Advanced Search (OLGA)

Gene: Atg13 (autophagy related 13) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Atg13

Name:

autophagy related 13

RGD ID:

1310685

Description:

Predicted to enable protein kinase binding activity and protein serine/threonine kinase activator activity. Predicted to be involved in several processes, including macroautophagy; positive regulation of protein targeting to mitochondrion; and response to mitochondrial depolarisation. Predicted to act upstream of or within autophagosome assembly. Predicted to be located in mitochondrion. Predicted to be part of Atg1/ULK1 kinase complex. Predicted to be active in autophagosome; cytosol; and phagophore assembly site membrane. Orthologous to human ATG13 (autophagy related 13); PARTICIPATES IN autophagy pathway; mTOR signaling pathway; INTERACTS WITH 3-chloropropane-1,2-diol; bisphenol A; endosulfan.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

ATG13 autophagy related 13 homolog; ATG13 autophagy related 13 homolog (S. cerevisiae); autophagy-related protein 13; Harbi1; Harbi1l; harbinger transposase derived 1; harbinger transposase derived 1-like; LOC362164; RGD1310685; similar to hypothetical protein D2Ertd391e

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ATG13 (autophagy related 13)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):	Atg13 (autophagy related 13)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Atg13 (autophagy related 13)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ATG13 (autophagy related 13)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ATG13 (autophagy related 13)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Atg13 (autophagy related 13)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ATG13 (autophagy related 13)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ATG13 (autophagy related 13)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Atg13 (autophagy related 13)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	PCDHB4 (protocadherin beta 4)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Atg13 (autophagy related 13)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	ATG13 (autophagy related 13)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	atg13 (ATG13 autophagy related 13 homolog (S. cerevisiae))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Atg13	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	atg-13	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	atg13	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	98,102,831 - 98,136,741 (-)	NCBI		GRCr8
mRatBN7.2	3	77,647,069 - 77,681,028 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	77,645,790 - 77,681,043 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	81,122,107 - 81,156,207 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	89,721,130 - 89,755,231 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	87,572,391 - 87,606,504 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	80,580,549 - 80,614,554 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	80,581,247 - 80,601,410 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	87,279,649 - 87,313,654 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	76,056,642 - 76,090,287 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	75,953,473 - 75,986,537 (-)	NCBI
Celera	3	76,851,283 - 76,885,195 (-)	NCBI		Celera
Cytogenetic Map	3	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Atg13	Rat	Liver Reperfusion Injury	ameliorates	ISO	Atg13 (Mus musculus)	329902072		RGD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Atg13	Rat	congenital disorder of glycosylation type IIc		ISO	ATG13 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Rambam Hasharon syndrome	ClinVar	PMID:16455955 more ...
Atg13	Rat	intellectual disability		ISO	ATG13 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Intellectual disability	ClinVar
Atg13	Rat	prostate cancer		ISO	ATG13 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Malignant tumor of prostate	ClinVar	PMID:23265383

