Symbol:
Wdr33
Name:
WD repeat domain 33
RGD ID:
1309230
Description:
Predicted to be involved in mRNA 3'-end processing. Predicted to be located in fibrillar center and nucleoplasm. Orthologous to human WDR33 (WD repeat domain 33); PARTICIPATES IN 3'-end pre-mRNA processing pathway; RNA polymerase II transcription termination pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; bisphenol A.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC307524; pre-mRNA 3' end processing protein WDR33; WD repeat-containing protein 33
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
WDR33 (WD repeat domain 33) HGNC
EggNOG, Ensembl, HomoloGene, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Wdr33 (WD repeat domain 33) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Wdr33 (WD repeat domain 33) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
WDR33 (WD repeat domain 33) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
WDR33 (WD repeat domain 33) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Wdr33 (WD repeat domain 33) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
WDR33 (WD repeat domain 33) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
WDR33 (WD repeat domain 33) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Wdr33 (WD repeat domain 33) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
COL5A2 (collagen type V alpha 2 chain) HGNC
Inparanoid
Homo sapiens (human):
OR5AU1 (olfactory receptor family 5 subfamily AU member 1) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
WDR33 (WD repeat domain 33)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Wdr33 (WD repeat domain 33)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
wdr33 (WD repeat domain 33)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
PFS2
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Wdr33
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
pfs-2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
wdr33
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 18 23,706,708 - 23,812,985 (+) NCBI GRCr8 mRatBN7.2 18 23,432,233 - 23,535,460 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 18 23,432,191 - 23,468,597 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 18 23,560,579 - 23,663,560 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 18 24,309,591 - 24,412,620 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 18 23,655,547 - 23,758,526 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 18 24,584,832 - 24,689,681 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 18 24,584,900 - 24,689,636 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 18 24,302,033 - 24,403,950 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 18 24,219,464 - 24,328,893 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 18 24,246,048 - 24,356,083 (+) NCBI Celera 18 23,184,843 - 23,287,871 (+) NCBI Celera Cytogenetic Map 18 p12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Wdr33 Rat (-)-demecolcine decreases expression ISO WDR33 (Homo sapiens) 6480464 Demecolcine results in decreased expression of WDR33 mRNA CTD PMID:23649840 Wdr33 Rat (1->4)-beta-D-glucan multiple interactions ISO Wdr33 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of WDR33 mRNA CTD PMID:36331819 Wdr33 Rat 1,2-dimethylhydrazine affects expression ISO Wdr33 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine affects the expression of WDR33 mRNA CTD PMID:22206623 Wdr33 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO WDR33 (Homo sapiens) 6480464 [Tetrachlorodibenzodioxin co-treated with 2-methyl-2H-pyrazole-3-carboxylic acid (2-methyl-4-o-tolylazophenyl)amide] results in increased expression of WDR33 mRNA CTD PMID:29704546 Wdr33 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of WDR33 mRNA CTD PMID:34747641 Wdr33 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of WDR33 mRNA CTD PMID:21346803 Wdr33 Rat 2-methylcholine affects expression ISO WDR33 (Homo sapiens) 6480464 beta-methylcholine affects the expression of WDR33 mRNA CTD PMID:21179406 Wdr33 Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Wdr33 