Symbol:
Snx18
Name:
sorting nexin 18
RGD ID:
1321232
MGI Page
MGI
Description:
Enables phosphatidylinositol binding activity. Predicted to be involved in several processes, including cytoskeleton-dependent cytokinesis; plasma membrane tubulation; and positive regulation of autophagosome assembly. Located in growth cone and neuronal cell body. Is expressed in several structures, including alimentary system; central nervous system; genitourinary system; hemolymphoid system; and integumental system. Orthologous to human SNX18 (sorting nexin 18).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
Sn; Snag1; sorting nexin associated golgi protein 1; sorting nexin-18; sorting nexin-associated Golgi protein 1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
SNX18 (sorting nexin 18) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Rattus norvegicus (Norway rat):
Snx18 (sorting nexin 18) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Snx18 (sorting nexin 18) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
SNX18 (sorting nexin 18) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
SNX18 (sorting nexin 18) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Snx18 (sorting nexin 18) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
SNX18 (sorting nexin 18) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
SNX18 (sorting nexin 18) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Snx18 (sorting nexin 18) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Snx18 (sorting nexin 18)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
SNX18 (sorting nexin 18)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
snx18a (sorting nexin 18a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
snx18b (sorting nexin 18b)
Alliance
DIOPT (InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Caenorhabditis elegans (roundworm):
lst-4
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
SH3PX1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
snx18
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 13 113,728,715 - 113,755,100 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 13 113,728,715 - 113,755,100 (-) Ensembl GRCm39 Ensembl GRCm38 13 113,592,179 - 113,618,564 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 13 113,592,179 - 113,618,564 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 13 114,382,387 - 114,408,772 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 13 114,713,061 - 114,739,419 (-) NCBI MGSCv36 mm8 Celera 13 117,901,784 - 117,928,168 (-) NCBI Celera Cytogenetic Map 13 D2.2 NCBI cM Map 13 64.0 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Snx18 Mouse 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO SNX18 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Snx18 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of SNX18 mRNA CTD PMID:19933214 Snx18 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Snx18 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of SNX18 mRNA CTD PMID:33387578 Snx18 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Snx18 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in increased expression of SNX18 mRNA CTD PMID:34747641 Snx18 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of SNX18 mRNA CTD PMID:21570461 Snx18 Mouse 2,4,6-tribromophenol decreases expression ISO SNX18 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Snx18 Mouse 3,3',5,5'-tetrabromobisphenol A decreases expression ISO SNX18 (Homo sapiens) 6480464 tetrabromobisphenol A results in decreased expression of SNX18 protein CTD PMID:31675489 Snx18 Mouse acrolein multiple interactions ISO SNX18 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of SNX18 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased expression of SNX18 mRNA CTD PMID:32699268 Snx18 Mouse aflatoxin B1 decreases methylation ISO SNX18 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of SNX18 gene CTD PMID:27153756 Snx18 Mouse alpha-pinene multiple interactions ISO SNX18 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of SNX18 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased expression of SNX18 mRNA CTD PMID:32699268 Snx18 Mouse amiodarone increases expression ISO SNX18 (Homo sapiens) 6480464 Amiodarone results in increased expression of SNX18 mRNA CTD PMID:19774075 Snx18 Mouse amphetamine increases expression ISO Snx18 (Rattus