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Atg13	Rat	(-)-anisomycin	decreases expression	ISO	ATG13 (Homo sapiens)	6480464	Anisomycin results in decreased expression of ATG13 protein	CTD	PMID:27629431
Atg13	Rat	17beta-estradiol	increases expression	ISO	Atg13 (Mus musculus)	6480464	Estradiol results in increased expression of ATG13 mRNA	CTD	PMID:39298647
Atg13	Rat	3-chloropropane-1,2-diol	increases expression	EXP		6480464	alpha-Chlorohydrin results in increased expression of ATG13 protein	CTD	PMID:34915118
Atg13	Rat	antimycin A	multiple interactions	ISO	ATG13 (Homo sapiens)	6480464	Antimycin A promotes the reaction [ATG13 protein results in increased expression of ULK1 protein] and ATG13 protein promotes the reaction [Antimycin A results in increased expression of ULK1 protein]	CTD	PMID:27629431
Atg13	Rat	arsenite(3-)	increases expression	ISO	Atg13 (Mus musculus)	6480464	arsenite results in increased expression of ATG13 mRNA	CTD	PMID:33053406
Atg13	Rat	arsenite(3-)	increases expression	ISO	ATG13 (Homo sapiens)	6480464	arsenite results in increased expression of ATG13 protein	CTD	PMID:34929507
Atg13	Rat	arsenous acid	increases expression	ISO	Atg13 (Mus musculus)	6480464	Arsenic Trioxide results in increased expression of ATG13 mRNA	CTD	PMID:32112876
Atg13	Rat	atrazine	increases expression	ISO	Atg13 (Mus musculus)	6480464	Atrazine results in increased expression of ATG13 mRNA	CTD	PMID:30360616
Atg13	Rat	atrazine	multiple interactions	ISO	Atg13 (Mus musculus)	6480464	Lycopene inhibits the reaction [Atrazine results in increased expression of ATG13 mRNA]	CTD	PMID:30360616
Atg13	Rat	benzo[a]pyrene	increases expression	ISO	ATG13 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased expression of ATG13 protein	CTD	PMID:32717239
Atg13	Rat	bis(2-ethylhexyl) phthalate	increases expression	ISO	Atg13 (Mus musculus)	6480464	Diethylhexyl Phthalate results in increased expression of ATG13 mRNA	CTD	PMID:34319233
Atg13	Rat	bisphenol A	affects expression	EXP		6480464	bisphenol A affects the expression of ATG13 mRNA	CTD	PMID:25181051
Atg13	Rat	bisphenol A	decreases methylation	ISO	ATG13 (Homo sapiens)	6480464	bisphenol A results in decreased methylation of ATG13 gene	CTD	PMID:31601247
Atg13	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of ATG13 mRNA	CTD	PMID:34947998
Atg13	Rat	bisphenol F	increases expression	ISO	Atg13 (Mus musculus)	6480464	bisphenol F results in increased expression of ATG13 mRNA	CTD	PMID:38685157
Atg13	Rat	cadmium atom	decreases expression	ISO	Atg13 (Mus musculus)	6480464	Cadmium results in decreased expression of ATG13 mRNA	CTD	PMID:24067728
Atg13	Rat	cadmium sulfide	increases expression	ISO	ATG13 (Homo sapiens)	6480464	cadmium sulfide results in increased expression of ATG13 mRNA	CTD	PMID:27866839
Atg13	Rat	carbon nanotube	decreases expression	ISO	Atg13 (Mus musculus)	6480464	Nanotubes more ...	CTD	PMID:25554681
Atg13	Rat	cisplatin	multiple interactions	ISO	ATG13 (Homo sapiens)	6480464	[Cisplatin co-treated with jinfukang] results in increased expression of ATG13 mRNA	CTD	PMID:27392435
Atg13	Rat	cisplatin	increases expression	ISO	ATG13 (Homo sapiens)	6480464	Cisplatin results in increased expression of ATG13 mRNA	CTD	PMID:27392435
Atg13	Rat	clobetasol	increases expression	ISO	Atg13 (Mus musculus)	6480464	Clobetasol results in increased expression of ATG13 mRNA	CTD	PMID:27462272
Atg13	Rat	clofibrate	decreases expression	ISO	Atg13 (Mus musculus)	6480464	Clofibrate results in decreased expression of ATG13 mRNA	CTD	PMID:23811191
Atg13	Rat	coumarin	increases phosphorylation	ISO	ATG13 (Homo sapiens)	6480464	coumarin results in increased phosphorylation of ATG13 protein	CTD	PMID:35688186
Atg13	Rat	cycloheximide	decreases expression	ISO	ATG13 (Homo sapiens)	6480464	Cycloheximide results in decreased expression of ATG13 protein	CTD	PMID:27629431
Atg13	Rat	cyclosporin A	increases expression	ISO	ATG13 (Homo sapiens)	6480464	Cyclosporine results in increased expression of ATG13 mRNA	CTD	PMID:20106945 and PMID:25562108
Atg13	Rat	diarsenic trioxide	increases expression	ISO	Atg13 (Mus musculus)	6480464	Arsenic Trioxide results in increased expression of ATG13 mRNA	CTD	PMID:32112876
Atg13	Rat	dinitrogen	multiple interactions	ISO	ATG13 (Homo sapiens)	6480464	ATG13 protein inhibits the reaction [Nitrogen deficiency results in decreased expression of ULK1 protein] more ...	CTD	PMID:27629431