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of WDR33 mRNA CTD PMID:26251327 Wdr33 Rat 4,4'-diaminodiphenylmethane affects expression ISO Wdr33 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane affects the expression of WDR33 mRNA CTD PMID:18648102 Wdr33 Rat 4,4'-sulfonyldiphenol decreases methylation ISO WDR33 (Homo sapiens) 6480464 bisphenol S results in decreased methylation of WDR33 gene CTD PMID:31601247 Wdr33 Rat 5-aza-2'-deoxycytidine affects expression ISO WDR33 (Homo sapiens) 6480464 Decitabine affects the expression of WDR33 mRNA CTD PMID:23300844 Wdr33 Rat aflatoxin B1 increases methylation ISO WDR33 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of WDR33 gene CTD PMID:27153756 Wdr33 Rat antirheumatic drug increases expression ISO WDR33 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of WDR33 mRNA CTD PMID:24449571 Wdr33 Rat atrazine increases expression ISO WDR33 (Homo sapiens) 6480464 Atrazine results in increased expression of WDR33 mRNA CTD PMID:22378314 Wdr33 Rat benzo[a]pyrene affects methylation ISO WDR33 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of WDR33 intron and Benzo(a)pyrene affects the methylation of WDR33 promoter CTD PMID:27901495 and PMID:30157460 Wdr33 Rat bis(2-ethylhexyl) phthalate increases expression ISO Wdr33 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of WDR33 mRNA CTD PMID:34319233 Wdr33 Rat bisphenol A decreases expression ISO Wdr33 (Mus musculus) 6480464 bisphenol A results in decreased expression of WDR33 mRNA CTD PMID:26063408 Wdr33 Rat bisphenol A decreases expression ISO WDR33 (Homo sapiens) 6480464 bisphenol A results in decreased expression of WDR33 mRNA CTD PMID:29275510 Wdr33 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of WDR33 mRNA CTD PMID:25181051 and PMID:30816183 Wdr33 Rat butanal decreases expression ISO WDR33 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of WDR33 mRNA CTD PMID:26079696 Wdr33 Rat caffeine decreases phosphorylation ISO WDR33 (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of WDR33 protein CTD PMID:35688186 Wdr33 Rat chloroprene increases expression EXP 6480464 Chloroprene results in increased expression of WDR33 mRNA CTD PMID:23125180 Wdr33 Rat cisplatin affects expression ISO WDR33 (Homo sapiens) 6480464 Cisplatin affects the expression of WDR33 mRNA CTD PMID:23300844 Wdr33 Rat cobalt dichloride increases expression EXP 6480464 cobaltous chloride results in increased expression of WDR33 mRNA CTD PMID:24386269 Wdr33 Rat copper(II) sulfate decreases expression ISO WDR33 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of WDR33 mRNA CTD PMID:19549813 Wdr33 Rat crocidolite asbestos increases expression ISO Wdr33 (Mus musculus) 6480464 Asbestos and Crocidolite results in increased expression of WDR33 mRNA CTD PMID:29279043 Wdr33 Rat diuron increases expression EXP 6480464 Diuron results in increased expression of WDR33 mRNA CTD PMID:21551480 Wdr33 Rat dorsomorphin multiple interactions ISO WDR33 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of WDR33 mRNA CTD PMID:27188386 Wdr33 Rat doxorubicin decreases expression ISO WDR33 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of WDR33 mRNA CTD PMID:29803840 Wdr33 Rat doxorubicin multiple interactions ISO WDR33 (Homo sapiens) 6480464 [VRK1 protein affects the susceptibility to Doxorubicin] which affects the phosphorylation of WDR33 protein CTD PMID:38367682 Wdr33 Rat ethyl methanesulfonate increases expression ISO WDR33 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in increased expression of WDR33 mRNA CTD PMID:23649840 Wdr33 Rat folic acid decreases expression ISO Wdr33 (Mus musculus) 6480464 Folic Acid results in decreased expression of WDR33 mRNA CTD PMID:25629700 Wdr33 Rat formaldehyde decreases expression ISO WDR33 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of WDR33 mRNA CTD PMID:23649840 Wdr33 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of WDR33 mRNA CTD PMID:33387578 Wdr33 Rat hydrogen peroxide affects expression ISO WDR33 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of WDR33 mRNA CTD