Symbol:
Wdr33
Name:
WD repeat domain 33
RGD ID:
1319456
MGI Page
MGI
Description:
Predicted to be involved in mRNA 3'-end processing. Located in nucleus. Orthologous to human WDR33 (WD repeat domain 33).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
1110001N06Rik; 2310011G05Rik; 2810021O11Rik; 8430413N20Rik; pre-mRNA 3' end processing protein WDR33; WD repeat-containing protein 33; WD repeat-containing protein of 146 kDa; WD repeat-containing protein WDC146; WDC146
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
WDR33 (WD repeat domain 33) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Wdr33 (WD repeat domain 33) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Wdr33 (WD repeat domain 33) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
WDR33 (WD repeat domain 33) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
WDR33 (WD repeat domain 33) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Wdr33 (WD repeat domain 33) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
WDR33 (WD repeat domain 33) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
WDR33 (WD repeat domain 33) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Wdr33 (WD repeat domain 33) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
COL3A1 (collagen type III alpha 1 chain) HGNC
Inparanoid
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Wdr33 (WD repeat domain 33)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
WDR33 (WD repeat domain 33)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
wdr33 (WD repeat domain 33)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid|ZFIN)
Saccharomyces cerevisiae (baker's yeast):
PFS2
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Wdr33
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
pfs-2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
wdr33
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 18 31,937,079 - 32,042,040 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 18 31,937,143 - 32,040,450 (+) Ensembl GRCm39 Ensembl GRCm38 18 31,804,057 - 31,908,987 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 18 31,804,090 - 31,907,397 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 18 31,963,711 - 32,068,641 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 18 31,970,295 - 32,050,005 (+) NCBI MGSCv36 mm8 Celera 18 32,292,716 - 32,399,466 (+) NCBI Celera Cytogenetic Map 18 B1 NCBI cM Map 18 17.85 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Wdr33 Mouse (-)-demecolcine decreases expression ISO WDR33 (Homo sapiens) 6480464 Demecolcine results in decreased expression of WDR33 mRNA CTD PMID:23649840 Wdr33 Mouse (1->4)-beta-D-glucan multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of WDR33 mRNA CTD PMID:36331819 Wdr33 Mouse 1,2-dimethylhydrazine affects expression EXP 6480464 1 and 2-Dimethylhydrazine affects the expression of WDR33 mRNA CTD PMID:22206623 Wdr33 Mouse 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO WDR33 (Homo sapiens) 6480464 [Tetrachlorodibenzodioxin co-treated with 2-methyl-2H-pyrazole-3-carboxylic acid (2-methyl-4-o-tolylazophenyl)amide] results in increased expression of WDR33 mRNA CTD PMID:29704546 Wdr33 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Wdr33 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in increased expression of WDR33 mRNA CTD PMID:34747641 Wdr33 Mouse 2,4-dinitrotoluene affects expression ISO Wdr33 (Rattus norvegicus) 6480464 2 and 4-dinitrotoluene affects the expression of WDR33 mRNA CTD PMID:21346803 Wdr33 Mouse 2-methylcholine affects expression ISO WDR33 (Homo sapiens) 6480464 beta-methylcholine affects the expression of WDR33 mRNA CTD PMID:21179406 Wdr33 Mouse 3,4-methylenedioxymethamphetamine decreases expression EXP 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of WDR33 mRNA CTD PMID:26251327 Wdr33 Mouse 4,4'-diaminodiphenylmethane affects expression EXP 6480464 4 and 4'-diaminodiphenylmethane affects the expression of WDR33 mRNA CTD PMID:18648102 Wdr33 Mouse 4,4'-sulfonyldiphenol decreases methylation ISO WDR33 (Homo sapiens) 6480464 bisphenol S results in decreased methylation of WDR33 gene CTD PMID:31601247 Wdr33 Mouse 5-aza-2'-deoxycytidine affects expression ISO WDR33 (Homo sapiens) 6480464 Decitabine affects the expression of WDR33 mRNA CTD PMID:23300844 Wdr33 Mouse aflatoxin B1 increases methylation ISO WDR33 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of WDR33 gene CTD PMID:27153756 Wdr33 Mouse antirheumatic drug increases expression ISO WDR33 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of WDR33 mRNA CTD PMID:24449571 Wdr33 Mouse atrazine increases expression ISO WDR33 (Homo sapiens) 6480464 Atrazine results in increased expression of WDR33 mRNA CTD PMID:22378314 Wdr33 Mouse benzo[a]pyrene affects methylation ISO WDR33 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of WDR33 intron and Benzo(a)pyrene affects the methylation of WDR33 promoter CTD PMID:27901495 and PMID:30157460 Wdr33 Mouse bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of WDR33 mRNA