Atg13	Rat	elemental selenium	increases expression	ISO	ATG13 (Homo sapiens)	6480464	Selenium results in increased expression of ATG13 mRNA	CTD	PMID:19244175
Atg13	Rat	endosulfan	increases expression	EXP		6480464	Endosulfan results in increased expression of ATG13 mRNA	CTD	PMID:29391264
Atg13	Rat	ethanol	affects splicing	ISO	Atg13 (Mus musculus)	6480464	Ethanol affects the splicing of ATG13 mRNA	CTD	PMID:30319688
Atg13	Rat	gallic acid	increases expression	ISO	ATG13 (Homo sapiens)	6480464	Gallic Acid results in increased expression of ATG13 mRNA	CTD	PMID:34408198
Atg13	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of ATG13 mRNA	CTD	PMID:33387578
Atg13	Rat	glafenine	increases expression	EXP		6480464	Glafenine results in increased expression of ATG13 mRNA	CTD	PMID:24136188
Atg13	Rat	lead diacetate	affects expression	EXP		6480464	lead acetate affects the expression of ATG13 protein	CTD	PMID:36539177
Atg13	Rat	lycopene	multiple interactions	ISO	Atg13 (Mus musculus)	6480464	Lycopene inhibits the reaction [Atrazine results in increased expression of ATG13 mRNA]	CTD	PMID:30360616
Atg13	Rat	Morroniside	increases expression	ISO	Atg13 (Mus musculus)	6480464	morroniside results in increased expression of ATG13 protein	CTD	PMID:35957534
Atg13	Rat	Morroniside	multiple interactions	ISO	Atg13 (Mus musculus)	6480464	MTOR inhibits the reaction [morroniside results in increased expression of ATG13 protein]	CTD	PMID:35957534
Atg13	Rat	N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal	multiple interactions	ISO	ATG13 (Homo sapiens)	6480464	benzyloxycarbonylleucyl-leucyl-leucine aldehyde promotes the reaction [ATG13 protein results in decreased expression of SQSTM1 protein]	CTD	PMID:27629431
Atg13	Rat	perfluorohexanesulfonic acid	decreases expression	ISO	Atg13 (Mus musculus)	6480464	perfluorohexanesulfonic acid results in decreased expression of ATG13 mRNA	CTD	PMID:37995155
Atg13	Rat	pirinixic acid	multiple interactions	ISO	Atg13 (Mus musculus)	6480464	[pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of ATG13 mRNA	CTD	PMID:19710929
Atg13	Rat	pirinixic acid	decreases expression	ISO	Atg13 (Mus musculus)	6480464	pirinixic acid results in decreased expression of ATG13 mRNA	CTD	PMID:23811191
Atg13	Rat	progesterone	affects expression	ISO	Atg13 (Mus musculus)	6480464	Progesterone affects the expression of ATG13 mRNA	CTD	PMID:17251523
Atg13	Rat	selenium atom	increases expression	ISO	ATG13 (Homo sapiens)	6480464	Selenium results in increased expression of ATG13 mRNA	CTD	PMID:19244175
Atg13	Rat	silicon dioxide	increases expression	ISO	ATG13 (Homo sapiens)	6480464	Silicon Dioxide analog results in increased expression of ATG13 mRNA	CTD	PMID:25895662
Atg13	Rat	sodium arsenite	affects methylation	ISO	ATG13 (Homo sapiens)	6480464	sodium arsenite affects the methylation of ATG13 gene	CTD	PMID:28589171
Atg13	Rat	sodium arsenite	increases expression	ISO	ATG13 (Homo sapiens)	6480464	sodium arsenite results in increased expression of ATG13 mRNA	CTD	PMID:38568856
Atg13	Rat	tetrachloromethane	increases expression	ISO	Atg13 (Mus musculus)	6480464	Carbon Tetrachloride results in increased expression of ATG13 mRNA	CTD	PMID:31919559
Atg13	Rat	thimerosal	decreases expression	ISO	ATG13 (Homo sapiens)	6480464	Thimerosal results in decreased expression of ATG13 mRNA	CTD	PMID:27188386
Atg13	Rat	thioacetamide	decreases expression	EXP		6480464	Thioacetamide results in decreased expression of ATG13 mRNA	CTD	PMID:34492290
Atg13	Rat	thiram	increases expression	ISO	ATG13 (Homo sapiens)	6480464	Thiram results in increased expression of ATG13 mRNA	CTD	PMID:38568856
Atg13	Rat	titanium dioxide	decreases methylation	ISO	Atg13 (Mus musculus)	6480464	titanium dioxide results in decreased methylation of ATG13 gene	CTD	PMID:35295148
Atg13	Rat	trichloroethene	increases expression	EXP		6480464	Trichloroethylene results in increased expression of ATG13 mRNA	CTD	PMID:33387578
Atg13	Rat	triphenyl phosphate	affects expression	ISO	ATG13 (Homo sapiens)	6480464	triphenyl phosphate affects the expression of ATG13 mRNA	CTD	PMID:37042841
Atg13	Rat	tunicamycin	increases expression	ISO	ATG13 (Homo sapiens)	6480464	Tunicamycin results in increased expression of ATG13 mRNA	CTD	PMID:22378314
Atg13	Rat	valproic acid	affects expression	ISO	Atg13 (Mus musculus)	6480464	Valproic Acid affects the expression of ATG13 mRNA	CTD	PMID:17292431