PMID:20044591 Wdr33 Rat hydrogen peroxide decreases expression ISO WDR33 (Homo sapiens) 6480464 Hydrogen Peroxide results in decreased expression of WDR33 mRNA CTD PMID:18951874 Wdr33 Rat ivermectin decreases expression ISO WDR33 (Homo sapiens) 6480464 Ivermectin results in decreased expression of WDR33 protein CTD PMID:32959892 Wdr33 Rat methyl methanesulfonate increases expression ISO WDR33 (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of WDR33 mRNA CTD PMID:23649840 Wdr33 Rat methylmercury chloride decreases expression ISO WDR33 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of WDR33 mRNA CTD PMID:28001369 Wdr33 Rat nickel atom decreases expression ISO WDR33 (Homo sapiens) 6480464 Nickel results in decreased expression of WDR33 mRNA CTD PMID:25583101 Wdr33 Rat nitrates multiple interactions ISO Wdr33 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of WDR33 mRNA CTD PMID:35964746 Wdr33 Rat ochratoxin A decreases expression ISO WDR33 (Homo sapiens) 6480464 ochratoxin A results in decreased expression of WDR33 mRNA CTD PMID:22124623 Wdr33 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of WDR33 mRNA CTD PMID:25729387 Wdr33 Rat paracetamol increases expression ISO WDR33 (Homo sapiens) 6480464 Acetaminophen results in increased expression of WDR33 mRNA CTD PMID:26690555 Wdr33 Rat pentanal decreases expression ISO WDR33 (Homo sapiens) 6480464 pentanal results in decreased expression of WDR33 mRNA CTD PMID:26079696 Wdr33 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Wdr33 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of WDR33 mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of WDR33 mRNA CTD PMID:36331819 Wdr33 Rat phenobarbital affects expression ISO Wdr33 (Mus musculus) 6480464 Phenobarbital affects the expression of WDR33 mRNA CTD PMID:19136022 Wdr33 Rat phenylmercury acetate decreases expression ISO WDR33 (Homo sapiens) 6480464 Phenylmercuric Acetate results in decreased expression of WDR33 mRNA CTD PMID:26272509 Wdr33 Rat phenylmercury acetate multiple interactions ISO WDR33 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of WDR33 mRNA CTD PMID:27188386 Wdr33 Rat pirinixic acid affects expression ISO Wdr33 (Mus musculus) 6480464 pirinixic acid affects the expression of WDR33 mRNA CTD PMID:19136022 Wdr33 Rat pirinixic acid decreases expression ISO Wdr33 (Mus musculus) 6480464 pirinixic acid results in decreased expression of WDR33 mRNA CTD PMID:18445702 Wdr33 Rat quercitrin decreases expression ISO WDR33 (Homo sapiens) 6480464 quercitrin results in decreased expression of WDR33 mRNA CTD PMID:25193878 Wdr33 Rat SB 431542 multiple interactions ISO WDR33 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of WDR33 mRNA CTD PMID:27188386 Wdr33 Rat serpentine asbestos increases expression ISO WDR33 (Homo sapiens) 6480464 Asbestos and Serpentine results in increased expression of WDR33 mRNA CTD PMID:21148743 Wdr33 Rat silicon dioxide decreases expression ISO WDR33 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of WDR33 mRNA CTD PMID:25895662 Wdr33 Rat silicon dioxide increases expression ISO WDR33 (Homo sapiens) 6480464 Silicon Dioxide results in increased expression of WDR33 mRNA CTD PMID:25351596 Wdr33 Rat sodium arsenate increases expression ISO Wdr33 (Mus musculus) 6480464 sodium arsenate results in increased expression of WDR33 mRNA CTD PMID:21795629 Wdr33 Rat sodium arsenite affects methylation ISO WDR33 (Homo sapiens) 6480464 sodium arsenite affects the methylation of WDR33 gene CTD PMID:28589171 Wdr33 Rat sodium arsenite decreases expression ISO WDR33 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of WDR33 mRNA CTD PMID:29301061 Wdr33 Rat Soman decreases expression EXP 6480464 Soman results in decreased expression of WDR33 mRNA CTD PMID:19281266 Wdr33 Rat titanium dioxide decreases methylation ISO Wdr33 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of WDR33 gene and titanium dioxide results in decreased methylation of WDR33 promoter CTD PMID:35295148 Wdr33 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of WDR33 mRNA CTD PMID:25729387 Wdr33 Rat