Symbol:
Snx18
Name:
sorting nexin 18
RGD ID:
1310367
Description:
Predicted to enable phosphatidylinositol-4,5-bisphosphate binding activity. Predicted to be involved in several processes, including cytoskeleton-dependent cytokinesis; plasma membrane tubulation; and positive regulation of autophagosome assembly. Predicted to be located in several cellular components, including cytoplasmic side of plasma membrane; extracellular exosome; and growth cone. Predicted to be active in plasma membrane and recycling endosome membrane. Orthologous to human SNX18 (sorting nexin 18); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; amphetamine; bisphenol A.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC310097; Snag1; sorting nexin associated golgi protein 1; sorting nexin-18
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
SNX18 (sorting nexin 18) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):
Snx18 (sorting nexin 18) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Snx18 (sorting nexin 18) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
SNX18 (sorting nexin 18) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
SNX18 (sorting nexin 18) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Snx18 (sorting nexin 18) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
SNX18 (sorting nexin 18) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
SNX18 (sorting nexin 18) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Snx18 (sorting nexin 18) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
FEZF2 (FEZ family zinc finger 2) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
SNX18 (sorting nexin 18)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Snx18 (sorting nexin 18)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
snx18a (sorting nexin 18a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
snx18b (sorting nexin 18b)
Alliance
DIOPT (OrthoFinder|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
lst-4
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
SH3PX1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
snx18
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 46,965,498 - 46,991,516 (-) NCBI GRCr8 mRatBN7.2 2 45,232,325 - 45,258,345 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 45,232,325 - 45,258,345 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 52,343,993 - 52,369,979 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 50,402,361 - 50,428,348 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 45,274,943 - 45,301,291 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 45,454,782 - 45,480,798 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 45,454,782 - 45,480,798 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 64,486,855 - 64,512,619 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 45,014,383 - 45,040,586 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 44,943,876 - 45,006,230 (-) NCBI Celera 2 41,000,711 - 41,026,746 (-) NCBI Celera Cytogenetic Map 2 q14 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Snx18 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO SNX18 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Snx18 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Snx18 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of SNX18 mRNA CTD PMID:19933214 Snx18 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of SNX18 mRNA CTD PMID:33387578 Snx18 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of SNX18 mRNA CTD PMID:34747641 Snx18 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Snx18 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of SNX18 mRNA CTD PMID:21570461 Snx18 Rat 2,4,6-tribromophenol decreases expression ISO SNX18 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Snx18 Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO SNX18 (Homo sapiens) 6480464 tetrabromobisphenol A results in decreased expression of SNX18 protein CTD PMID:31675489 Snx18 Rat acrolein multiple interactions ISO SNX18 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of SNX18 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased expression of SNX18 mRNA CTD PMID:32699268 Snx18 Rat aflatoxin B1 decreases methylation ISO SNX18 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of