002221.4(ITPKB):c.370C>T (p.Pro124Ser)	single nucleotide variant	not specified [RCV004357170]	Chr1:226737089 [GRCh38] Chr1:226924790 [GRCh37] Chr1:1q42.12	uncertain significance
NM_002221.4(ITPKB):c.1646C>G (p.Pro549Arg)	single nucleotide variant	not specified [RCV004349543]	Chr1:226735813 [GRCh38] Chr1:226923514 [GRCh37] Chr1:1q42.12	uncertain significance
NM_002221.4(ITPKB):c.151G>A (p.Gly51Arg)	single nucleotide variant	ITPKB-related disorder [RCV003901022]\|not specified [RCV004340576]	Chr1:226737308 [GRCh38] Chr1:226925009 [GRCh37] Chr1:1q42.12	likely benign\|uncertain significance
NM_002221.4(ITPKB):c.1896C>T (p.Ala632=)	single nucleotide variant	not specified [RCV003489060]	Chr1:226735563 [GRCh38] Chr1:226923264 [GRCh37] Chr1:1q42.12	benign
NM_002221.4(ITPKB):c.2625+39C>T	single nucleotide variant	not specified [RCV003489220]	Chr1:226637640 [GRCh38] Chr1:226825341 [GRCh37] Chr1:1q42.12	benign
NM_002221.4(ITPKB):c.1244C>A (p.Pro415His)	single nucleotide variant	ITPKB-related disorder [RCV003394408]\|not specified [RCV004364462]	Chr1:226736215 [GRCh38] Chr1:226923916 [GRCh37] Chr1:1q42.12	uncertain significance
NM_002221.4(ITPKB):c.2688C>T (p.Ile896=)	single nucleotide variant	not provided [RCV003414842]	Chr1:226634824 [GRCh38] Chr1:226822525 [GRCh37] Chr1:1q42.12	likely benign
NM_002221.4(ITPKB):c.880G>T (p.Gly294Trp)	single nucleotide variant	not provided [RCV003414843]	Chr1:226736579 [GRCh38] Chr1:226924280 [GRCh37] Chr1:1q42.12	likely benign
NM_002221.4(ITPKB):c.-8C>T	single nucleotide variant	not specified [RCV003489246]	Chr1:226737466 [GRCh38] Chr1:226925167 [GRCh37] Chr1:1q42.12	benign
NM_002221.4(ITPKB):c.1764C>T (p.Ser588=)	single nucleotide variant	not specified [RCV003489245]	Chr1:226735695 [GRCh38] Chr1:226923396 [GRCh37] Chr1:1q42.12	benign
NM_002221.4(ITPKB):c.526T>C (p.Ser176Pro)	single nucleotide variant	ITPKB-related disorder [RCV003962260]	Chr1:226736933 [GRCh38] Chr1:226924634 [GRCh37] Chr1:1q42.12	likely benign
NM_002221.4(ITPKB):c.2833C>G (p.Leu945Val)	single nucleotide variant	ITPKB-related disorder [RCV003919575]	Chr1:226634679 [GRCh38] Chr1:226822380 [GRCh37] Chr1:1q42.12	likely benign
NM_002221.4(ITPKB):c.1832C>T (p.Ser611Phe)	single nucleotide variant	not specified [RCV004398565]	Chr1:226735627 [GRCh38] Chr1:226923328 [GRCh37] Chr1:1q42.12	uncertain significance
NM_002221.4(ITPKB):c.2587A>G (p.Thr863Ala)	single nucleotide variant	not specified [RCV004398566]	Chr1:226637717 [GRCh38] Chr1:226825418 [GRCh37] Chr1:1q42.12	likely benign
NM_002221.4(ITPKB):c.1261G>A (p.Val421Ile)	single nucleotide variant	not specified [RCV004398558]	Chr1:226736198 [GRCh38] Chr1:226923899 [GRCh37] Chr1:1q42.12	uncertain significance
NM_002221.4(ITPKB):c.1439C>T (p.Pro480Leu)	single nucleotide variant	not specified [RCV004398560]	Chr1:226736020 [GRCh38] Chr1:226923721 [GRCh37] Chr1:1q42.12	uncertain significance
NM_002221.4(ITPKB):c.144C>G (p.Phe48Leu)	single nucleotide variant	not specified [RCV004398562]	Chr1:226737315 [GRCh38] Chr1:226925016 [GRCh37] Chr1:1q42.12	uncertain significance
NM_002221.4(ITPKB):c.205C>G (p.Pro69Ala)	single nucleotide variant	not specified [RCV004633585]	Chr1:226737254 [GRCh38] Chr1:226924955 [GRCh37] Chr1:1q42.12	uncertain significance
NM_002221.4(ITPKB):c.100C>G (p.Pro34Ala)	single nucleotide variant	not specified [RCV004398557]	Chr1:226737359 [GRCh38] Chr1:226925060 [GRCh37] Chr1:1q42.12	uncertain significance
NM_002221.4(ITPKB):c.1397T>C (p.Val466Ala)	single nucleotide variant	not specified [RCV004398559]	Chr1:226736062 [GRCh38] Chr1:226923763 [GRCh37] Chr1:1q42.12	uncertain significance