topotecan decreases expression EXP 6480464 Topotecan results in decreased expression of WDR33 mRNA CTD PMID:25729387 Wdr33 Rat trichostatin A decreases expression ISO WDR33 (Homo sapiens) 6480464 trichostatin A results in decreased expression of WDR33 mRNA CTD PMID:24935251 Wdr33 Rat troglitazone decreases expression ISO Wdr33 (Mus musculus) 6480464 troglitazone results in decreased expression of WDR33 mRNA CTD PMID:28973697 Wdr33 Rat ursodeoxycholic acid affects expression ISO WDR33 (Homo sapiens) 6480464 Ursodeoxycholic Acid affects the expression of WDR33 mRNA CTD PMID:18422935 Wdr33 Rat valdecoxib decreases expression EXP 6480464 valdecoxib results in decreased expression of WDR33 mRNA CTD PMID:24136188 Wdr33 Rat valproic acid decreases expression ISO Wdr33 (Mus musculus) 6480464 Valproic Acid results in decreased expression of WDR33 mRNA CTD PMID:21427059 Wdr33 Rat valproic acid decreases expression ISO WDR33 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of WDR33 mRNA CTD PMID:23179753 more ... Wdr33 Rat valproic acid decreases methylation ISO WDR33 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of WDR33 gene CTD PMID:29154799 Wdr33 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of WDR33 mRNA CTD PMID:23034163 Wdr33 Rat vinclozolin increases methylation EXP 6480464 vinclozolin results in increased methylation of WDR33 gene CTD PMID:31682807 Wdr33 Rat vincristine decreases expression ISO WDR33 (Homo sapiens) 6480464 Vincristine results in decreased expression of WDR33 mRNA CTD PMID:23649840
(-)-demecolcine (ISO) (1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 2-methylcholine (ISO) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 5-aza-2'-deoxycytidine (ISO) aflatoxin B1 (ISO) antirheumatic drug (ISO) atrazine (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) butanal (ISO) caffeine (ISO) chloroprene (EXP) cisplatin (ISO) cobalt dichloride (EXP) copper(II) sulfate (ISO) crocidolite asbestos (ISO) diuron (EXP) dorsomorphin (ISO) doxorubicin (ISO) ethyl methanesulfonate (ISO) folic acid (ISO) formaldehyde (ISO) gentamycin (EXP) hydrogen peroxide (ISO) ivermectin (ISO) methyl methanesulfonate (ISO) methylmercury chloride (ISO) nickel atom (ISO) nitrates (ISO) ochratoxin A (ISO) oxaliplatin (EXP) paracetamol (ISO) pentanal (ISO) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) phenylmercury acetate (ISO) pirinixic acid (ISO) quercitrin (ISO) SB 431542 (ISO) serpentine asbestos (ISO) silicon dioxide (ISO) sodium arsenate (ISO) sodium arsenite (ISO) Soman (EXP) titanium dioxide (ISO) topotecan (EXP) trichostatin A (ISO) troglitazone (ISO) ursodeoxycholic acid (ISO) valdecoxib (EXP) valproic acid (ISO) vinclozolin (EXP) vincristine (ISO)
Wdr33 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 18 23,706,708 - 23,812,985 (+) NCBI GRCr8 mRatBN7.2 18 23,432,233 - 23,535,460 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 18 23,432,191 - 23,468,597 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 18 23,560,579 - 23,663,560 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 18 24,309,591 - 24,412,620 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 18 23,655,547 - 23,758,526 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 18 24,584,832 - 24,689,681 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 18 24,584,900 - 24,689,636 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 18 24,302,033 - 24,403,950 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 18 24,219,464 - 24,328,893 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 18 24,246,048 - 24,356,083 (+) NCBI Celera 18 23,184,843 - 23,287,871 (+) NCBI Celera Cytogenetic Map 18 p12 NCBI
WDR33 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 127,701,027 - 127,811,171 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 127,701,027 - 127,811,187 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 128,458,601 - 128,568,745 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 128,178,278 - 128,285,215 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 2 128,178,037 - 128,284,975 NCBI Celera 2 121,772,751 - 121,879,694 (-) NCBI Celera Cytogenetic Map 2 q14.3 NCBI HuRef 2 120,768,042 - 120,874,721 (-) NCBI HuRef CHM1_1 2 128,466,415 - 128,573,757 (-) NCBI CHM1_1 T2T-CHM13v2.0 2 128,136,260 - 128,246,425 (-) NCBI T2T-CHM13v2.0