SNX18 gene CTD PMID:27153756 Snx18 Rat alpha-pinene multiple interactions ISO SNX18 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of SNX18 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased expression of SNX18 mRNA CTD PMID:32699268 Snx18 Rat amiodarone increases expression ISO SNX18 (Homo sapiens) 6480464 Amiodarone results in increased expression of SNX18 mRNA CTD PMID:19774075 Snx18 Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of SNX18 mRNA CTD PMID:30779732 Snx18 Rat benzo[a]pyrene increases expression ISO Snx18 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of SNX18 mRNA CTD PMID:22228805 Snx18 Rat benzo[a]pyrene affects methylation ISO SNX18 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of SNX18 exon and Benzo(a)pyrene affects the methylation of SNX18 promoter CTD PMID:27901495 Snx18 Rat bis(2-ethylhexyl) phthalate affects expression ISO Snx18 (Mus musculus) 6480464 Diethylhexyl Phthalate affects the expression of SNX18 mRNA and Diethylhexyl Phthalate affects the expression of SNX18 protein CTD PMID:37734331 Snx18 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of SNX18 mRNA CTD PMID:25181051 more ... Snx18 Rat bisphenol A decreases expression ISO SNX18 (Homo sapiens) 6480464 bisphenol A results in decreased expression of SNX18 protein CTD PMID:31675489 Snx18 Rat bisphenol A decreases methylation ISO Snx18 (Mus musculus) 6480464 bisphenol A results in decreased methylation of SNX18 promoter CTD PMID:27312807 Snx18 Rat bisphenol AF increases expression ISO SNX18 (Homo sapiens) 6480464 bisphenol AF results in increased expression of SNX18 protein CTD PMID:34186270 Snx18 Rat cadmium dichloride decreases expression ISO SNX18 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of SNX18 mRNA CTD PMID:38568856 Snx18 Rat calcitriol increases expression ISO SNX18 (Homo sapiens) 6480464 Calcitriol results in increased expression of SNX18 mRNA CTD PMID:16002434 Snx18 Rat chlorpyrifos increases expression ISO Snx18 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of SNX18 mRNA CTD PMID:37019170 Snx18 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of SNX18 mRNA CTD PMID:27523638 Snx18 Rat decabromodiphenyl ether decreases expression ISO SNX18 (Homo sapiens) 6480464 decabromobiphenyl ether results in decreased expression of SNX18 protein CTD PMID:31675489 Snx18 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of SNX18 mRNA CTD PMID:21266533 Snx18 Rat dorsomorphin multiple interactions ISO SNX18 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Snx18 Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of SNX18 mRNA CTD PMID:30307764 Snx18 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of SNX18 mRNA CTD PMID:24136188 Snx18 Rat FR900359 decreases phosphorylation ISO SNX18 (Homo sapiens) 6480464 FR900359 results in decreased phosphorylation of SNX18 protein CTD PMID:37730182 Snx18 Rat inulin multiple interactions ISO Snx18 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of SNX18 mRNA CTD PMID:36331819 Snx18 Rat irinotecan decreases expression ISO SNX18 (Homo sapiens) 6480464 Irinotecan metabolite results in decreased expression of SNX18 mRNA and Irinotecan results in decreased expression of SNX18 mRNA CTD PMID:15956246 Snx18 Rat ketoconazole increases expression ISO SNX18 (Homo sapiens) 6480464 Ketoconazole results in increased expression of SNX18 mRNA CTD PMID:36621641 Snx18 Rat lipopolysaccharide decreases expression ISO SNX18 (Homo sapiens) 6480464 Lipopolysaccharides results in decreased expression of SNX18 mRNA CTD PMID:35811015 Snx18 Rat lipopolysaccharide multiple interactions ISO SNX18 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of SNX18 mRNA CTD PMID:35811015 Snx18 Rat methotrexate increases expression ISO SNX18 (Homo sapiens) 6480464 Methotrexate results in increased expression of SNX18 mRNA CTD PMID:24449571 Snx18 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of SNX18 gene CTD PMID:35440735 Snx18 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of SNX18 mRNA CTD PMID:25729387 Snx18 Rat ozone multiple interactions ISO SNX18 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of SNX18 mRNA more ... CTD PMID:32699268 Snx18 Rat ozone multiple interactions ISO Snx18 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of