norvegicus) 6480464 Amphetamine results in increased expression of SNX18 mRNA CTD PMID:30779732 Snx18 Mouse benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of SNX18 mRNA CTD PMID:22228805 Snx18 Mouse benzo[a]pyrene affects methylation ISO SNX18 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of SNX18 exon and Benzo(a)pyrene affects the methylation of SNX18 promoter CTD PMID:27901495 Snx18 Mouse bis(2-ethylhexyl) phthalate affects expression EXP 6480464 Diethylhexyl Phthalate affects the expression of SNX18 mRNA and Diethylhexyl Phthalate affects the expression of SNX18 protein CTD PMID:37734331 Snx18 Mouse bisphenol A increases expression ISO Snx18 (Rattus norvegicus) 6480464 bisphenol A results in increased expression of SNX18 mRNA CTD PMID:25181051 more ... Snx18 Mouse bisphenol A decreases expression ISO SNX18 (Homo sapiens) 6480464 bisphenol A results in decreased expression of SNX18 protein CTD PMID:31675489 Snx18 Mouse bisphenol A decreases methylation EXP 6480464 bisphenol A results in decreased methylation of SNX18 promoter CTD PMID:27312807 Snx18 Mouse bisphenol AF increases expression ISO SNX18 (Homo sapiens) 6480464 bisphenol AF results in increased expression of SNX18 protein CTD PMID:34186270 Snx18 Mouse cadmium dichloride decreases expression ISO SNX18 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of SNX18 mRNA CTD PMID:38568856 Snx18 Mouse calcitriol increases expression ISO SNX18 (Homo sapiens) 6480464 Calcitriol results in increased expression of SNX18 mRNA CTD PMID:16002434 Snx18 Mouse chlorpyrifos increases expression EXP 6480464 Chlorpyrifos results in increased expression of SNX18 mRNA CTD PMID:37019170 Snx18 Mouse Cuprizon increases expression ISO Snx18 (Rattus norvegicus) 6480464 Cuprizone results in increased expression of SNX18 mRNA CTD PMID:27523638 Snx18 Mouse decabromodiphenyl ether decreases expression ISO SNX18 (Homo sapiens) 6480464 decabromobiphenyl ether results in decreased expression of SNX18 protein CTD PMID:31675489 Snx18 Mouse dibutyl phthalate increases expression ISO Snx18 (Rattus norvegicus) 6480464 Dibutyl Phthalate results in increased expression of SNX18 mRNA CTD PMID:21266533 Snx18 Mouse dorsomorphin multiple interactions ISO SNX18 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Snx18 Mouse fenvalerate increases expression ISO Snx18 (Rattus norvegicus) 6480464 fenvalerate results in increased expression of SNX18 mRNA CTD PMID:30307764 Snx18 Mouse flutamide increases expression ISO Snx18 (Rattus norvegicus) 6480464 Flutamide results in increased expression of SNX18 mRNA CTD PMID:24136188 Snx18 Mouse FR900359 decreases phosphorylation ISO SNX18 (Homo sapiens) 6480464 FR900359 results in decreased phosphorylation of SNX18 protein CTD PMID:37730182 Snx18 Mouse inulin multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of SNX18 mRNA CTD PMID:36331819 Snx18 Mouse irinotecan decreases expression ISO SNX18 (Homo sapiens) 6480464 Irinotecan metabolite results in decreased expression of SNX18 mRNA and Irinotecan results in decreased expression of SNX18 mRNA CTD PMID:15956246 Snx18 Mouse ketoconazole increases expression ISO SNX18 (Homo sapiens) 6480464 Ketoconazole results in increased expression of SNX18 mRNA CTD PMID:36621641 Snx18 Mouse lipopolysaccharide decreases expression ISO SNX18 (Homo sapiens) 6480464 Lipopolysaccharides results in decreased expression of SNX18 mRNA CTD PMID:35811015 Snx18 Mouse lipopolysaccharide multiple interactions ISO SNX18 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of SNX18 mRNA CTD PMID:35811015 Snx18 Mouse methotrexate increases expression ISO SNX18 (Homo sapiens) 6480464 Methotrexate results in increased expression of SNX18 mRNA CTD PMID:24449571 Snx18 Mouse methoxychlor affects methylation ISO Snx18 (Rattus norvegicus) 6480464 Methoxychlor affects the methylation of SNX18 gene CTD PMID:35440735 Snx18 Mouse oxaliplatin multiple interactions ISO Snx18 (Rattus norvegicus) 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of SNX18 mRNA CTD PMID:25729387 Snx18 Mouse ozone multiple interactions ISO SNX18 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of SNX18 mRNA more ... CTD PMID:32699268 Snx18 Mouse ozone multiple interactions EXP 6480464 [Air Pollutants results in increased abundance of Ozone] which results in increased expression of SNX18 mRNA CTD PMID:34911549 Snx18 