Wdr33 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 18 31,937,079 - 32,042,040 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 18 31,937,143 - 32,040,450 (+) Ensembl GRCm39 Ensembl GRCm38 18 31,804,057 - 31,908,987 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 18 31,804,090 - 31,907,397 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 18 31,963,711 - 32,068,641 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 18 31,970,295 - 32,050,005 (+) NCBI MGSCv36 mm8 Celera 18 32,292,716 - 32,399,466 (+) NCBI Celera Cytogenetic Map 18 B1 NCBI cM Map 18 17.85 NCBI
Wdr33 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955459 2,740,466 - 2,841,376 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955459 2,740,465 - 2,841,376 (+) NCBI ChiLan1.0 ChiLan1.0
WDR33 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 13 47,832,747 - 47,938,394 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2B 47,848,994 - 47,953,992 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2B 32,465,959 - 32,571,024 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2B 128,371,250 - 128,476,083 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 2B 128,371,250 - 128,476,083 (-) Ensembl panpan1.1 panPan2
WDR33 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 19 22,788,462 - 22,904,610 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 19 22,788,508 - 23,024,378 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 19 23,034,606 - 23,152,142 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 19 24,114,118 - 24,230,735 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 19 24,115,180 - 24,230,721 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 19 22,893,968 - 22,934,632 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 19 23,012,800 - 23,129,479 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 19 24,144,095 - 24,260,757 (+) NCBI UU_Cfam_GSD_1.0
Wdr33 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405303 98,006,836 - 98,112,211 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936469 43,505,476 - 43,610,851 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936469 43,505,507 - 43,610,851 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
WDR33 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 15 59,520,065 - 59,638,879 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 15 59,519,832 - 59,639,050 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 15 66,271,930 - 66,371,372 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
WDR33 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 10 2,406,083 - 2,511,966 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 10 2,406,100 - 2,515,016 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666061 20,243,667 - 20,356,103 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Wdr33
.
Predicted Target Of
Count of predictions: 49 Count of miRNA genes: 45 Interacting mature miRNAs: 49 Transcripts: ENSRNOT00000017075 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2301410 Bp317 Blood pressure QTL 317 0.004 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 11944273 26548295 Rat 1358358 Sradr6 Stress Responsive Adrenal Weight QTL 6 2.49 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 18 11944299 59330563 Rat 1331735 Rf44 Renal function QTL 44 2.981 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 18 18234564 31359530 Rat 61382 Bp46 Blood pressure QTL 46 18.