Ozone] which results in increased expression of SNX18 mRNA CTD PMID:34911549 Snx18 Rat paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of SNX18 mRNA CTD PMID:17984051 Snx18 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of SNX18 mRNA CTD PMID:33387578 Snx18 Rat paracetamol decreases expression ISO SNX18 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of SNX18 mRNA CTD PMID:22230336 Snx18 Rat paracetamol affects expression ISO Snx18 (Mus musculus) 6480464 Acetaminophen affects the expression of SNX18 mRNA CTD PMID:17562736 Snx18 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Snx18 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of SNX18 mRNA CTD PMID:36331819 Snx18 Rat phenobarbital affects expression ISO Snx18 (Mus musculus) 6480464 Phenobarbital affects the expression of SNX18 mRNA CTD PMID:23091169 Snx18 Rat phenylmercury acetate increases expression ISO SNX18 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of SNX18 mRNA CTD PMID:26272509 Snx18 Rat phenylmercury acetate multiple interactions ISO SNX18 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SNX18 mRNA CTD PMID:27188386 Snx18 Rat resveratrol increases expression ISO SNX18 (Homo sapiens) 6480464 resveratrol results in increased expression of SNX18 mRNA CTD PMID:25888808 Snx18 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO SNX18 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of SNX18 mRNA CTD PMID:35811015 Snx18 Rat SB 431542 multiple interactions ISO SNX18 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Snx18 Rat sodium arsenite decreases expression ISO SNX18 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of SNX18 protein CTD PMID:30528433 Snx18 Rat Soman increases expression EXP 6480464 Soman results in increased expression of SNX18 mRNA CTD PMID:19281266 Snx18 Rat tetrachloromethane affects expression ISO Snx18 (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of SNX18 mRNA CTD PMID:17484886 Snx18 Rat tetrachloromethane increases expression ISO Snx18 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of SNX18 mRNA CTD PMID:31919559 Snx18 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of SNX18 mRNA CTD PMID:34492290 Snx18 Rat titanium dioxide decreases methylation ISO Snx18 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of SNX18 gene CTD PMID:35295148 Snx18 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of SNX18 mRNA CTD PMID:25729387 Snx18 Rat topotecan increases expression EXP 6480464 Topotecan results in increased expression of SNX18 mRNA CTD PMID:25729387 Snx18 Rat trichostatin A increases expression ISO SNX18 (Homo sapiens) 6480464 trichostatin A results in increased expression of SNX18 mRNA CTD PMID:26272509 Snx18 Rat trichostatin A multiple interactions ISO SNX18 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SNX18 mRNA CTD PMID:27188386 Snx18 Rat tungsten decreases expression ISO Snx18 (Mus musculus) 6480464 Tungsten results in decreased expression of SNX18 mRNA CTD PMID:30912803 Snx18 Rat valproic acid affects expression ISO Snx18 (Mus musculus) 6480464 Valproic Acid affects the expression of SNX18 mRNA CTD PMID:17963808 Snx18 Rat valproic acid increases methylation ISO SNX18 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of SNX18 gene CTD PMID:29154799 Snx18 Rat valproic acid increases expression ISO SNX18 (Homo sapiens) 6480464 Valproic Acid results in increased expression of SNX18 mRNA CTD PMID:23179753 more ... Snx18 Rat valproic acid multiple interactions ISO SNX18 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SNX18 mRNA CTD PMID:27188386
2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-tribromophenol (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) acrolein (ISO) aflatoxin B1 (ISO) alpha-pinene (ISO) amiodarone (ISO) amphetamine (EXP) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) cadmium dichloride (ISO) calcitriol (ISO) chlorpyrifos (ISO) Cuprizon (EXP) decabromodiphenyl ether (ISO) dibutyl phthalate (EXP) dorsomorphin (ISO) fenvalerate (EXP) flutamide (EXP) FR900359 (ISO) inulin (ISO) irinotecan (ISO) ketoconazole (ISO) lipopolysaccharide (ISO) methotrexate (ISO) methoxychlor (EXP) oxaliplatin (EXP) ozone (ISO) paracetamol (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) phenylmercury acetate (ISO) resveratrol (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) sodium arsenite (ISO) Soman (EXP) tetrachloromethane (ISO) thioacetamide (EXP) titanium dioxide (ISO) topotecan (EXP) trichostatin A (ISO) tungsten (ISO) valproic acid (ISO)