CTD PMID:34319233 Wdr33 Mouse bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of WDR33 mRNA CTD PMID:26063408 Wdr33 Mouse bisphenol A decreases expression ISO WDR33 (Homo sapiens) 6480464 bisphenol A results in decreased expression of WDR33 mRNA CTD PMID:29275510 Wdr33 Mouse bisphenol A increases expression ISO Wdr33 (Rattus norvegicus) 6480464 bisphenol A results in increased expression of WDR33 mRNA CTD PMID:25181051 and PMID:30816183 Wdr33 Mouse butanal decreases expression ISO WDR33 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of WDR33 mRNA CTD PMID:26079696 Wdr33 Mouse caffeine decreases phosphorylation ISO WDR33 (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of WDR33 protein CTD PMID:35688186 Wdr33 Mouse chloroprene increases expression ISO Wdr33 (Rattus norvegicus) 6480464 Chloroprene results in increased expression of WDR33 mRNA CTD PMID:23125180 Wdr33 Mouse cisplatin affects expression ISO WDR33 (Homo sapiens) 6480464 Cisplatin affects the expression of WDR33 mRNA CTD PMID:23300844 Wdr33 Mouse cobalt dichloride increases expression ISO Wdr33 (Rattus norvegicus) 6480464 cobaltous chloride results in increased expression of WDR33 mRNA CTD PMID:24386269 Wdr33 Mouse copper(II) sulfate decreases expression ISO WDR33 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of WDR33 mRNA CTD PMID:19549813 Wdr33 Mouse crocidolite asbestos increases expression EXP 6480464 Asbestos and Crocidolite results in increased expression of WDR33 mRNA CTD PMID:29279043 Wdr33 Mouse diuron increases expression ISO Wdr33 (Rattus norvegicus) 6480464 Diuron results in increased expression of WDR33 mRNA CTD PMID:21551480 Wdr33 Mouse dorsomorphin multiple interactions ISO WDR33 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of WDR33 mRNA CTD PMID:27188386 Wdr33 Mouse doxorubicin decreases expression ISO WDR33 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of WDR33 mRNA CTD PMID:29803840 Wdr33 Mouse doxorubicin multiple interactions ISO WDR33 (Homo sapiens) 6480464 [VRK1 protein affects the susceptibility to Doxorubicin] which affects the phosphorylation of WDR33 protein CTD PMID:38367682 Wdr33 Mouse ethyl methanesulfonate increases expression ISO WDR33 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in increased expression of WDR33 mRNA CTD PMID:23649840 Wdr33 Mouse folic acid decreases expression EXP 6480464 Folic Acid results in decreased expression of WDR33 mRNA CTD PMID:25629700 Wdr33 Mouse formaldehyde decreases expression ISO WDR33 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of WDR33 mRNA CTD PMID:23649840 Wdr33 Mouse gentamycin increases expression ISO Wdr33 (Rattus norvegicus) 6480464 Gentamicins results in increased expression of WDR33 mRNA CTD PMID:33387578 Wdr33 Mouse hydrogen peroxide affects expression ISO WDR33 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of WDR33 mRNA CTD PMID:20044591 Wdr33 Mouse hydrogen peroxide decreases expression ISO WDR33 (Homo sapiens) 6480464 Hydrogen Peroxide results in decreased expression of WDR33 mRNA CTD PMID:18951874 Wdr33 Mouse ivermectin decreases expression ISO WDR33 (Homo sapiens) 6480464 Ivermectin results in decreased expression of WDR33 protein CTD PMID:32959892 Wdr33 Mouse methyl methanesulfonate increases expression ISO WDR33 (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of WDR33 mRNA CTD PMID:23649840 Wdr33 Mouse methylmercury chloride decreases expression ISO WDR33 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of WDR33 mRNA CTD PMID:28001369 Wdr33 Mouse nickel atom decreases expression ISO WDR33 (Homo sapiens) 6480464 Nickel results in decreased expression of WDR33 mRNA CTD PMID:25583101 Wdr33 Mouse nitrates multiple interactions EXP 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of WDR33 mRNA CTD PMID:35964746 Wdr33 Mouse ochratoxin A decreases expression ISO WDR33 (Homo sapiens) 6480464 ochratoxin A results in decreased expression of WDR33 mRNA CTD PMID:22124623 Wdr33 Mouse oxaliplatin multiple interactions ISO Wdr33 (Rattus norvegicus) 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of WDR33 mRNA CTD PMID:25729387 Wdr33 Mouse paracetamol increases expression ISO WDR33 (Homo sapiens) 6480464 Acetaminophen results in increased expression of WDR33 mRNA CTD PMID:26690555 Wdr33 Mouse pentanal decreases expression ISO WDR33 (Homo sapiens) 6480464 pentanal results in decreased expression of WDR33 mRNA CTD PMID:26079696 Wdr33 Mouse perfluorooctane-1-sulfonic acid multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of WDR33 mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of WDR33 mRNA CTD PMID:36331819 Wdr33 Mouse phenobarbital affects expression EXP 6480464 Phenobarbital affects the expression of WDR33 mRNA CTD PMID:19136022 Wdr33 Mouse phenylmercury acetate decreases expression ISO WDR33 (Homo sapiens) 6480464 Phenylmercuric Acetate results in decreased expression of WDR33 mRNA CTD PMID:26272509 Wdr33 Mouse phenylmercury acetate multiple interactions ISO WDR33 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of WDR33 mRNA