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Atg13	Rat	autophagosome assembly	acts_upstream_of_or_within	ISO	ATG13 (Homo sapiens)	1624291	PMID:19211835	RGD	PMID:19211835
Atg13	Rat	autophagosome assembly	involved_in	IEA	UniProtKB:O75143 and ensembl:ENSP00000507809	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Atg13	Rat	autophagosome assembly	involved_in	ISO	Atg13 (Mus musculus)	1624291	PMID:19225151 and PMID:19258318	RGD	PMID:19225151 and PMID:19258318
Atg13	Rat	autophagosome assembly	involved_in	IEA	UniProtKB:Q91YI1 and ensembl:ENSMUSP00000076081	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Atg13	Rat	autophagosome assembly	involved_in	IEA	InterPro:IPR040182	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Atg13	Rat	autophagosome assembly	involved_in	ISO	ATG13 (Homo sapiens)	1624291	PMID:19211835 and PMID:19225151	RGD	PMID:19211835 and PMID:19225151
Atg13	Rat	autophagy	involved_in	IEA	UniProtKB-KW:KW-0072	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Atg13	Rat	biological_process		ND		1598407	12/10: no relevant rat data	RGD
Atg13	Rat	mitophagy	involved_in	IBA	MGI:1196429 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Atg13	Rat	mitophagy	involved_in	IEA	UniProtKB:Q91YI1 and ensembl:ENSMUSP00000076081	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Atg13	Rat	mitophagy	involved_in	ISO	Atg13 (Mus musculus)	1624291	PMID:21855797	RGD	PMID:21855797
Atg13	Rat	negative regulation of cell population proliferation	involved_in	ISO	ATG13 (Homo sapiens)	1624291	PMID:21795849	RGD	PMID:21795849
Atg13	Rat	negative regulation of cell population proliferation	involved_in	IEA	UniProtKB:Q91YI1 and ensembl:ENSMUSP00000076081	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Atg13	Rat	negative regulation of cell population proliferation	involved_in	IEA	UniProtKB:O75143 and ensembl:ENSP00000507809	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Atg13	Rat	negative regulation of cell population proliferation	involved_in	ISO	Atg13 (Mus musculus)	1624291	PMID:21795849	RGD	PMID:21795849
Atg13	Rat	piecemeal microautophagy of the nucleus	involved_in	IBA	PANTHER:PTN001268151 and SGD:S000006389	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Atg13	Rat	positive regulation of autophagy	involved_in	ISO	Atg13 (Mus musculus)	1624291	PMID:19225151	RGD	PMID:19225151
Atg13	Rat	positive regulation of autophagy	involved_in	IEA	UniProtKB:Q91YI1 and ensembl:ENSMUSP00000076081	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Atg13	Rat	positive regulation of autophagy	involved_in	IEA	UniProtKB:O75143 and ensembl:ENSP00000507809	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Atg13	Rat	positive regulation of autophagy	involved_in	ISO	ATG13 (Homo sapiens)	1624291	PMID:29487085	RGD	PMID:29487085
Atg13	Rat	positive regulation of protein targeting to mitochondrion	involved_in	ISO	ATG13 (Homo sapiens)	9068941	PMID:24270810	ParkinsonsUK-UCL	PMID:24270810
Atg13	Rat	protein localization to phagophore assembly site	involved_in	IBA	PANTHER:PTN001268151 and SGD:S000006389	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Atg13	Rat	response to mitochondrial depolarisation	involved_in	ISO	Atg13 (Mus musculus)	1624291	PMID:21855797	RGD	PMID:21855797
Atg13	Rat	response to mitochondrial depolarisation	involved_in	IEA	UniProtKB:Q91YI1 and ensembl:ENSMUSP00000076081	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Atg13	Rat	Atg1/ULK1 kinase complex	part_of	ISO	ATG13 (Homo sapiens)	1624291	UniProtKB:O75385 more ...	RGD	PMID:19211835 and PMID:19597335
Atg13	Rat	Atg1/ULK1 kinase complex	part_of	IEA	UniProtKB:O75143 and ensembl:ENSP00000507809	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Atg13	Rat	Atg1/ULK1 kinase complex	part_of	IEA	UniProtKB:Q91YI1 and ensembl:ENSMUSP00000076081	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Atg13	Rat	Atg1/ULK1 kinase complex	part_of	ISO	Atg13 (Mus musculus)	1624291	UniProtKB:O70405 more ...	RGD	PMID:19211835 and PMID:19258318
Atg13	Rat	Atg1/ULK1 kinase complex	part_of	IBA	FB:FBgn0261108 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Atg13	Rat	autophagosome	is_active_in	IBA	CGD:CAL0000176796 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Atg13	Rat	cytosol	is_active_in	IBA	MGI:1196429 and PANTHER:PTN001268151	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Atg13	Rat	cytosol	located_in	IEA	UniProtKB:Q91YI1 and ensembl:ENSMUSP00000076081	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Atg13	Rat	cytosol	located_in	ISO	Atg13 (Mus musculus)	1624291	PMID:19258318	RGD	PMID:19258318
Atg13	Rat	mitochondrion	located_in	ISO	ATG13 (Homo sapiens)	1624291	PMID:21855797	RGD	PMID:21855797
Atg13	Rat	mitochondrion	located_in	IEA	UniProtKB:O75143 and ensembl:ENSP00000507809	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Atg13	Rat	phagophore assembly site	located_in	ISO	ATG13 (Homo sapiens)	1624291	PMID:19597335	RGD	PMID:19597335
Atg13	Rat	phagophore assembly site	located_in	IEA	UniProtKB:O75143 and ensembl:ENSP00000507809	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Atg13	Rat	phagophore assembly site	located_in	IEA	UniProtKB-SubCell:SL-0220	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Atg13	Rat	phagophore assembly site	located_in	ISO	Atg13 (Mus musculus)	1624291	PMID:18936157 more ...	RGD	PMID:18936157 more ...
Atg13	Rat	phagophore assembly site	located_in	IEA	UniProtKB:Q91YI1 and ensembl:ENSMUSP00000076081	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Atg13	Rat	phagophore assembly site	is_active_in	IBA	MGI:1196429 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Atg13	Rat	phagophore assembly site membrane	is_active_in	ISO	ATG13 (Homo sapiens)	1624291	PMID:19597335	RGD	PMID:19597335
Atg13	Rat	phagophore assembly site membrane	is_active_in	IEA	UniProtKB:O75143 and ensembl:ENSP00000507809	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Atg13	Rat	protein binding	enables	ISO	ATG13 (Homo sapiens)	1624291	UniProtKB:O60238 more ...	RGD	PMID:19211835 more ...
Atg13	Rat	protein binding	enables	ISO	Atg13 (Mus musculus)	1624291	UniProtKB:O70405 more ...	RGD	PMID:19258318 and PMID:26030876
Atg13	Rat	protein binding	enables	ISO	ATG13 (Homo sapiens) and UniProtKB:O75143-2	1624291	UniProtKB:P37173 more ...	RGD	PMID:32296183 and PMID:32814053
Atg13	Rat	protein kinase binding	enables	ISO	ATG13 (Homo sapiens)	1624291	UniProtKB:O75385 more ...	RGD	PMID:18936157 and PMID:29487085
Atg13	Rat	protein kinase binding	enables	IEA	UniProtKB:O75143 and ensembl:ENSP00000507809	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Atg13	Rat	protein kinase regulator activity	enables	IBA	PANTHER:PTN001268151 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Atg13	Rat	protein serine/threonine kinase activator activity	enables	ISO	ATG13 (Homo sapiens)	1624291	PMID:19225151	RGD	PMID:19225151
Atg13	Rat	protein serine/threonine kinase activator activity	enables	IEA	UniProtKB:O75143 and ensembl:ENSP00000507809	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