Mouse paracetamol affects expression ISO Snx18 (Rattus norvegicus) 6480464 Acetaminophen affects the expression of SNX18 mRNA CTD PMID:17984051 Snx18 Mouse paracetamol increases expression ISO Snx18 (Rattus norvegicus) 6480464 Acetaminophen results in increased expression of SNX18 mRNA CTD PMID:33387578 Snx18 Mouse paracetamol decreases expression ISO SNX18 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of SNX18 mRNA CTD PMID:22230336 Snx18 Mouse paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of SNX18 mRNA CTD PMID:17562736 Snx18 Mouse perfluorooctane-1-sulfonic acid multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of SNX18 mRNA CTD PMID:36331819 Snx18 Mouse phenobarbital affects expression EXP 6480464 Phenobarbital affects the expression of SNX18 mRNA CTD PMID:23091169 Snx18 Mouse phenylmercury acetate increases expression ISO SNX18 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of SNX18 mRNA CTD PMID:26272509 Snx18 Mouse phenylmercury acetate multiple interactions ISO SNX18 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SNX18 mRNA CTD PMID:27188386 Snx18 Mouse resveratrol increases expression ISO SNX18 (Homo sapiens) 6480464 resveratrol results in increased expression of SNX18 mRNA CTD PMID:25888808 Snx18 Mouse S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO SNX18 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of SNX18 mRNA CTD PMID:35811015 Snx18 Mouse SB 431542 multiple interactions ISO SNX18 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Snx18 Mouse sodium arsenite decreases expression ISO SNX18 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of SNX18 protein CTD PMID:30528433 Snx18 Mouse Soman increases expression ISO Snx18 (Rattus norvegicus) 6480464 Soman results in increased expression of SNX18 mRNA CTD PMID:19281266 Snx18 Mouse tetrachloromethane affects expression EXP 6480464 Carbon Tetrachloride affects the expression of SNX18 mRNA CTD PMID:17484886 Snx18 Mouse tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of SNX18 mRNA CTD PMID:31919559 Snx18 Mouse thioacetamide increases expression ISO Snx18 (Rattus norvegicus) 6480464 Thioacetamide results in increased expression of SNX18 mRNA CTD PMID:34492290 Snx18 Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of SNX18 gene CTD PMID:35295148 Snx18 Mouse topotecan multiple interactions ISO Snx18 (Rattus norvegicus) 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of SNX18 mRNA CTD PMID:25729387 Snx18 Mouse topotecan increases expression ISO Snx18 (Rattus norvegicus) 6480464 Topotecan results in increased expression of SNX18 mRNA CTD PMID:25729387 Snx18 Mouse trichostatin A increases expression ISO SNX18 (Homo sapiens) 6480464 trichostatin A results in increased expression of SNX18 mRNA CTD PMID:26272509 Snx18 Mouse trichostatin A multiple interactions ISO SNX18 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SNX18 mRNA CTD PMID:27188386 Snx18 Mouse tungsten decreases expression EXP 6480464 Tungsten results in decreased expression of SNX18 mRNA CTD PMID:30912803 Snx18 Mouse valproic acid increases methylation ISO SNX18 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of SNX18 gene CTD PMID:29154799 Snx18 Mouse valproic acid affects expression EXP 6480464 Valproic Acid affects the expression of SNX18 mRNA CTD PMID:17963808 Snx18 Mouse valproic acid increases expression ISO SNX18 (Homo sapiens) 6480464 Valproic Acid results in increased expression of SNX18 mRNA CTD PMID:23179753 more ... Snx18 Mouse valproic acid multiple interactions ISO SNX18 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SNX18 mRNA CTD PMID:27188386
2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-tribromophenol (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) acrolein (ISO) aflatoxin B1 (ISO) alpha-pinene (ISO) amiodarone (ISO) amphetamine (ISO) benzo[a]pyrene (EXP,ISO) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (EXP,ISO) bisphenol AF (ISO) cadmium dichloride (ISO) calcitriol (ISO) chlorpyrifos (EXP) Cuprizon (ISO) decabromodiphenyl ether (ISO) dibutyl phthalate (ISO) dorsomorphin (ISO) fenvalerate (ISO) flutamide (ISO) FR900359 (ISO) inulin (EXP) irinotecan (ISO) ketoconazole (ISO) lipopolysaccharide (ISO) methotrexate (ISO) methoxychlor (ISO) oxaliplatin (ISO) ozone (EXP,ISO) paracetamol (EXP,ISO) perfluorooctane-1-sulfonic acid (EXP) phenobarbital (EXP) phenylmercury acetate (ISO) resveratrol (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) sodium arsenite (ISO) Soman (ISO) tetrachloromethane (EXP) thioacetamide (ISO) titanium dioxide (EXP) topotecan (ISO) trichostatin A (ISO) tungsten (EXP) valproic acid (EXP,ISO)