CTD PMID:27188386 Wdr33 Mouse pirinixic acid affects expression EXP 6480464 pirinixic acid affects the expression of WDR33 mRNA CTD PMID:19136022 Wdr33 Mouse pirinixic acid decreases expression EXP 6480464 pirinixic acid results in decreased expression of WDR33 mRNA CTD PMID:18445702 Wdr33 Mouse quercitrin decreases expression ISO WDR33 (Homo sapiens) 6480464 quercitrin results in decreased expression of WDR33 mRNA CTD PMID:25193878 Wdr33 Mouse SB 431542 multiple interactions ISO WDR33 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of WDR33 mRNA CTD PMID:27188386 Wdr33 Mouse serpentine asbestos increases expression ISO WDR33 (Homo sapiens) 6480464 Asbestos and Serpentine results in increased expression of WDR33 mRNA CTD PMID:21148743 Wdr33 Mouse silicon dioxide decreases expression ISO WDR33 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of WDR33 mRNA CTD PMID:25895662 Wdr33 Mouse silicon dioxide increases expression ISO WDR33 (Homo sapiens) 6480464 Silicon Dioxide results in increased expression of WDR33 mRNA CTD PMID:25351596 Wdr33 Mouse sodium arsenate increases expression EXP 6480464 sodium arsenate results in increased expression of WDR33 mRNA CTD PMID:21795629 Wdr33 Mouse sodium arsenite affects methylation ISO WDR33 (Homo sapiens) 6480464 sodium arsenite affects the methylation of WDR33 gene CTD PMID:28589171 Wdr33 Mouse sodium arsenite decreases expression ISO WDR33 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of WDR33 mRNA CTD PMID:29301061 Wdr33 Mouse Soman decreases expression ISO Wdr33 (Rattus norvegicus) 6480464 Soman results in decreased expression of WDR33 mRNA CTD PMID:19281266 Wdr33 Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of WDR33 gene and titanium dioxide results in decreased methylation of WDR33 promoter CTD PMID:35295148 Wdr33 Mouse topotecan multiple interactions ISO Wdr33 (Rattus norvegicus) 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of WDR33 mRNA CTD PMID:25729387 Wdr33 Mouse topotecan decreases expression ISO Wdr33 (Rattus norvegicus) 6480464 Topotecan results in decreased expression of WDR33 mRNA CTD PMID:25729387 Wdr33 Mouse trichostatin A decreases expression ISO WDR33 (Homo sapiens) 6480464 trichostatin A results in decreased expression of WDR33 mRNA CTD PMID:24935251 Wdr33 Mouse troglitazone decreases expression EXP 6480464 troglitazone results in decreased expression of WDR33 mRNA CTD PMID:28973697 Wdr33 Mouse ursodeoxycholic acid affects expression ISO WDR33 (Homo sapiens) 6480464 Ursodeoxycholic Acid affects the expression of WDR33 mRNA CTD PMID:18422935 Wdr33 Mouse valdecoxib decreases expression ISO Wdr33 (Rattus norvegicus) 6480464 valdecoxib results in decreased expression of WDR33 mRNA CTD PMID:24136188 Wdr33 Mouse valproic acid decreases methylation ISO WDR33 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of WDR33 gene CTD PMID:29154799 Wdr33 Mouse valproic acid decreases expression ISO WDR33 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of WDR33 mRNA CTD PMID:23179753 more ... Wdr33 Mouse valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of WDR33 mRNA CTD PMID:21427059 Wdr33 Mouse vinclozolin decreases expression ISO Wdr33 (Rattus norvegicus) 6480464 vinclozolin results in decreased expression of WDR33 mRNA CTD PMID:23034163 Wdr33 Mouse vinclozolin increases methylation ISO Wdr33 (Rattus norvegicus) 6480464 vinclozolin results in increased methylation of WDR33 gene CTD PMID:31682807 Wdr33 Mouse vincristine decreases expression ISO WDR33 (Homo sapiens) 6480464 Vincristine results in decreased expression of WDR33 mRNA CTD PMID:23649840
(-)-demecolcine (ISO) (1->4)-beta-D-glucan (EXP) 1,2-dimethylhydrazine (EXP) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4-dinitrotoluene (ISO) 2-methylcholine (ISO) 3,4-methylenedioxymethamphetamine (EXP) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (ISO) 5-aza-2'-deoxycytidine (ISO) aflatoxin B1 (ISO) antirheumatic drug (ISO) atrazine (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (EXP,ISO) butanal (ISO) caffeine (ISO) chloroprene (ISO) cisplatin (ISO) cobalt dichloride (ISO) copper(II) sulfate (ISO) crocidolite asbestos (EXP) diuron (ISO) dorsomorphin (ISO) doxorubicin (ISO) ethyl methanesulfonate (ISO) folic acid (EXP) formaldehyde (ISO) gentamycin (ISO) hydrogen peroxide (ISO) ivermectin (ISO) methyl methanesulfonate (ISO) methylmercury chloride (ISO) nickel atom (ISO) nitrates (EXP) ochratoxin A (ISO) oxaliplatin (ISO) paracetamol (ISO) pentanal (ISO) perfluorooctane-1-sulfonic acid (EXP) phenobarbital (EXP) phenylmercury acetate (ISO) pirinixic acid (EXP) quercitrin (ISO) SB 431542 (ISO) serpentine asbestos (ISO) silicon dioxide (ISO) sodium arsenate (EXP) sodium arsenite (ISO) Soman (ISO) titanium dioxide (EXP) topotecan (ISO) trichostatin A (ISO) troglitazone (EXP) ursodeoxycholic acid (ISO) valdecoxib (ISO) valproic acid (EXP,ISO) vinclozolin (ISO) vincristine (ISO)
1.
Pre-mRNA 3'-end processing complex assembly and function.
Chan S, etal., Wiley Interdiscip Rev RNA. 2011 May-Jun;2(3):321-35. doi: 10.1002/wrna.54. Epub 2010 Oct 18.