RGD Manual Annotations

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Atg13	Rat	autophagy pathway		ISO	ATG13 (Homo sapiens)	4889529		RGD

Imported Annotations - PID (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Atg13	Rat	mTOR signaling pathway		ISO	ATG13 (Homo sapiens)	6484113		PID	PID:200096

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
5.	Comprehensive gene review and curation	RGD comprehensive gene curation
6.	Hepatic interferon regulatory factor 8 expression mediates liver ischemia/reperfusion injury in mice.	Shi G, etal., Biochem Pharmacol. 2021 Oct;192:114728. doi: 10.1016/j.bcp.2021.114728. Epub 2021 Aug 13.
7.	Mammalian autophagy: core molecular machinery and signaling regulation.	Yang Z and Klionsky DJ, Curr Opin Cell Biol. 2010 Apr;22(2):124-31. Epub 2009 Dec 23.

PMID:18936157	PMID:19211835	PMID:19258318	PMID:21855797	PMID:24270810	PMID:33867822

Atg13
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	98,102,831 - 98,136,741 (-)	NCBI		GRCr8
mRatBN7.2	3	77,647,069 - 77,681,028 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	77,645,790 - 77,681,043 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	81,122,107 - 81,156,207 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	89,721,130 - 89,755,231 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	87,572,391 - 87,606,504 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	80,580,549 - 80,614,554 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	80,581,247 - 80,601,410 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	87,279,649 - 87,313,654 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	76,056,642 - 76,090,287 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	75,953,473 - 75,986,537 (-)	NCBI
Celera	3	76,851,283 - 76,885,195 (-)	NCBI		Celera
Cytogenetic Map	3	q24	NCBI

ATG13
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	46,617,553 - 46,674,518 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	11	46,617,527 - 46,674,818 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	11	46,639,103 - 46,696,068 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	46,595,703 - 46,652,644 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	11	46,786,959 - 46,844,582 (+)	NCBI		Celera
Cytogenetic Map	11	p11.2	NCBI
HuRef	11	46,345,178 - 46,403,609 (+)	NCBI		HuRef
CHM1_1	11	46,637,238 - 46,695,980 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	11	46,773,592 - 46,830,534 (+)	NCBI		T2T-CHM13v2.0

Atg13
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	91,504,957 - 91,540,947 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	91,504,963 - 91,540,921 (-)	Ensembl		GRCm39 Ensembl
GRCm38	2	91,674,612 - 91,710,597 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	91,674,618 - 91,710,576 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	91,514,782 - 91,550,733 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	91,475,464 - 91,511,415 (-)	NCBI		MGSCv36	mm8
Celera	2	93,064,097 - 93,099,336 (-)	NCBI		Celera
Cytogenetic Map	2	E1	NCBI
cM Map	2	50.63	NCBI

Atg13
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955422	1,398,593 - 1,432,438 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955422	1,398,646 - 1,432,440 (-)	NCBI	ChiLan1.0	ChiLan1.0

ATG13
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	9	48,833,991 - 48,878,284 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	11	48,840,876 - 48,898,053 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	11	46,567,728 - 46,623,609 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	11	47,126,380 - 47,182,848 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	11	47,126,380 - 47,182,850 (+)	Ensembl	panpan1.1		panPan2