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 18 11941791 31393320 Rat 1331741 Bp232 Blood pressure QTL 232 3.59112 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 18 21372893 83213037 Rat 8552968 Pigfal19 Plasma insulin-like growth factor 1 level QTL 19 11.4 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 18 1 25758124 Rat 61388 Bp2 Blood pressure QTL 2 3.23 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 18 1 35374722 Rat 1331781 Scl28 Serum cholesterol level QTL 28 3.995 blood HDL cholesterol amount (VT:0000184) serum high density lipoprotein cholesterol level (CMO:0000361) 18 11944299 24797117 Rat 6903359 Bp355 Blood pressure QTL 355 3.6 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 18 11944544 59796478 Rat 2313082 Bss85 Bone structure and strength QTL 85 0.8 0.0001 long bone metaphysis morphology trait (VT:0000133) tibia midshaft total cross-sectional area (CMO:0001715) 18 14951337 59951337 Rat 1641923 Colcr8 Colorectal carcinoma resistance QTL 8 3.1 0.0014 intestine integrity trait (VT:0010554) poorly differentiated malignant colorectal tumor number (CMO:0002076) 18 22066242 52293055 Rat 2312568 Glom21 Glomerulus QTL 21 2 0.005 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 18 5185858 40503530 Rat 1331766 Bp236 Blood pressure QTL 236 3.022 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 11944299 31359530 Rat 1358193 Emca2 Estrogen-induced mammary cancer QTL 2 1.6 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 18 18007599 63571040 Rat 631264 Scl22 Serum cholesterol level QTL 22 6.2 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 18 11941791 31393320 Rat 1331775 Bp235 Blood pressure QTL 235 3.201 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 18234564 31359530 Rat 12904680 Bw189 Body weight QTL 189 0.019 body mass (VT:0001259) body weight (CMO:0000012) 18 11944273 26548295 Rat 1600373 Mamtr6 Mammary tumor resistance QTL 6 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 18 19278901 83218561 Rat 2293708 Bss46 Bone structure and strength QTL 46 8.8 0.0001 lumbar vertebra morphology trait (VT:0010494) lumbar vertebra cortical cross-sectional area (CMO:0001690) 18 11791518 63636873 Rat 12904693 Am20 Aortic mass QTL 20 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 18 11944273 26548295 Rat 9589153 Insul31 Insulin level QTL 31 7.15 0.05 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 18 1 42547119 Rat 1578667 Bss21 Bone structure and strength QTL 21 3.5 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 18 11791518 83218561 Rat 12904695 Kidm73 Kidney mass QTL 73 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 18 11944273 26548295 Rat 2312598 Bp340 Blood pressure QTL 340 0.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 18 1 30558703 Rat 12904689 Cm128 Cardiac mass QTL 128 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 18 11944273 26548295 Rat 12904690 Cm129 Cardiac mass QTL 129 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 18 11944273 26548295 Rat 2300180 Bmd67 Bone mineral density QTL 67 4.8 0.0001 femur mineral mass (VT:0010011) bone mineral density (CMO:0001226) 18 1 34291613 Rat 12904691 Cm130 Cardiac mass QTL 130 0.001 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 18 11944273 26548295 Rat 9590248 Scort10 Serum corticosterone level QTL 10 19.71 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 18 1 25758124 Rat 2299160 Iddm35 Insulin dependent diabetes mellitus QTL 35 2.79 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 18 4207941 60377792 Rat 1578661 Bss20 Bone structure and strength QTL 20 3.7 femur morphology trait (VT:0000559) femoral neck cross-sectional area (CMO:0001697) 18 11791518 83218561 Rat 1331753 Bp231 Blood pressure QTL 231 3.643 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 18 11944299 52293055 Rat 2293661 Bss50 Bone structure and strength QTL 50 4.64 0.0003 lumbar vertebra size trait (VT:0010518) lumbar vertebra trabecular cross-sectional area (CMO:0001692) 18 1 34291613 Rat 61375 Bp41 Blood pressure QTL 41 2.4 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 18 11944299 41122201 Rat
D18Chm1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 18 23,499,564 - 23,499,733 (+) MAPPER mRatBN7.2 Rnor_6.0 18 24,654,463 - 24,654,630 NCBI Rnor6.0 Rnor_5.0 18 24,368,444 - 24,368,611 UniSTS Rnor5.0 RGSC_v3.4 18 24,286,413 - 24,286,580 UniSTS RGSC3.4 Celera 18 23,252,087 - 23,252,254 UniSTS Cytogenetic Map 18 p12 UniSTS
RH131944