NM_002221.4(ITPKB):c.1799C>T (p.Ser600Phe)	single nucleotide variant	not specified [RCV004398563]	Chr1:226735660 [GRCh38] Chr1:226923361 [GRCh37] Chr1:1q42.12	uncertain significance
NM_002221.4(ITPKB):c.336G>T (p.Gln112His)	single nucleotide variant	not specified [RCV004398567]	Chr1:226737123 [GRCh38] Chr1:226924824 [GRCh37] Chr1:1q42.12	uncertain significance
NM_002221.4(ITPKB):c.530C>T (p.Pro177Leu)	single nucleotide variant	not specified [RCV004398568]	Chr1:226736929 [GRCh38] Chr1:226924630 [GRCh37] Chr1:1q42.12	uncertain significance
NM_002221.4(ITPKB):c.633G>C (p.Glu211Asp)	single nucleotide variant	not specified [RCV004398570]	Chr1:226736826 [GRCh38] Chr1:226924527 [GRCh37] Chr1:1q42.12	uncertain significance
NM_002221.4(ITPKB):c.2209G>A (p.Asp737Asn)	single nucleotide variant	not specified [RCV004633586]	Chr1:226647204 [GRCh38] Chr1:226834905 [GRCh37] Chr1:1q42.12	uncertain significance
NC_000001.10:g.(?_225591005)_(227174438_?)del	deletion	not provided [RCV004579153]	Chr1:225591005..227174438 [GRCh37] Chr1:1q42.12-42.13	pathogenic
NM_002221.4(ITPKB):c.667C>A (p.Pro223Thr)	single nucleotide variant	not specified [RCV004633583]	Chr1:226736792 [GRCh38] Chr1:226924493 [GRCh37] Chr1:1q42.12	uncertain significance
NM_002221.4(ITPKB):c.2278C>T (p.Arg760Trp)	single nucleotide variant	not specified [RCV004633581]	Chr1:226642094 [GRCh38] Chr1:226829795 [GRCh37] Chr1:1q42.12	uncertain significance
NM_002221.4(ITPKB):c.1454C>T (p.Ala485Val)	single nucleotide variant	not specified [RCV004633582]	Chr1:226736005 [GRCh38] Chr1:226923706 [GRCh37] Chr1:1q42.12	uncertain significance
NM_002221.4(ITPKB):c.1342C>T (p.Pro448Ser)	single nucleotide variant	not specified [RCV004633584]	Chr1:226736117 [GRCh38] Chr1:226923818 [GRCh37] Chr1:1q42.12	uncertain significance
NM_002221.4(ITPKB):c.2270C>T (p.Thr757Met)	single nucleotide variant	not specified [RCV004934503]	Chr1:226642102 [GRCh38] Chr1:226829803 [GRCh37] Chr1:1q42.12	uncertain significance
NM_002221.4(ITPKB):c.614G>C (p.Trp205Ser)	single nucleotide variant	not specified [RCV004934505]	Chr1:226736845 [GRCh38] Chr1:226924546 [GRCh37] Chr1:1q42.12	uncertain significance
NM_002221.4(ITPKB):c.1346C>T (p.Thr449Met)	single nucleotide variant	not specified [RCV004934507]	Chr1:226736113 [GRCh38] Chr1:226923814 [GRCh37] Chr1:1q42.12	uncertain significance
NM_002221.4(ITPKB):c.1604A>G (p.Gln535Arg)	single nucleotide variant	not specified [RCV004934504]	Chr1:226735855 [GRCh38] Chr1:226923556 [GRCh37] Chr1:1q42.12	uncertain significance
NM_002221.4(ITPKB):c.1271A>G (p.Glu424Gly)	single nucleotide variant	not specified [RCV004934506]	Chr1:226736188 [GRCh38] Chr1:226923889 [GRCh37] Chr1:1q42.12	uncertain significance
NM_002221.4(ITPKB):c.1510G>C (p.Gly504Arg)	single nucleotide variant	not specified [RCV004934508]	Chr1:226735949 [GRCh38] Chr1:226923650 [GRCh37] Chr1:1q42.12	uncertain significance
NM_002221.4(ITPKB):c.109C>G (p.Pro37Ala)	single nucleotide variant	not specified [RCV004934509]	Chr1:226737350 [GRCh38] Chr1:226925051 [GRCh37] Chr1:1q42.12	uncertain significance
NM_002221.4(ITPKB):c.328C>T (p.Arg110Trp)	single nucleotide variant	not specified [RCV004934510]	Chr1:226737131 [GRCh38] Chr1:226924832 [GRCh37] Chr1:1q42.12	uncertain significance
NM_002221.4(ITPKB):c.2092C>T (p.Arg698Cys)	single nucleotide variant	not specified [RCV004934511]	Chr1:226647321 [GRCh38] Chr1:226835022 [GRCh37] Chr1:1q42.12	uncertain significance