ATG13
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	18	42,834,538 - 42,886,873 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	18	42,836,755 - 42,886,855 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	18	41,563,260 - 41,615,540 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	18	43,490,641 - 43,542,934 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	18	43,482,301 - 43,542,937 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	18	42,975,663 - 43,027,961 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	18	42,531,296 - 42,583,663 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	18	43,260,591 - 43,313,187 (-)	NCBI		UU_Cfam_GSD_1.0

Atg13
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	20,311,338 - 20,361,623 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936562	2,423,001 - 2,473,232 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936562	2,424,398 - 2,473,103 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ATG13
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	15,856,860 - 15,916,109 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	15,856,859 - 15,916,122 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	17,207,885 - 17,266,756 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ATG13
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	1	18,651,872 - 18,712,395 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	1	18,652,998 - 18,712,482 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	115,936,173 - 115,995,623 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Atg13
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624767	1,924,672 - 1,953,868 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Atg13
528 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	825
Count of miRNA genes:	257
Interacting mature miRNAs:	322
Transcripts:	ENSRNOT00000022841, ENSRNOT00000023237
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300178	Hrtrt4	Heart rate QTL 4	3.74		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	43827364	90905114	Rat
61377	Edpm3	Estrogen-dependent pituitary mass QTL 3	7.05	0.038	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	53184692	89878207	Rat
2301414	Kidm37	Kidney mass QTL 37		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	70653097	121056321	Rat
1582238	Bw68	Body weight QTL 68	3.2	0.0064	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
1331795	Rf30	Renal function QTL 30	3.708		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	3	39454637	89115240	Rat
1582239	Epfw1	Epididymal fat weight QTL 1	4.5	0.0006	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	3	53184593	115665732	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
1354589	Bw31	Body weight QTL 31	3.3		body mass (VT:0001259)	body weight (CMO:0000012)	3	33703347	78196190	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	47233211	147415807	Rat
1358362	Srcrt2	Stress Responsive Cort QTL 2	2.78		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	38192233	133483320	Rat
737818	Hcar12	Hepatocarcinoma resistance QTL 12	2.6		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	3	29463235	118376539	Rat
1582218	Bw74	Body weight QTL 74	3.9	0.0021	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
1331777	Bw24	Body weight QTL 24	3.503		body mass (VT:0001259)	body weight (CMO:0000012)	3	39454637	89115240	Rat
1582221	Kidm30	Kidney mass QTL 30	3.5	0.0008	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	3	64655305	115665732	Rat
1581568	Rf53	Renal function QTL 53			urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	3	56395968	161299569	Rat
1582210	Bw71	Body weight QTL 71	3.3	0.0012	body mass (VT:0001259)	body weight (CMO:0000012)	3	64655305	115665732	Rat
1300111	Rf12	Renal function QTL 12	3.78		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	61017749	121056321	Rat
724523	Tsu1	Thymus enlargement suppressive QTL 1	3.84		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	3	50437504	115638231	Rat
1600376	Arunc5	Aerobic running capacity QTL 5		0.21	exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	3	73376539	118376539	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	59242096	157323038	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
1581503	Cm58	Cardiac mass QTL 58	2.7	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	43827364	121056321	Rat
2292613	Ept16	Estrogen-induced pituitary tumorigenesis QTL 16	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	47233430	110362260	Rat
731180	Bp152	Blood pressure QTL 152		0.03	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	53781112	91609953	Rat
738019	Anxrr10	Anxiety related response QTL 10	3.9		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	3	38517803	83517803	Rat
631200	Cm25	Cardiac mass QTL 25	4.8	0.0001	heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	3	61134348	89115068	Rat
61419	Cia11	Collagen induced arthritis QTL 11	5.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	3	30356773	98535386	Rat
12879848	Bw181	Body weght QTL 181		0.015	body mass (VT:0001259)	body weight (CMO:0000012)	3	70348525	121056321	Rat
1358905	Hrtrt17	Heart rate QTL 17	5.9	0.000014	heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	10861912	89878372	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	41874578	155617519	Rat
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
1354597	Kidm13	Kidney mass QTL 13	2.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	3	41874578	104104347	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	41874578	155617519	Rat
2290452	Scl56	Serum cholesterol level QTL 56	2.26		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	3	1	91609953	Rat
1354604	Bw36	Body weight QTL 36	2.9		body mass (VT:0001259)	body weight (CMO:0000012)	3	33703347	104104347	Rat
631665	Bw8	Body weight QTL 8	5.5		body mass (VT:0001259)	body weight (CMO:0000012)	3	50437042	119183768	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
1358186	Ept2	Estrogen-induced pituitary tumorigenesis QTL 2	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	47233430	110362260	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001271212	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CB774831	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473949	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ217242	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000022841 ⟹ ENSRNOP00000022841

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	77,646,931 - 77,681,043 (-)	Ensembl
Rnor_6.0 Ensembl	3	80,581,247 - 80,601,410 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000103658 ⟹ ENSRNOP00000077466

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	77,645,790 - 77,681,030 (-)	Ensembl

RefSeq Acc Id:

NM_001271212 ⟹ NP_001258141

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	98,102,831 - 98,136,741 (-)	NCBI
mRatBN7.2	3	77,647,069 - 77,681,028 (-)	NCBI
Rnor_6.0	3	80,580,549 - 80,614,554 (-)	NCBI
Rnor_5.0	3	87,279,649 - 87,313,654 (-)	NCBI
Celera	3	76,851,283 - 76,885,195 (-)	NCBI

Sequence:

show sequence

AAACACTAACGATGGCGGCGCCGGGCAGCGACTGGTTGCTGTCTTAGGGAGGGAGAGATCGCTTGACGCGTGAAGGGGAAGCTGTGAAGAAAACCAGTCGACACCAGTCCGACAGCTTTTTTAGTTCT
GGGATCTCAGAACCTCGTTAGCGTGAGGTATCTCTCTGCGACCTGTGCTGTCACTGCCGCCCGGGAGCGCGGAACCCTCAGCCGGGAGGTGCGGTTGGCCGGCCCCAGGCCCCGGCCTCCGGAATGAG
AGCCCGGAGTCACTCTATGTGCCGTAGCTTCACAGGTTCCAGTAGGCAATGGAAACTGATCTCAGTTCCCAGGACAGAAAGGACCTGGACAAGTTTATTAAGTTTTTTGCCCTCAAGACTGTCCAAGT
GATTGTCCAGGCTCGACTTGGAGAAAAGATTTGCACCCGTTCATCATCTTCCCCGACGGGTTCAGATTGGTTCAATTTAGCAATCAAAGATATCCCAGAAGTCACCCATGAAGCAAAGAAGGCCCTGT
CTGGGCAGCTGCCTGCTGTGGGGCGATCTATGTGTGTGGAGATCTCACTCAAGACTTCTGAGGGAGATTCCATGGAGTTGGAAATTTGGTGTCTTGAAATGAATGAAAAGTGTGACAAAGAAATCAAA
GTTTCCTACACTGTATACAACCGATTGTCACTGCTGCTGAAGTCTCTCCTTGCTATTACGAGGGTGACACCAGCCTATAGACTCTCCAGGAAGCAAGGGCATGAATATGTAATTTTGTACAGGATTTA
TTTTGGAGAAGTTCAACTGAATGGCTTAGGAGAAGGCTTCCAGACAGTTCGTGTTGGAACAGTGGGCACCCCCGTGGGTACCCTCACTCTTTCCTGTGCTTATAGAATTAACTTGGCGTTCATGTCCA
CCAGGCAATTTGAGAGGACCCCACCTATCATGGGGATTATCATTGATCACTTTGTTGACCGTCCCTATCCCAGCTCCTCTCCTATGCACCCTTGCAATTACAGAACTGCTGAGGATGCTGGAGTCGCA
TACCCATCAGTGGAAGACTCTCAGGAAGTGTGTACCACATCTTTTTCCACATCCCCTCCCTCCCAGCTGATGGTTCCTGGGAAGGAAGGTGGGGTGCCTCTTGCTCCCAACCACCCTGCTCATGGTGC
CCAGGCTGATCAGGAGAGACTGGTGGTGCACATGCCTTCTGATGGAACCCACTGTGCAGCCACACCCTCCAGCAGTGAGGACACTGAGACTGTATCTAACAGCAGTGAAGGACGGGCCTCACCCCATG
ACATCCTGGAAACTATCTTTGTCCGAAAAGTGGGAGCATTTGTCAACAAACCCATCAATCAGGTGACACTGACGAGTTTGGACATACCCTTTGCCATGTTTGCTCCCAAGAATTTGGAGCTGGAGGAT
GCTGATCCTATGGTGAACCCTCCAGACTCCCCAGAGACCACGTCTCCCCTCCATGGCAGTCTGCACTCAGAGGGCTCCAGCGGGGGCAGCAGTGGCAATGCACATGATGACTTTGTCATGATTGACTT
TAAACCAGCTTTTTCTAAAGACGACATTCTTCCAATGGACTTGGGGACCTTTTACCGTGAATTTCAGAATCCCCCTCAGCTGAGCAGCCTCTCCATAGATTTTGGAGCTCAGTCTATGGCAGAAGACT
TGGACTCCTTACCAGAGAAGCTGGCTGTGCATGAGAAGAATGTCCGAGAATTTGATGCCTTCGTCGAAACCCTGCAGTAAAAGTGTCCCGAGTGTCTGCAGCATCCCCTTTCTGTGGACTCAGCAGAG
AACCTCGTCTTCCTCAGCCTCTCCCCAGCCTCCATGCTGTTTCTAGCCAGGTGAAAGACAGGGTGGTTCCCCTATGGGACTTAGAAGTCTCTGCTCTTGGACTTCCTGGACTCATAGCAGCAGTCAGG
CCCAATGGCAGGCTTGGGGGGAGCTGGCTGTGACAGCCTCAGCAAGGACTGTCCGCAGCACTTCACCAAGGGCGTCGTCTGCTCTTCCCTGCTGCCAGCCTCCTGCCTGGGTCTACCCGAGGCCAGCC
CTACCTGCCTGTCCTTACCATCAATCACCTGACATTCCAGCTGGTGGCTGGGACACTGGGCAAAGCAAAAAGAGGAAGAAAACCAAGGAGACCAAGCAAGTCGAAGGAGGGCCCTGTGCACCAGTAGC
TCCTGGACCACCCCACTCTCCCTCCCTCCTTTCTCCCCTTCCTTCCCTCTATCTTTACTCACTCCCTTTTCCCCACCTTCTTTCTTCTCTTCATCTCCCCCCCACCCTTCCATTCCTTGCCTTCCTGG
GTCTGTGATTTTGATGATATGAAAGGCCTATCTGCCTAAAATGACACCTATTCCAAAGCTAGCCATCATCTCCCAAAGGCTGTACCAGCCTGTTTCTAGAATTTGTTATTGAGAGTCACAGAAAGGTT
TTTTGTTTTT