Snx18 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 13 113,728,715 - 113,755,100 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 13 113,728,715 - 113,755,100 (-) Ensembl GRCm39 Ensembl GRCm38 13 113,592,179 - 113,618,564 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 13 113,592,179 - 113,618,564 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 13 114,382,387 - 114,408,772 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 13 114,713,061 - 114,739,419 (-) NCBI MGSCv36 mm8 Celera 13 117,901,784 - 117,928,168 (-) NCBI Celera Cytogenetic Map 13 D2.2 NCBI cM Map 13 64.0 NCBI
SNX18 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 5 54,517,759 - 54,648,005 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 5 54,517,759 - 54,546,586 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 5 53,813,589 - 53,842,416 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 5 53,849,350 - 53,878,173 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 5 53,849,539 - 53,851,426 NCBI Celera 5 50,767,064 - 50,795,890 (+) NCBI Celera Cytogenetic Map 5 q11.2 NCBI HuRef 5 50,787,437 - 50,816,259 (+) NCBI HuRef CHM1_1 5 53,816,580 - 53,845,409 (+) NCBI CHM1_1 T2T-CHM13v2.0 5 55,345,475 - 55,475,784 (+) NCBI T2T-CHM13v2.0
Snx18 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 46,965,498 - 46,991,516 (-) NCBI GRCr8 mRatBN7.2 2 45,232,325 - 45,258,345 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 45,232,325 - 45,258,345 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 52,343,993 - 52,369,979 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 50,402,361 - 50,428,348 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 45,274,943 - 45,301,291 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 45,454,782 - 45,480,798 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 45,454,782 - 45,480,798 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 64,486,855 - 64,512,619 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 45,014,383 - 45,040,586 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 44,943,876 - 45,006,230 (-) NCBI Celera 2 41,000,711 - 41,026,746 (-) NCBI Celera Cytogenetic Map 2 q14 NCBI
Snx18 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955446 13,043,821 - 13,067,933 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955446 13,043,821 - 13,067,933 (-) NCBI ChiLan1.0 ChiLan1.0
SNX18 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 4 59,181,347 - 59,419,695 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 5 57,334,972 - 57,573,292 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 5 59,270,053 - 59,508,359 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 5 61,101,061 - 61,129,397 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 5 61,101,056 - 61,129,397 (-) Ensembl panpan1.1 panPan2
SNX18 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 4 60,803,245 - 60,945,317 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 4 60,835,783 - 60,945,828 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 4 60,569,927 - 60,710,959 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 4 61,295,275 - 61,436,640 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 4 61,302,014 - 61,436,904 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 4 61,185,900 - 61,215,498 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 4 61,201,579 - 61,342,650 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 4 61,720,198 - 61,861,418 (-) NCBI UU_Cfam_GSD_1.0
Snx18
SNX18 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 16 33,776,746 - 33,847,624 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 16 33,776,964 - 33,801,391 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 16 35,846,933 - 35,859,015 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SNX18 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 4 50,782,842 - 50,810,220 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 4 50,782,929 - 50,811,253 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666082 261,616 - 288,960 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Snx18
.
