Enables phosphomevalonate kinase activity. Involved in isopentenyl diphosphate biosynthetic process, mevalonate pathway. Predicted to be located in cytosol and peroxisome. Human ortholog(s) of this gene implicated in porokeratosis. Orthologous to human PMVK (phosphomevalonate kinase); PARTICIPATES IN alendronate pharmacodynamics pathway; cholesterol biosynthetic pathway; cholesterol ester storage disease pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.
[azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased expression of PMVK mRNA
[azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased expression of PMVK mRNA
[NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PMVK mRNA
[azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased expression of PMVK mRNA
[azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased expression of PMVK mRNA
[Diethylnitrosamine co-treated with Phenobarbital] results in decreased expression of PMVK mRNA and [Diethylnitrosamine co-treated with Phenobarbital] results in increased methylation of PMVK promoter
[Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of PMVK mRNA and [Air Pollutants results in increased abundance of Ozone] which results in increased expression of PMVK mRNA
[perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of PMVK mRNA and [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of PMVK mRNA
[Diethylnitrosamine co-treated with Phenobarbital] results in decreased expression of PMVK mRNA and [Diethylnitrosamine co-treated with Phenobarbital] results in increased methylation of PMVK promoter
[NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PMVK mRNA
[NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PMVK mRNA
[azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased expression of PMVK mRNA
MAPLGASPRLVLLFSGKRKSGKDFVTERLQSRLGGNICAVLRLSGPLKEQYAREHGLDFQKLLD ASTYKETYRRDMICWGEEKRQADPGFFCRKIVEGVSQPIWLVSDTRRMSDIQWFQEAYGALTQT VRVVASEQSRQQRGWVFTRGVDDAESECGLDSFGDFDWVIENHGDEQCLEDQLENLLEFIHAKL QR