Predicted Target Of

	Summary Value
Count of predictions:	364
Count of miRNA genes:	217
Interacting mature miRNAs:	261
Transcripts:	ENSRNOT00000013390
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331729	Rf42	Renal function QTL 42	3.071		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	15	17362897	73690657	Rat
1582227	Gluco30	Glucose level QTL 30	3.6	0.0003	blood glucose amount (VT:0000188)	absolute change in blood glucose level area under curve (CMO:0002034)	15	28030665	82262678	Rat
1582228	Epfw3	Epididymal fat weight QTL 3	4.1	0.0002	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	15	28030665	82262678	Rat
1578646	Bmd18	Bone mineral density QTL 18	5.2		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	15	22806240	98288169	Rat
1578647	Bmd17	Bone mineral density QTL 17	4		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	15	22806240	98288169	Rat
2293686	Bmd36	Bone mineral density QTL 36	7.4	0.0001	femur strength trait (VT:0010010)	femoral neck ultimate force (CMO:0001703)	15	33611058	71477291	Rat
2317750	Glom26	Glomerulus QTL 26	4.3		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	15	12496141	65205939	Rat
2298549	Neuinf12	Neuroinflammation QTL 12	3.5		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	15	1	55302115	Rat
2293691	Bmd37	Bone mineral density QTL 37	6.6	0.0001	femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	15	33611058	71477291	Rat
2293688	Bss29	Bone structure and strength QTL 29	5.31	0.0001	femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	15	11111142	56111142	Rat
1582214	Stl21	Serum triglyceride level QTL 21	3.1	0.022	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	15	28030665	82262678	Rat
631273	Lecl2	Lens clarity QTL 2		0.001	lens clarity trait (VT:0001304)	age of onset/diagnosis of cataract (CMO:0001584)	15	10596089	55596089	Rat
1300144	Rf23	Renal function QTL 23	3.61		renal blood flow trait (VT:2000006)	absolute change in renal vascular resistance (CMO:0001900)	15	40631268	98288169	Rat
2300167	Bmd63	Bone mineral density QTL 63	5.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	15	11111142	56111142	Rat
738017	Hcas7	Hepatocarcinoma susceptibility QTL 7	2.91		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464)	15	2266368	46921453	Rat
152025253	Hrtrt24	Heart rate QTL 24	3.82		heart pumping trait (VT:2000009)		15	27885774	86257085	Rat
10054130	Srcrt8	Stress Responsive Cort QTL 8	2.18	0.0085	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	15	22117933	67117933	Rat
2300173	Bmd62	Bone mineral density QTL 62	12.8	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	15	11111142	56111142	Rat
2324620	Coatc3	Coat color QTL 3			coat/hair pigmentation trait (VT:0010463)	pigmented coat/hair area to total coat/hair area ratio (CMO:0001810)	15	19856566	46187442	Rat
61424	Scl1	Serum cholesterol level QTL 1	7.7	0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	15	16725528	80672115	Rat
1582251	Gluco24	Glucose level QTL 24	3.2	0.0008	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	15	5530756	50530756	Rat
1598828	Glom14	Glomerulus QTL 14	2.5		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	15	34054139	79054139	Rat
1582242	Gluco28	Glucose level QTL 28	3.3	0.0008	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	15	28030665	82262678	Rat
2306968	Anxrr23	Anxiety related response QTL 23	4.83		reflex trait (VT:0001961)	amplitude of the acoustic startle response (CMO:0001520)	15	40631268	46187442	Rat
1578660	Bss19	Bone structure and strength QTL 19	4.3		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	15	22806240	98288169	Rat
1582244	Bw79	Body weight QTL 79	4	0.0002	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	15	28030665	82262678	Rat
7411725	Strs7	Sensitivity to stroke QTL 7	3.8		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	15	40289901	49308583	Rat