Predicted Target Of
Count of predictions: 817 Count of miRNA genes: 446 Interacting mature miRNAs: 555 Transcripts: ENSMUST00000109241 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
4142334 Svtms_m survival time modifier of Sod2 (mouse) Not determined 13 107613580 119476372 Mouse 1558741 Ses10_m salmonella enteritidis susceptibility 10 (mouse) Not determined 13 82739968 116740106 Mouse 1301142 Heal2_m wound healing/regeneration 2 (mouse) Not determined 13 93875267 120883175 Mouse 1357468 Rplag_m reduced platelet aggregation (mouse) Not determined 13 95502130 120883175 Mouse 12879496 Fexq2_m fear expression QTL 2 (mouse) 13 100741519 120883175 Mouse 14700691 Cisaq1_m coxsackieviral infection serum ALT QTL 1 (mouse) 13 86148119 120461536 Mouse 4141704 Hipq1_m hyperinsulin production QTL 1 (mouse) Not determined 110409487 119476372 Mouse 1300939 Hrtfm6_m heart failure modifier 6 (mouse) Not determined 13 91383692 120883175 Mouse 4140995 Fbtq6_m femoral bone trait QTL 6 (mouse) Not determined 13 86341617 120341758 Mouse 1558763 Gct9_m granulosa cell tumorigenesis 9 (mouse) Not determined 13 95036824 120883175 Mouse 4142338 Skmw18_m skeletal muscle weight 18 (mouse) Not determined 13 94528399 120883175 Mouse 4141826 Tbqt5_m tibia bone quality traits 5 (mouse) Not determined 13 103341617 117043216 Mouse 4142465 Pbwg17_m postnatal body weight growth 17 (mouse) Not determined 13 83876060 117876256 Mouse 1300876 Tanidd2_m tally ho associated non-insulin dependednt diabetes mellitus 2 (mouse) Not determined 13 91965303 120883175 Mouse 14746974 Manh75_m mandible shape 75 (mouse) 13 99386647 120883175 Mouse 4142400 Tgq24_m triglyceride QTL 24 (mouse) Not determined 102602630 120883175 Mouse
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000109241 ⟹ ENSMUSP00000104864
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 13 113,728,715 - 113,755,100 (-) Ensembl GRCm38.p6 Ensembl 13 113,592,179 - 113,618,564 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000223993
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 13 113,728,721 - 113,750,177 (-) Ensembl GRCm38.p6 Ensembl 13 113,592,185 - 113,613,641 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000224883
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 13 113,731,288 - 113,750,550 (-) Ensembl GRCm38.p6 Ensembl 13 113,594,752 - 113,614,014 (-) Ensembl
RefSeq Acc Id:
NM_130796 ⟹ NP_570614
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 13 113,728,715 - 113,755,100 (-) NCBI GRCm38 13 113,592,179 - 113,618,564 (-) ENTREZGENE MGSCv37 13 114,382,387 - 114,408,772 (-) RGD Celera 13 117,901,784 - 117,928,168 (-) RGD cM Map 13 ENTREZGENE
Sequence:
CGAGTTGCAGTCGCTGCTGCGAGCCGAGCCGAGCTGCACGGAGGGCGAGAGCGGAGCGGGGAGCGGACCGGTGCGCTGCCCTCCAGGCTTCCCTTCGGCGTTCGGGGGGGGGATCCTGACTGCAGGGG
hide sequence
RefSeq Acc Id:
NP_570614 ⟸ NM_130796
- UniProtKB:
Q91ZR2 (UniProtKB/Swiss-Prot), Q8C788 (UniProtKB/TrEMBL)
- Sequence:
MALRARALYDFKSENPGEISLREHEVLSLCSEQDIEGWLEGINSRGDRGLFPASYVQVIRAPEPGPPADGGPGAPARYANVPPGGFEPLPAAPPAAFPPLLQPQASPGSFQPPGAGFPYGGGALQPSP
hide sequence
Ensembl Acc Id:
ENSMUSP00000104864 ⟸ ENSMUST00000109241
RGD ID: 8681340 Promoter ID: EPDNEW_M18701 Type: initiation region Name: Snx18_1 Description: Mus musculus sorting nexin 18 , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 13 113,618,556 - 113,618,616 EPDNEW
RGD ID: 6824432 Promoter ID: MM_KWN:15308 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day4, 3T3L1_Day6, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen Transcripts: UC007RXH.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 13 114,405,356 - 114,408,802 (-) MPROMDB