Snx18 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 46,965,498 - 46,991,516 (-) NCBI GRCr8 mRatBN7.2 2 45,232,325 - 45,258,345 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 45,232,325 - 45,258,345 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 52,343,993 - 52,369,979 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 50,402,361 - 50,428,348 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 45,274,943 - 45,301,291 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 45,454,782 - 45,480,798 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 45,454,782 - 45,480,798 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 64,486,855 - 64,512,619 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 45,014,383 - 45,040,586 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 44,943,876 - 45,006,230 (-) NCBI Celera 2 41,000,711 - 41,026,746 (-) NCBI Celera Cytogenetic Map 2 q14 NCBI
SNX18 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 5 54,517,759 - 54,648,005 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 5 54,517,759 - 54,546,586 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 5 53,813,589 - 53,842,416 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 5 53,849,350 - 53,878,173 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 5 53,849,539 - 53,851,426 NCBI Celera 5 50,767,064 - 50,795,890 (+) NCBI Celera Cytogenetic Map 5 q11.2 NCBI HuRef 5 50,787,437 - 50,816,259 (+) NCBI HuRef CHM1_1 5 53,816,580 - 53,845,409 (+) NCBI CHM1_1 T2T-CHM13v2.0 5 55,345,475 - 55,475,784 (+) NCBI T2T-CHM13v2.0
Snx18 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 13 113,728,715 - 113,755,100 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 13 113,728,715 - 113,755,100 (-) Ensembl GRCm39 Ensembl GRCm38 13 113,592,179 - 113,618,564 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 13 113,592,179 - 113,618,564 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 13 114,382,387 - 114,408,772 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 13 114,713,061 - 114,739,419 (-) NCBI MGSCv36 mm8 Celera 13 117,901,784 - 117,928,168 (-) NCBI Celera Cytogenetic Map 13 D2.2 NCBI cM Map 13 64.0 NCBI
Snx18 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955446 13,043,821 - 13,067,933 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955446 13,043,821 - 13,067,933 (-) NCBI ChiLan1.0 ChiLan1.0
SNX18 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 4 59,181,347 - 59,419,695 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 5 57,334,972 - 57,573,292 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 5 59,270,053 - 59,508,359 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 5 61,101,061 - 61,129,397 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 5 61,101,056 - 61,129,397 (-) Ensembl panpan1.1 panPan2
SNX18 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 4 60,803,245 - 60,945,317 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 4 60,835,783 - 60,945,828 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 4 60,569,927 - 60,710,959 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 4 61,295,275 - 61,436,640 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 4 61,302,014 - 61,436,904 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 4 61,185,900 - 61,215,498 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 4 61,201,579 - 61,342,650 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 4 61,720,198 - 61,861,418 (-) NCBI UU_Cfam_GSD_1.0
Snx18
SNX18 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 16 33,776,746 - 33,847,624 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 16 33,776,964 - 33,801,391 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 16 35,846,933 - 35,859,015 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SNX18 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 4 50,782,842 - 50,810,220 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 4 50,782,929 - 50,811,253 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666082 261,616 - 288,960 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Snx18