2.
Means to an end: mechanisms of alternative polyadenylation of messenger RNA precursors.
Gruber AR, etal., Wiley Interdiscip Rev RNA. 2014 Mar-Apr;5(2):183-96. doi: 10.1002/wrna.1206. Epub 2013 Nov 14.
3.
Functional annotation of a full-length mouse cDNA collection.
Kawai J, etal., Nature. 2001 Feb 8;409(6821):685-90.
4.
MGDs mouse GO annotations
MGD data from the GO Consortium
5.
Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.
Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
6.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
Wdr33 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 18 31,937,079 - 32,042,040 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 18 31,937,143 - 32,040,450 (+) Ensembl GRCm39 Ensembl GRCm38 18 31,804,057 - 31,908,987 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 18 31,804,090 - 31,907,397 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 18 31,963,711 - 32,068,641 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 18 31,970,295 - 32,050,005 (+) NCBI MGSCv36 mm8 Celera 18 32,292,716 - 32,399,466 (+) NCBI Celera Cytogenetic Map 18 B1 NCBI cM Map 18 17.85 NCBI
WDR33 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 127,701,027 - 127,811,171 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 127,701,027 - 127,811,187 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 128,458,601 - 128,568,745 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 128,178,278 - 128,285,215 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 2 128,178,037 - 128,284,975 NCBI Celera 2 121,772,751 - 121,879,694 (-) NCBI Celera Cytogenetic Map 2 q14.3 NCBI HuRef 2 120,768,042 - 120,874,721 (-) NCBI HuRef CHM1_1 2 128,466,415 - 128,573,757 (-) NCBI CHM1_1 T2T-CHM13v2.0 2 128,136,260 - 128,246,425 (-) NCBI T2T-CHM13v2.0
Wdr33 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 18 23,706,708 - 23,812,985 (+) NCBI GRCr8 mRatBN7.2 18 23,432,233 - 23,535,460 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 18 23,432,191 - 23,468,597 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 18 23,560,579 - 23,663,560 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 18 24,309,591 - 24,412,620 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 18 23,655,547 - 23,758,526 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 18 24,584,832 - 24,689,681 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 18 24,584,900 - 24,689,636 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 18 24,302,033 - 24,403,950 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 18 24,219,464 - 24,328,893 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 18 24,246,048 - 24,356,083 (+) NCBI Celera 18 23,184,843 - 23,287,871 (+) NCBI Celera Cytogenetic Map 18 p12 NCBI
Wdr33 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955459 2,740,466 - 2,841,376 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955459 2,740,465 - 2,841,376 (+) NCBI ChiLan1.0 ChiLan1.0
WDR33 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 13 47,832,747 - 47,938,394 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2B 47,848,994 - 47,953,992 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2B 32,465,959 - 32,571,024 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2B 128,371,250 - 128,476,083 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 2B 128,371,250 - 128,476,083 (-) Ensembl panpan1.1 panPan2
WDR33 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 19 22,788,462 - 22,904,610 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 19 22,788,508 - 23,024,378 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 19 23,034,606 - 23,152,142 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 19 24,114,118 - 24,230,735 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 19 24,115,180 - 24,230,721 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 19 22,893,968 - 22,934,632 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 19 23,012,800 - 23,129,479 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 19 24,144,095 - 24,260,757 (+) NCBI UU_Cfam_GSD_1.0
Wdr33 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405303 98,006,836 - 98,112,211 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936469 43,505,476 - 43,610,851 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936469 43,505,507 - 43,610,851 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
WDR33 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 15 59,520,065 - 59,638,879 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 15 59,519,832 - 59,639,050 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 15 66,271,930 - 66,371,372 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
WDR33 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 10 2,406,083 - 2,511,966 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 10 2,406,100 - 2,515,016 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666061 20,243,667 - 20,356,103 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Wdr33
.