hide sequence


Protein RefSeqs	NP_001258141	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL79542	(Get FASTA)	NCBI Sequence Viewer
	EDL79543	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000022841
	ENSRNOP00000022841.7
	ENSRNOP00000077466.1

RefSeq Acc Id:

NP_001258141 ⟸ NM_001271212

- UniProtKB:

A6HNE1 (UniProtKB/TrEMBL), D3ZA45 (UniProtKB/TrEMBL)

- Sequence:

show sequence

METDLSSQDRKDLDKFIKFFALKTVQVIVQARLGEKICTRSSSSPTGSDWFNLAIKDIPEVTHEAKKALSGQLPAVGRSMCVEISLKTSEGDSMELEIWCLEMNEKCDKEIKVSYTVYNRLSLLLKSL
LAITRVTPAYRLSRKQGHEYVILYRIYFGEVQLNGLGEGFQTVRVGTVGTPVGTLTLSCAYRINLAFMSTRQFERTPPIMGIIIDHFVDRPYPSSSPMHPCNYRTAEDAGVAYPSVEDSQEVCTTSFS
TSPPSQLMVPGKEGGVPLAPNHPAHGAQADQERLVVHMPSDGTHCAATPSSSEDTETVSNSSEGRASPHDILETIFVRKVGAFVNKPINQVTLTSLDIPFAMFAPKNLELEDADPMVNPPDSPETTSP
LHGSLHSEGSSGGSSGNAHDDFVMIDFKPAFSKDDILPMDLGTFYREFQNPPQLSSLSIDFGAQSMAEDLDSLPEKLAVHEKNVREFDAFVETLQ

hide sequence

Ensembl Acc Id:

ENSRNOP00000022841 ⟸ ENSRNOT00000022841

Ensembl Acc Id:

ENSRNOP00000077466 ⟸ ENSRNOT00000103658

Protein Domains

Autophagy-related protein 13 N-terminal

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZA45-F1-model_v2	AlphaFold	D3ZA45	1-478	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-48721	BioCyc
Ensembl Genes	ENSRNOG00000016984	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000022841	ENTREZGENE
	ENSRNOT00000022841.8	UniProtKB/TrEMBL
	ENSRNOT00000103658.1	UniProtKB/TrEMBL
Gene3D-CATH	3.30.900.10	UniProtKB/TrEMBL
InterPro	ATG13	UniProtKB/TrEMBL
	Atg13_N	UniProtKB/TrEMBL
	HORMA_dom_sf	UniProtKB/TrEMBL
KEGG Report	rno:362164	UniProtKB/TrEMBL
NCBI Gene	362164	ENTREZGENE
PANTHER	AUTOPHAGY-RELATED PROTEIN 13	UniProtKB/TrEMBL
	PTHR13430	UniProtKB/TrEMBL
Pfam	ATG13	UniProtKB/TrEMBL
PhenoGen	Atg13	PhenoGen
RatGTEx	ENSRNOG00000016984	RatGTEx
UniProt	A0A8I5Y5V4_RAT	UniProtKB/TrEMBL
	A6HNE1	ENTREZGENE, UniProtKB/TrEMBL
	D3ZA45	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2012-06-07	Atg13	autophagy related 13	Atg13	ATG13 autophagy related 13 homolog (S. cerevisiae)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-07-03	Harbi1l	harbinger transposase derived 1-like	Harbi1	harbinger transposase derived 1	Symbol and Name updated	1299863	APPROVED
2008-05-02	Harbi1	harbinger transposase derived 1	RGD1310685	similar to hypothetical protein D2Ertd391e	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	RGD1310685	similar to hypothetical protein D2Ertd391e	RGD1310685_predicted	similar to hypothetical protein D2Ertd391e (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-20	RGD1310685_predicted	similar to hypothetical protein D2Ertd391e (predicted)	LOC362164_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC362164_predicted	similar to hypothetical protein D2Ertd391e (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Imported Annotations - PID (archival)