.
Predicted Target Of
Count of predictions: 729 Count of miRNA genes: 299 Interacting mature miRNAs: 403 Transcripts: ENSRNOT00000066764 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
10755430 Coatc6 Coat color QTL 6 0.02576 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 2 11591100 56591100 Rat 2293671 Bss44 Bone structure and strength QTL 44 10.97 0.0001 lumbar vertebra morphology trait (VT:0010494) lumbar vertebra cortical cross-sectional area (CMO:0001690) 2 43162366 148478373 Rat 7387318 Stl32 Serum triglyceride level QTL 32 3.2 0.0003 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 2 22384627 67384627 Rat 10755436 Coatc8 Coat color QTL 8 0.02431 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 2 35023117 80023117 Rat 1298074 Bp164 Blood pressure QTL 164 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 10755434 Coatc7 Coat color QTL 7 0.04794 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 2 30648065 75648065 Rat 2293676 Bmd19 Bone mineral density QTL 19 10.7 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 2 43162366 111362592 Rat 10755499 Bp389 Blood pressure QTL 389 2.61 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 18960362 228801039 Rat 2293682 Bmd24 Bone mineral density QTL 24 8.9 0.0001 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 2 43162366 111362592 Rat 1358917 Cm42 Cardiac mass QTL 42 2.82 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 1300160 Hrtrt3 Heart rate QTL 3 3.62 heart pumping trait (VT:2000009) absolute change in heart rate (CMO:0000534) 2 29971593 51729300 Rat 731167 Glom4 Glomerulus QTL 4 2.4 0.0082 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 2 20304672 65304672 Rat 1358913 Cm41 Cardiac mass QTL 41 2.73 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 152025242 Bw191 Body weight QTL 191 3.62 body mass (VT:0001259) 2 38573329 122609194 Rat 738012 Anxrr3 Anxiety related response QTL 3 3.8 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 2 9023519 54023519 Rat 1302794 Stl27 Serum triglyceride level QTL 27 4.4 0.0001 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 2 25413423 143657569 Rat 9685065 Swd6 Spike wave discharge measurement QTL 6 5.8 0.01 brain electrophysiology trait (VT:0010557) brain spike-and-wave discharge rate (CMO:0001739) 2 39223937 48793699 Rat 61467 Bp14 Blood pressure QTL 14 2.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 43154682 202446871 Rat 10402051 Gdil2 Gastrointestinal dilation QTL 2 enteric ganglion morphology trait (VT:0001045) length of intestine affected by colonic aganglionosis to total length of colon ratio (CMO:0001836) 2 24903853 74786777 Rat 9590095 Sffal3 Serum free fatty acids level QTL 3 6.78 0.001 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 2 27157160 72157160 Rat 70174 BpQTLCluster2 Blood pressure QTL cluster 2 4.24 arterial blood pressure trait (VT:2000000) absolute change in mean arterial blood pressure (CMO:0000533) 2 40067944 102785628 Rat 1358901 Cm38 Cardiac mass QTL 38 2 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 157142209 Rat 631208 Bw1 Body weight QTL1 5.09 mesenteric fat pad mass (VT:0010427) mesenteric fat pad weight to body weight ratio (CMO:0000654) 2 43171017 83575226 Rat 1358899 Kidm23 Kidney mass QTL 23 3.88 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1643006 Pain1 Pain QTL 1 3.63 0.005 mechanical nociception trait (VT:0002734) self mutilation severity score (CMO:0002145) 2 26999571 48268661 Rat 1358908 Bw49 Body weight QTL 49 3.36 body mass (VT:0001259) body weight (CMO:0000012) 2 25413652 157142078 Rat 1300155 Bp174 Blood pressure QTL 174 4.09 arterial blood pressure trait (VT:2000000) absolute change in mean arterial blood pressure (CMO:0000533) 2 42804607 60653831 Rat 2293835 Kiddil5 Kidney dilation QTL 5 3.8 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 2 42804607 157142209 Rat 1358910 Kidm27 Kidney mass QTL 27 5.77 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 61355 Bp36 Blood pressure QTL 36 2.9 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 2 5873687 102844969 Rat 2300168 Bmd47 Bone mineral density QTL 47 6.6 0.0001 femur mineral mass (VT:0010011) bone mineral density (CMO:0001226) 2 20662448 65662448 Rat 1358911 Kidm28 Kidney mass QTL 28 5.42 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1358904 Cm39 Cardiac mass QTL 39 2.26 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 157142209 Rat 1354617 Bp240 Blood pressure QTL 240 4 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 26917817 81754745 Rat 1578664 Bmd9 Bone mineral QTL density 9 5 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 2 11852062 49003364 Rat 2293843 Kiddil6 Kidney dilation QTL 6 3.1 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 2 42804607 182042367 Rat 1357990 Ael1 Aortic elastin QTL 1 3.1 0.00091 aorta elastin amount (VT:0003905) aortic elastin 2 19076825 64076825 Rat 1358887 Bw50 Body weight QTL 50 2.39 body mass (VT:0001259) body weight (CMO:0000012) 2 25413652 157142078 Rat 12879863 Bp402 Blood pressure QTL 402 0.003 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 41125789 56532139 Rat 1298085 Bp165 Blood pressure QTL 165 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 2290453 Scl55 Serum cholesterol level QTL 55 2.83 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 2 26917817 136917119 Rat 152025206 Hrtrt23 Heart rate QTL 23 5.98 heart pumping trait (VT:2000009) 2 28484589 169504100 Rat 1358894 Kidm24 Kidney mass QTL 24 4.03 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 731184 Mamtr4 Mammary tumor resistance QTL 4 0.0003 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 2 16491740 61491740 Rat 152025204 Hrtrt22 Heart rate QTL 22 5.6 heart pumping trait (VT:2000009) 2 28484589 169504100 Rat 61371 Edpm1 Estrogen-dependent pituitary mass QTL 1 4 0.05 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 2 35134841 88029593 Rat 1354601 Slep1 Serum leptin concentration QTL 1 5.39 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 2 43171017 184114403 Rat 1354603 Bp243 Blood pressure QTL 243 3.9 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 26917817 127469484 Rat
RH130385
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 45,231,878 - 45,232,081 (+) MAPPER mRatBN7.2 Rnor_6.0 2 45,454,336 - 45,454,538 NCBI Rnor6.0 Rnor_5.0 2 64,486,409 - 64,486,611 UniSTS Rnor5.0 RGSC_v3.4 2 45,013,937 - 45,014,139 UniSTS RGSC3.4 Celera 2 41,000,265 - 41,000,467 UniSTS RH 3.4 Map 2 282.0 UniSTS Cytogenetic Map 2 q14 UniSTS
RH135330
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 45,238,595 - 45,238,790 (+) MAPPER mRatBN7.2 Rnor_6.0 2 45,461,053 - 45,461,247 NCBI Rnor6.0 Rnor_5.0 2 64,493,126 - 64,493,320 UniSTS Rnor5.0 RGSC_v3.4 2 45,020,654 - 45,020,848 UniSTS RGSC3.4 Celera 2 41,006,982 - 41,007,176 UniSTS RH 3.4 Map 2 282.8 UniSTS Cytogenetic Map 2 q14 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000066764 ⟹ ENSRNOP00000063122
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 45,232,325 - 45,258,345 (-) Ensembl Rnor_6.0 Ensembl 2 45,454,782 - 45,480,798 (-) Ensembl
RefSeq Acc Id:
NM_001107652 ⟹ NP_001101122
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 46,965,498 - 46,991,516 (-) NCBI mRatBN7.2 2 45,232,325 - 45,258,345 (-) NCBI Rnor_6.0 2 45,454,782 - 45,480,798 (-) NCBI Rnor_5.0 2 64,486,855 - 64,512,619 (-) NCBI RGSC_v3.4 2 45,014,383 - 45,040,586 (-) RGD Celera 2 41,000,711 - 41,026,746 (-) RGD
Sequence:
TGCAGTCGCTGCGGTGAGCAGAGCGGATCTGCACGGAGGCTACGAGCGGAACGGGGAGCAGACCGTGCGTTGCCCTCAAGGCTCGCTCCCTTCGGCGCTCAGGGGCGCGGGTACTGACCGCGGGGCCC
hide sequence
RefSeq Acc Id:
NP_001101122 ⟸ NM_001107652
- UniProtKB:
D3ZZ38 (UniProtKB/TrEMBL), A6I5R6 (UniProtKB/TrEMBL)
- Sequence:
MALRARALYDFRSENPGEISLREHEVLSLCSEQDIEGWLEGINSRGDRGLFPASYVQVIRAPEPGPPADGGPGAPARYANVPPGGFEPLPAAPPAAFQPLLQPQASPGSFQSPGAGFTYGGGAPQPSP
hide sequence
Ensembl Acc Id:
ENSRNOP00000063122 ⟸ ENSRNOT00000066764
RGD ID: 13691144 Promoter ID: EPDNEW_R1669 Type: multiple initiation site Name: Snx18_1 Description: sorting nexin 18 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 2 45,480,795 - 45,480,855 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-03-19
Snx18
sorting nexin 18
Snag1_predicted
sorting nexin associated golgi protein 1 (predicted)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-12
Snag1_predicted
sorting nexin associated golgi protein 1 (predicted)
Symbol and Name status set to approved
70820 APPROVED