Predicted Target Of
Count of predictions: 639 Count of miRNA genes: 442 Interacting mature miRNAs: 506 Transcripts: ENSMUST00000025264, ENSMUST00000082319 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1558743 Kcal1_m kilocalorie 1 (mouse) Not determined 18 19018874 53018992 Mouse 1302163 Bmd16_m bone mineral density 16 (mouse) Not determined 18 29667914 63668060 Mouse 11532716 Sluc41c_m susceptibility to lung cancer 41c (mouse) 18 22619914 56620127 Mouse 11532715 Sluc41b_m susceptibility to lung cancer 41b (mouse) 18 22619914 56620127 Mouse 11532710 Sluc41a_m susceptibility to lung cancer 41a (mouse) 18 22619914 56620127 Mouse 25823171 Hrsq10_m host response to SARS QTL 10, D4% weight (mouse) 18 27241115 58827077 Mouse 11532709 Sluc41_m susceptibility to lung cancer 41 (mouse) 18 20953694 57590708 Mouse 1301400 Lmr13_m leishmaniasis resistance 13 (mouse) Not determined 18 28109380 62109518 Mouse 25823174 Hrsq11_m host response to SARS QTL 11, log titer (mouse) 18 27241115 58827077 Mouse 1300638 Im7_m immunoregulatory 7 (mouse) Not determined 18 19018874 53018992 Mouse 1558873 Hrtfm7_m heart failure modifier 7 (mouse) Not determined 18 8086964 42087106 Mouse 25823173 Hrsq12_m host response to SARS QTL 12, hemorrhage (mouse) 18 24895881 78339555 Mouse 1300994 Pvcan3_m protection against vaginal candidiasis 3 (mouse) Not determined 18 16199640 50199776 Mouse 1301570 Sluc14_m susceptibility to lung cancer 14 (mouse) Not determined 18 22619914 56620127 Mouse 13504732 Cath6_m carotid atherosclerosis 6 (mouse) 18 13637126 47637126 Mouse 1558849 W3q15_m weight 3 weeks QTL 15 (mouse) Not determined 18 5041119 61272643 Mouse 12880412 V125Dq12_m vitamin D active form serum level QTL 12 (mouse) 18 30233067 64233067 Mouse 1300877 Adip8_m adiposity 8 (mouse) Not determined 18 22619914 56620127 Mouse 4141857 Mhysq5_m male hybrid sterility QTL 5 (mouse) Not determined 28130604 62130739 Mouse 1300685 Scc5_m colon tumor susceptibility 5 (mouse) Not determined 18 31988480 65988629 Mouse 13207585 Mwmlpt3_m Morris water maze latency to platform, training, 3 (mouse) 18 1 33547739 Mouse 1301307 Phospq1_m phospholipid QTL 1 (mouse) Not determined 18 18139704 52139859 Mouse 13207589 Mwmlpa3_m Morris water maze latency to platform, all, 3 (mouse) 18 1 33547739 Mouse 1301950 Otx2m1_m orthodenticle homolog 2 (Drosophila) modifier 1 (mouse) Not determined 18 21568682 36187740 Mouse 4142031 Moen1_m modifier of engrailed QTL 1 (mouse) Not determined 18 24115560 58115730 Mouse 12904950 Smmq3_m soleus muscle mass QTL 3 (mouse) 18 26056875 60056875 Mouse 25823167 Hrsq5_m host response to SARS QTL 5, D3% weight (mouse) 18 27241115 58827077 Mouse 1357603 Mom3_m modifier of Min 3 (mouse) Not determined 18 14030023 67098962 Mouse 13463476 Hctq8_m hematocrit QTL 8 (mouse) 18 21217580 55217727 Mouse 27226723 Tibw9_m tibia width 9, proximal, 16 week (mouse) 18 3200000 60933072 Mouse
PMC150726P5