Rat Assembly Chr Position (strand) Source JBrowse Rnor_6.0 18 24,619,520 - 24,619,727 NCBI Rnor6.0 Rnor_5.0 18 24,336,718 - 24,336,925 UniSTS Rnor5.0 RGSC_v3.4 18 24,254,085 - 24,254,292 UniSTS RGSC3.4 Celera 18 23,219,409 - 23,219,616 UniSTS RH 3.4 Map 18 284.2 UniSTS Cytogenetic Map 18 p12 UniSTS
BE116335
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 18 23,765,565 - 23,765,757 (+) Marker Load Pipeline mRatBN7.2 18 23,491,142 - 23,491,334 (+) MAPPER mRatBN7.2 Rnor_6.0 18 24,643,755 - 24,643,946 NCBI Rnor6.0 Rnor_5.0 18 24,360,953 - 24,361,144 UniSTS Rnor5.0 RGSC_v3.4 18 24,278,339 - 24,278,530 UniSTS RGSC3.4 Celera 18 23,243,645 - 23,243,836 UniSTS RH 3.4 Map 18 301.3 UniSTS Cytogenetic Map 18 p12 UniSTS
MARC_7291-7292:992008311:1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 18 23,531,686 - 23,533,200 (+) MAPPER mRatBN7.2 mRatBN7.2 3 90,973,085 - 90,973,116 (+) MAPPER mRatBN7.2 Rnor_6.0 18 24,685,825 - 24,687,377 NCBI Rnor6.0 Rnor_5.0 18 24,400,118 - 24,401,670 UniSTS Rnor5.0 RGSC_v3.4 18 24,325,124 - 24,326,636 UniSTS RGSC3.4 Celera 18 23,284,100 - 23,285,612 UniSTS Cytogenetic Map 18 p12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000017075 ⟹ ENSRNOP00000017075
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 18 23,432,191 - 23,468,597 (+) Ensembl Rnor_6.0 Ensembl 18 24,584,900 - 24,689,636 (+) Ensembl
RefSeq Acc Id:
NM_001107398 ⟹ NP_001100868
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 23,706,715 - 23,809,685 (+) NCBI mRatBN7.2 18 23,432,233 - 23,535,460 (+) NCBI Rnor_6.0 18 24,584,900 - 24,689,636 (+) NCBI Rnor_5.0 18 24,302,033 - 24,403,950 (+) NCBI RGSC_v3.4 18 24,219,464 - 24,328,893 (+) RGD Celera 18 23,184,843 - 23,287,871 (+) NCBI
Sequence:
GAAGATGGCGGCTGCATCTTTGAAGGAGAGGAATTGAGAGTGGGGAGAAGGGAAGAGGACCAGACGGGAGAGACATTCCCTACGGCGCCGAAGGACGCCGCGCTCGCGGTTAGGAGCTCTTCCCGGCC
hide sequence
RefSeq Acc Id:
XM_063277379 ⟹ XP_063133449
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 23,706,708 - 23,812,985 (+) NCBI
RefSeq Acc Id:
XM_063277380 ⟹ XP_063133450
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 23,706,708 - 23,812,985 (+) NCBI
RefSeq Acc Id:
XM_063277381 ⟹ XP_063133451
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 23,706,708 - 23,812,985 (+) NCBI
RefSeq Acc Id:
XM_063277382 ⟹ XP_063133452
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 23,706,708 - 23,773,176 (+) NCBI
RefSeq Acc Id:
XM_063277383 ⟹ XP_063133453
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 23,706,708 - 23,757,455 (+) NCBI
RefSeq Acc Id:
XM_063277384 ⟹ XP_063133454
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 23,706,708 - 23,757,455 (+) NCBI
RefSeq Acc Id:
XM_063277385 ⟹ XP_063133455
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 23,706,708 - 23,749,177 (+) NCBI
RefSeq Acc Id:
NP_001100868 ⟸ NM_001107398
- UniProtKB:
F1LT09 (UniProtKB/TrEMBL)
- Sequence:
MATEIGSPPRFFHMPRFQHQAPRQLFYKRPDFAQQQAMQQLTFDGKRMRKAVNRKTIDYNPSVIKYLENRIWQRDQRDMRAIQPDAGYYNDLVPPIGMLNNPMNAVTTKFVRTSTNKVKCPVFVVRWT
hide sequence
Ensembl Acc Id:
ENSRNOP00000017075 ⟸ ENSRNOT00000017075
RefSeq Acc Id:
XP_063133449 ⟸ XM_063277379
- Peptide Label:
isoform X1
- UniProtKB:
A6J2P4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063133450 ⟸ XM_063277380
- Peptide Label:
isoform X2
- UniProtKB:
A6J2P4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063133451 ⟸ XM_063277381
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_063133452 ⟸ XM_063277382
- Peptide Label:
isoform X4
RefSeq Acc Id:
XP_063133454 ⟸ XM_063277384
- Peptide Label:
isoform X6
RefSeq Acc Id:
XP_063133453 ⟸ XM_063277383
- Peptide Label:
isoform X5
RefSeq Acc Id:
XP_063133455 ⟸ XM_063277385
- Peptide Label:
isoform X7
RGD ID: 13700676 Promoter ID: EPDNEW_R11200 Type: multiple initiation site Name: Wdr33_1 Description: WD repeat domain 33 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 18 24,584,880 - 24,584,940 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-04-30
Wdr33
WD repeat domain 33
Wdr33_predicted
WD repeat domain 33 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Wdr33_predicted
WD repeat domain 33 (predicted)
Symbol and Name status set to approved
70820 APPROVED