RH127846

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	15	45,511,679 - 45,511,888 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	52,129,564 - 52,129,772	NCBI	Rnor6.0
Rnor_5.0	15	55,853,081 - 55,853,289	UniSTS	Rnor5.0
RGSC_v3.4	15	50,838,246 - 50,838,454	UniSTS	RGSC3.4
Celera	15	45,190,806 - 45,191,014	UniSTS
Cytogenetic Map	15	p11	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001031653	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006252272	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC099167	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473951	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000015	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000013390 ⟹ ENSRNOP00000013390

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	15	45,511,589 - 45,516,353 (-)	Ensembl
Rnor_6.0 Ensembl	15	52,129,471 - 52,134,140 (-)	Ensembl

RefSeq Acc Id:

NM_001031653 ⟹ NP_001026823

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	51,921,283 - 51,925,952 (-)	NCBI
mRatBN7.2	15	45,511,587 - 45,516,256 (-)	NCBI
Rnor_6.0	15	52,129,471 - 52,134,140 (-)	NCBI
Rnor_5.0	15	55,852,988 - 55,857,657 (-)	NCBI
RGSC_v3.4	15	50,838,153 - 50,842,822 (-)	RGD
Celera	15	45,190,713 - 45,195,382 (-)	RGD

Sequence:

show sequence

TAGAGGTGAGGTCGTGAAACTCGGCGTAGAGCCTCAACGCAGGAACCATGTCGGAAGGAAACGCCGCGGGCGAGCCCAGCAATCCTGGAGGGCCCCGACCCCTTCTCTCTGGGGGCCGGGGACTTGTG
GGCCGGCGGCCCGCTCCCCCGCTTACGCCAGGCCGCCTTCCCTCCATCCGCTCTCGGGACCTCACCCTTGGCGGTGTCAAGAAGAAAACCTTCACCCCAAATATCATCAGTCGGAAGATCAAAGAAGA
GCCAAAGGAAGAAGTAACTATGAAGAAGGAAAAGCGTGAACGGGACAGAGACCGCCAGCGTGAGGGTCATGGACGGGGACGTGGCCGCCCAGAAGTGATCCAGTCCCATTCCATCTTTGAGCAGGGTC
CAGCAGAAATGATGAAAAAAAAAGGGAACTGGGATAAGACTGTGGATATGTCAGACATGGGGCCTTCTCATATCATCAACATCAAAAAAGAGAAGAGAGAAACAGATGAAGAAACCAAGCAGATCTTG
CGCATGCTGGAGAAGGATGATTTCATCGATGACCCAGGGCTAAAGAATGACACACGGAACATGCCAGTACAACTGCCACTGGCTCATTCAGGGTGGCTTTTCAAGGAGGAGAGTGAAGAGCCAGACGT
TAAGCCTTTTTCTGCTGGCCCCAAGGAAGAAGACATGGAGGTGGATGTGCCAGCTGTAAAAGTGAAAGAGGAGCCACGGGATGAGGAAGAGGAGGCGAAAGTGAAAGCCCCTCCAAGAGCAGCCAGGA
AGACCCCTGGTCTTCCAAAGGACGTGTCTGTGGCAGAGCTGCTGAGGGAGTTGAGCCTCACGAAGGAGGAGGAGCTGCTGTTCCTTCAGCTGCCTGATACCCTCCCTGGGCAGCCGCCTACTCAGGAC
ATCAAGCCTGTCAAGACAGAGGTGCAGGGCGAGGATGGACAGATGGTAGTCATAAAGCAAGAAAAGGACCGGGAAACCAGGCTAGCAGAGAATGCTTGTACCTTGGCTGACCTGACAGAGGGTCAAGT
GGGCAAGCTACTCATCCGCAAATCAGGGAAGGTGCAGCTTCTCCTGGGCAAGGTGACTCTGGATGTGACCATGGGAACAACCTGTTCTTTCCTGCAGGAACTGGTGTCTGTGGGCCTTGGGGACAGCA
GGACAGGGGAGATGACAGTCCTAGGACATGTGAAGCACAAACTTGTATGTTCTCCTGATTTTGAATCTCTCTTGGATCACAAACACCGGTGAAATGGACAGATGGAGGAGGATGGTGACTGCCCATGA
CCGCTGCCTACTCCAGACCTTTGTTCTCAAAGACATGCAGCCCAGTTGGGGCCTCTTTAACCCACTTGTTGCAGCTTTTGGTGGCTATAGTCCCAGTCCCCCCAACCCCCACACTAGGGCCCATGCTG
CCCCCCGCCCCCCCAGCAGCTATGAGTGGGAATTGACACAGCATGAGTATGGAAACGTCCTCACTTCTGGGAACCTGACCCTGCTATTTATTTTATTTATGTCTTAATCCTCAACTGACTGCATCCTC
GCAGAGCAGGATGGGGCAGGCTTCTTTTTGGGGAGCCATGGGCTACAGGGCTCAAGGGGGTAGGAAAGAACCGGGATAGGATAGAACTGCCGGAGACTTAAAACTCAGTCTCAGCTCACTGGTCTCTA
GTTCAGTGTCCCTGAACAAACTACCTAACCTTTCTGAGCCTCGTAGTCCTCACCTGACATGTGAGGATAATACCTACCTCACAGGGTTGGGGTGAGGATCAAACGGAATGTTGTAGATGAGAACTCCT
TGCACAAGACCAGGCATACATTGTATAAGGGTGTGTATGTATGTATACACATATATACACATACCCATAGGCGCTCAATAAATGTTAGTTTTCCTTTCCTTTGCAAAAAAAAAAAAAAAAAAAAAAAA
A

hide sequence

RefSeq Acc Id:

XM_006252272 ⟹ XP_006252334

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	51,921,289 - 51,925,910 (-)	NCBI
mRatBN7.2	15	45,511,593 - 45,516,215 (-)	NCBI
Rnor_6.0	15	52,129,477 - 52,134,095 (-)	NCBI
Rnor_5.0	15	55,852,988 - 55,857,657 (-)	NCBI

Sequence:

show sequence

CGTCATGCAGTCCCGGGGAGAGGGCATGTGACGAGTCCAAAGCTAGAGGAACCATGTCGGAAGG
AAACGCCGCGGGCGAGCCCAGCAATCCTGGAGGGCCCCGACCCCTTCTCTCTGGGGGCCGGGGACTTGTGGGCCGGCGGCCCGCTCCCCCGCTTACGCCAGGCCGCCTTCCCTCCATCCGCTCTCGGG
ACCTCACCCTTGGCGGTGTCAAGAAGAAAACCTTCACCCCAAATATCATCAGTCGGAAGATCAAAGAAGAGCCAAAGGAAGAAGTAACTATGAAGAAGGAAAAGCGTGAACGGGACAGAGACCGCCAG
CGTGAGGGTCATGGACGGGGACGTGGCCGCCCAGAAGTGATCCAGTCCCATTCCATCTTTGAGCAGGGTCCAGCAGAAATGATGAAAAAAAAAGGGAACTGGGATAAGACTGTGGATATGTCAGACAT
GGGGCCTTCTCATATCATCAACATCAAAAAAGAGAAGAGAGAAACAGATGAAGAAACCAAGCAGATCTTGCGCATGCTGGAGAAGGATGATTTCATCGATGACCCAGGGCTAAAGAATGACACACGGA
ACATGCCAGTACAACTGCCACTGGCTCATTCAGGGTGGCTTTTCAAGGAGGAGAGTGAAGAGCCAGACGTTAAGCCTTTTTCTGCTGGCCCCAAGGAAGAAGACATGGAGGTGGATGTGCCAGCTGTA
AAAGTGAAAGAGGAGCCACGGGATGAGGAAGAGGAGGCGAAAGTGAAAGCCCCTCCAAGAGCAGCCAGGAAGACCCCTGGTCTTCCAAAGGACGTGTCTGTGGCAGAGCTGCTGAGGGAGTTGAGCCT
CACGAAGGAGGAGGAGCTGCTGTTCCTTCAGCTGCCTGATACCCTCCCTGGGCAGCCGCCTACTCAGGACATCAAGCCTGTCAAGACAGAGGTGCAGGGCGAGGATGGACAGATGGTAGTCATAAAGC
AAGAAAAGGACCGGGAAACCAGGCTAGCAGAGAATGCTTGTACCTTGGCTGACCTGACAGAGGGTCAAGTGGGCAAGCTACTCATCCGCAAATCAGGGAAGGTGCAGCTTCTCCTGGGCAAGGTGACT
CTGGATGTGACCATGGGAACAACCTGTTCTTTCCTGCAGGAACTGGTGTCTGTGGGCCTTGGGGACAGCAGGACAGGGGAGATGACAGTCCTAGGACATGTGAAGCACAAACTTGTATGTTCTCCTGA
TTTTGAATCTCTCTTGGATCACAAACACCGGTGAAATGGACAGATGGAGGAGGATGGTGACTGCCCATGACCGCTGCCTACTCCAGACCTTTGTTCTCAAAGACATGCAGCCCAGTTGGGGCCTCTTT
AACCCACTTGTTGCAGCTTTTGGTGGCTATAGTCCCAGTCCCCCCAACCCCCACACTAGGGCCCATGCTGCCCCCCGCCCCCCCAGCAGCTATGAGTGGGAATTGACACAGCATGAGTATGGAAACGT
CCTCACTTCTGGGAACCTGACCCTGCTATTTATTTTATTTATGTCTTAATCCTCAACTGACTGCATCCTCGCAGAGCAGGATGGGGCAGGCTTCTTTTTGGGGAGCCATGGGCTACAGGGCTCAAGGG
GGTAGGAAAGAACCGGGATAGGATAGAACTGCCGGAGACTTAAAACTCAGTCTCAGCTCACTGGTCTCTAGTTCAGTGTCCCTGAACAAACTACCTAACCTTTCTGAGCCTCGTAGTCCTCACCTGAC
ATGTGAGGATAATACCTACCTCACAGGGTTGGGGTGAGGATCAAACGGAATGTTGTAGATGAGAACTCCTTGCACAAGACCAGGCATACATTGTATAAGGGTGTGTATGTATGTATACACATATATAC
ACATACCCATAGGCGCTCAATAAATGTTAGTTTTCCTTTC

hide sequence


Protein RefSeqs	NP_001026823	(Get FASTA)	NCBI Sequence Viewer
	XP_006252334	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH99167	(Get FASTA)	NCBI Sequence Viewer
	EDM02217	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000013390
	ENSRNOP00000013390.4

RefSeq Acc Id:

NP_001026823 ⟸ NM_001031653

- UniProtKB:

Q4FZS9 (UniProtKB/TrEMBL), F7EKD9 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSEGNAAGEPSNPGGPRPLLSGGRGLVGRRPAPPLTPGRLPSIRSRDLTLGGVKKKTFTPNIISRKIKEEPKEEVTMKKEKRERDRDRQREGHGRGRGRPEVIQSHSIFEQGPAEMMKKKGNWDKTVD
MSDMGPSHIINIKKEKRETDEETKQILRMLEKDDFIDDPGLKNDTRNMPVQLPLAHSGWLFKEESEEPDVKPFSAGPKEEDMEVDVPAVKVKEEPRDEEEEAKVKAPPRAARKTPGLPKDVSVAELLR
ELSLTKEEELLFLQLPDTLPGQPPTQDIKPVKTEVQGEDGQMVVIKQEKDRETRLAENACTLADLTEGQVGKLLIRKSGKVQLLLGKVTLDVTMGTTCSFLQELVSVGLGDSRTGEMTVLGHVKHKLV
CSPDFESLLDHKHR

hide sequence

RefSeq Acc Id:	XP_006252334 ⟸ XM_006252272
- Peptide Label:	isoform X1
- UniProtKB:	Q4FZS9 (UniProtKB/TrEMBL), F7EKD9 (UniProtKB/TrEMBL)
- Sequence:	show sequence MSEGNAAGEPSNPGGPRPLLSGGRGLVGRRPAPPLTPGRLPSIRSRDLTLGGVKKKTFTPNIIS RKIKEEPKEEVTMKKEKRERDRDRQREGHGRGRGRPEVIQSHSIFEQGPAEMMKKKGNWDKTVDMSDMGPSHIINIKKEKRETDEETKQILRMLEKDDFIDDPGLKNDTRNMPVQLPLAHSGWLFKEE SEEPDVKPFSAGPKEEDMEVDVPAVKVKEEPRDEEEEAKVKAPPRAARKTPGLPKDVSVAELLRELSLTKEEELLFLQLPDTLPGQPPTQDIKPVKTEVQGEDGQMVVIKQEKDRETRLAENACTLAD LTEGQVGKLLIRKSGKVQLLLGKVTLDVTMGTTCSFLQELVSVGLGDSRTGEMTVLGHVKHKLVCSPDFESLLDHKHR hide sequence

Ensembl Acc Id:

ENSRNOP00000013390 ⟸ ENSRNOT00000013390

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q4FZS9-F1-model_v2	AlphaFold	Q4FZS9	1-398	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13699809

Promoter ID:

EPDNEW_R10332

Type:

initiation region

Name:

Polr3d_1

Description:

RNA polymerase III subunit D

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	15	52,134,186 - 52,134,246	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-13221	BioCyc
Ensembl Genes	ENSRNOG00000010028	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000013390	ENTREZGENE
	ENSRNOT00000013390.5	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7382125	IMAGE-MGC_LOAD
InterPro	RNA_pol_Rpc4	UniProtKB/TrEMBL
KEGG Report	rno:306012	UniProtKB/TrEMBL
MGC_CLONE	MGC:116334	IMAGE-MGC_LOAD
NCBI Gene	306012	ENTREZGENE
PANTHER	DNA-DIRECTED RNA POLYMERASE III SUBUNIT RPC4	UniProtKB/TrEMBL
	RNA_pol_Rpc4	UniProtKB/TrEMBL
Pfam	RNA_pol_Rpc4	UniProtKB/TrEMBL
PhenoGen	Polr3d	PhenoGen
RatGTEx	ENSRNOG00000010028	RatGTEx
UniProt	F7EKD9	ENTREZGENE, UniProtKB/TrEMBL
	Q4FZS9	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-07-21	Polr3d	RNA polymerase III subunit D	Polr3d	polymerase (RNA) III subunit D	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-03-16	Polr3d	polymerase (RNA) III subunit D	Polr3d	polymerase (RNA) III (DNA directed) polypeptide D	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2009-10-22	Polr3d	polymerase (RNA) III (DNA directed) polypeptide D	Polr3d	polymerase (RNA) III (DNA directed) polypeptide D, 44kDa	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-24	Polr3d	polymerase (RNA) III (DNA directed) polypeptide D, 44kDa	Polr3d	polymerase (RNA) III (DNA directed) polypeptide D	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Polr3d	polymerase (RNA) III (DNA directed) polypeptide D	Polr3d_predicted	polymerase (RNA) III (DNA directed) polypeptide D (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Polr3d_predicted	polymerase (RNA) III (DNA directed) polypeptide D (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Imported Annotations - KEGG (archival)