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 18 31,819,890 - 31,820,190 UniSTS GRCm38 MGSCv37 18 31,979,544 - 31,979,844 UniSTS GRCm37 Celera 18 32,308,986 - 32,309,286 UniSTS Cytogenetic Map 3 F2.3 UniSTS Cytogenetic Map 18 B1 UniSTS Cytogenetic Map 18 B3 UniSTS
D11Bhm20
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 7 F1 UniSTS Cytogenetic Map 5 E2 UniSTS Cytogenetic Map 1 C3 UniSTS Cytogenetic Map 17 A3.3 UniSTS Cytogenetic Map 19 D1 UniSTS Cytogenetic Map 13 A2-A3 UniSTS Cytogenetic Map 11 A1 UniSTS Cytogenetic Map 5 C1 UniSTS Cytogenetic Map 12 D1 UniSTS Cytogenetic Map 8 E1 UniSTS Cytogenetic Map 4 D1 UniSTS Cytogenetic Map 7 B4 UniSTS Cytogenetic Map 3 F1 UniSTS Cytogenetic Map 7 A1 UniSTS Cytogenetic Map 4 E1 UniSTS Cytogenetic Map 10 B4 UniSTS Cytogenetic Map 2 E5 UniSTS Cytogenetic Map 14 B UniSTS Cytogenetic Map 10 C1 UniSTS Cytogenetic Map 19 C2 UniSTS Cytogenetic Map 7 A3 UniSTS Cytogenetic Map 16 C1.1 UniSTS Cytogenetic Map 3 B UniSTS Cytogenetic Map 13 B3 UniSTS Cytogenetic Map 15 F1 UniSTS Cytogenetic Map 5 B1 UniSTS Cytogenetic Map 2 E2 UniSTS Cytogenetic Map 8 B3.3 UniSTS Cytogenetic Map 6 F3 UniSTS Cytogenetic Map 4 C7 UniSTS Cytogenetic Map 12 F1 UniSTS Cytogenetic Map 10 A3 UniSTS Cytogenetic Map 14 D2 UniSTS Cytogenetic Map 6 A3.3 UniSTS Cytogenetic Map 6 G3 UniSTS Cytogenetic Map 9 F2 UniSTS Cytogenetic Map 11 E2 UniSTS Cytogenetic Map 1 C1.3 UniSTS Cytogenetic Map 13 D2 UniSTS Cytogenetic Map 11 C UniSTS Cytogenetic Map 17 B1 UniSTS Cytogenetic Map 18 B3 UniSTS Cytogenetic Map 4 E2 UniSTS Cytogenetic Map X A5 UniSTS Cytogenetic Map 6 A2 UniSTS Cytogenetic Map 2 H4 UniSTS Cytogenetic Map 5 F UniSTS Cytogenetic Map 11 E1 UniSTS Cytogenetic Map 16 C4 UniSTS Cytogenetic Map 3 G1 UniSTS Cytogenetic Map 8 D2 UniSTS Cytogenetic Map 2 H2 UniSTS Cytogenetic Map 11 B5 UniSTS Cytogenetic Map 4 D3 UniSTS Cytogenetic Map 12 C3 UniSTS Cytogenetic Map 7 B1-B2 UniSTS Cytogenetic Map 4 D2.2 UniSTS Cytogenetic Map 11 B1.1 UniSTS Cytogenetic Map 15 B3.1 UniSTS Cytogenetic Map 8 D3 UniSTS Cytogenetic Map 10 D2 UniSTS Cytogenetic Map 15 E3 UniSTS Cytogenetic Map 2 H1 UniSTS Cytogenetic Map 7 E3 UniSTS Cytogenetic Map 4 D2.3 UniSTS Cytogenetic Map 10 D3 UniSTS Cytogenetic Map 12 E UniSTS Cytogenetic Map 5 G2 UniSTS Cytogenetic Map 1 H6 UniSTS Cytogenetic Map 16 A1 UniSTS Cytogenetic Map 2 A3 UniSTS Cytogenetic Map 9 A5.2 UniSTS Cytogenetic Map 3 D UniSTS Cytogenetic Map 6 B1 UniSTS Cytogenetic Map X C-D UniSTS Cytogenetic Map 13 B1 UniSTS Cytogenetic Map 11 A3.2 UniSTS Cytogenetic Map 8 C3 UniSTS Cytogenetic Map X A7.3 UniSTS Cytogenetic Map 12 A1.1 UniSTS Cytogenetic Map 16 B4 UniSTS Cytogenetic Map 4 B3 UniSTS Cytogenetic Map 5 E5 UniSTS Cytogenetic Map 19 B UniSTS cM Map 11 44.15 UniSTS
Gstm2
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 18 31,820,109 - 31,820,190 UniSTS GRCm38 GRCm38 3 107,984,175 - 107,985,080 UniSTS GRCm38 MGSCv37 18 31,979,763 - 31,979,844 UniSTS GRCm37 MGSCv37 3 107,787,093 - 107,787,998 UniSTS GRCm37 Celera 3 110,317,251 - 110,318,156 UniSTS Celera 18 32,309,205 - 32,309,286 UniSTS Cytogenetic Map 18 B1 UniSTS Cytogenetic Map 18 B3 UniSTS Cytogenetic Map 3 F2.3 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000025264 ⟹ ENSMUSP00000025264
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 18 31,937,151 - 32,040,450 (+) Ensembl GRCm38.p6 Ensembl 18 31,804,098 - 31,907,397 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000082319 ⟹ ENSMUSP00000080936
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 18 31,937,143 - 31,974,695 (+) Ensembl GRCm38.p6 Ensembl 18 31,804,090 - 31,841,642 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000234137
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 18 32,015,195 - 32,019,423 (+) Ensembl GRCm38.p6 Ensembl 18 31,882,142 - 31,886,370 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000234302
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 18 31,937,143 - 31,961,905 (+) Ensembl GRCm38.p6 Ensembl 18 31,804,090 - 31,828,852 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000234344 ⟹ ENSMUSP00000157238
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 18 31,937,229 - 31,968,475 (+) Ensembl GRCm38.p6 Ensembl 18 31,804,176 - 31,835,422 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000234937
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 18 32,036,970 - 32,039,891 (+) Ensembl GRCm38.p6 Ensembl 18 31,903,917 - 31,906,838 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000234957 ⟹ ENSMUSP00000157157
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 18 31,937,146 - 31,974,994 (+) Ensembl GRCm38.p6 Ensembl 18 31,804,093 - 31,841,941 (+) Ensembl
RefSeq Acc Id:
NM_001170966 ⟹ NP_001164437
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 18 31,937,110 - 31,968,488 (+) NCBI GRCm38 18 31,804,057 - 31,835,435 (+) NCBI MGSCv37 18 31,963,711 - 32,068,641 (+) RGD Celera 18 32,292,716 - 32,399,466 (+) RGD cM Map 18 ENTREZGENE
Sequence:
GCGGGGCGTAGCGCCGTGAGGCCGTGATGACGCACAGGCGTACGCTCGGTGGCTCCTCGGGTAAGATGGCGGCTGCATCTTTGAAGGAGAGGAATTGAAGAGTGAGGAGAAGGGAAGGAGGACCAGAC
hide sequence
RefSeq Acc Id:
NM_001170967 ⟹ NP_001164438
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 18 31,937,110 - 31,974,695 (+) NCBI GRCm38 18 31,804,057 - 31,841,642 (+) NCBI MGSCv37 18 31,963,711 - 32,068,641 (+) RGD Celera 18 32,292,716 - 32,399,466 (+) RGD cM Map 18 ENTREZGENE
Sequence:
GCGGGGCGTAGCGCCGTGAGGCCGTGATGACGCACAGGCGTACGCTCGGTGGCTCCTCGGGTAAGATGGCGGCTGCATCTTTGAAGGAGAGGAATTGAAGAGTGAGGAGAAGGGAAGGAGGACCAGAC
hide sequence
RefSeq Acc Id:
NM_001170970 ⟹ NP_001164441
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 18 31,937,110 - 31,974,695 (+) NCBI GRCm38 18 31,804,057 - 31,841,642 (+) NCBI MGSCv37 18 31,963,711 - 32,068,641 (+) RGD Celera 18 32,292,716 - 32,399,466 (+) RGD cM Map 18 ENTREZGENE
Sequence:
GCGGGGCGTAGCGCCGTGAGGCCGTGATGACGCACAGGCGTACGCTCGGTGGCTCCTCGGGTAAGATGGCGGCTGCATCTTTGAAGGAGAGGAATTGAAGAGTGAGGAGAAGGGAAGGAGGACCAGAC
hide sequence
RefSeq Acc Id:
NM_028866 ⟹ NP_083142
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 18 31,937,110 - 32,042,040 (+) NCBI GRCm38 18 31,804,057 - 31,908,987 (+) ENTREZGENE MGSCv37 18 31,963,711 - 32,068,641 (+) RGD Celera 18 32,292,716 - 32,399,466 (+) RGD cM Map 18 ENTREZGENE
Sequence:
GCGGGGCGTAGCGCCGTGAGGCCGTGATGACGCACAGGCGTACGCTCGGTGGCTCCTCGGGTAAGATGGCGGCTGCATCTTTGAAGGAGAGGAATTGAAGAGTGAGGAGAAGGGAAGGAGGACCAGAC
hide sequence
RefSeq Acc Id:
XM_006526298 ⟹ XP_006526361
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 18 31,937,084 - 32,040,740 (+) NCBI GRCm38 18 31,804,062 - 31,907,845 (+) NCBI
Sequence:
CTACGGTAGACCTGCGGCACAGGCGCGCGGGGCGTAGCGCCGTGAGGCCGTGATGACGCACAGG
hide sequence
RefSeq Acc Id:
XM_006526300 ⟹ XP_006526363
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 18 31,937,079 - 32,040,898 (+) NCBI GRCm38 18 31,804,062 - 31,907,845 (+) NCBI
Sequence:
GAGCCCTACGGTAGACCTGCGGCACAGGCGCGCGGGGCGTAGCGCCGTGAGGCCGTGATGACGCACAGGCGTACGCTCGGTGGCTCCTCGGGTAAGATGGCGGCTGCATCTTTGAAGGAGAGGAATTG
hide sequence
RefSeq Acc Id:
XM_006526301 ⟹ XP_006526364
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 18 31,937,079 - 32,040,898 (+) NCBI GRCm38 18 31,804,062 - 31,907,845 (+) NCBI
Sequence:
GAGCCCTACGGTAGACCTGCGGCACAGGCGCGCGGGGCGTAGCGCCGTGAGGCCGTGATGACGCACAGGCGTACGCTCGGTGGCTCCTCGGGTAAGATGGCGGCTGCATCTTTGAAGGAGAGGAATTG
hide sequence
RefSeq Acc Id:
XM_017317996 ⟹ XP_017173485
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 18 31,937,315 - 32,040,740 (+) NCBI GRCm38 18 31,804,300 - 31,907,845 (+) NCBI
Sequence:
CGCCGTGGCACCCGTGAGGGCCGCGGCGGGTCGCGCTCCGCCATTTTCGGGCCCGGCCGTTGCG
hide sequence
RefSeq Acc Id:
XM_036161296 ⟹ XP_036017189
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 18 31,937,367 - 31,986,036 (+) NCBI
Sequence:
CCGGCCGTTGCGTGCTTCGGGGGTCCGGAGGGGACAGGTCGCGGGAGAGAAGAGGACGGACGTCCGCTAGGCCGGCCGCGGCCGGCGGGGGTCCCGGCGGAGGAACTCTGCGGAGGAGGCCGTGAGGC
hide sequence
RefSeq Acc Id:
XM_036161297 ⟹ XP_036017190
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 18 31,937,115 - 32,002,644 (+) NCBI
Sequence:
GCGTAGCGCCGTGAGGCCGTGATGACGCACAGGCGTACGCTCGGTGGCTCCTCGGGTAAGATGGCGGCTGCATCTTTGAAGGAGAGGAATTGAAGAGTGAGGAGAAGGGAAGGAGGACCAGACTGGAG
hide sequence
RefSeq Acc Id:
NP_083142 ⟸ NM_028866
- Peptide Label:
isoform 1
- UniProtKB:
Q8C7C6 (UniProtKB/Swiss-Prot), Q8CD02 (UniProtKB/Swiss-Prot), Q8K4P0 (UniProtKB/Swiss-Prot)
- Sequence:
MATEIGSPPRFFHMPRFQHQAPRQLFYKRPDFAQQQAMQQLTFDGKRMRKAVNRKTIDYNPSVIKYLENRIWQRDQRDMRAIQPDAGYYNDLVPPIGMLNNPMNAVTTKFVRTSTNKVKCPVFVVRWT
hide sequence
RefSeq Acc Id:
NP_001164438 ⟸ NM_001170967
- Peptide Label:
isoform 3
- UniProtKB:
Q8K1G7 (UniProtKB/TrEMBL), D3YX80 (UniProtKB/TrEMBL)
- Sequence:
MATEIGSPPRFFHMPRFQHQAPRQLFYKRPDFAQQQAMQQLTFDGKRMRKAVNRKTIDYNPSVI
hide sequence
RefSeq Acc Id:
NP_001164441 ⟸ NM_001170970
- Peptide Label:
isoform 2
- UniProtKB:
A0A3Q4EGD8 (UniProtKB/TrEMBL)
- Sequence:
MATEIGSPPRFFHMPRFQHQAPRQLFYKRPDFAQQQAMQQLTFDGKRMRKAVNRKTIDYNPSVI
hide sequence
RefSeq Acc Id:
NP_001164437 ⟸ NM_001170966
- Peptide Label:
isoform 4
- UniProtKB:
Q9D1P6 (UniProtKB/TrEMBL), Q8BRC5 (UniProtKB/TrEMBL)
- Sequence:
MATEIGSPPRFFHMPRFQHQAPRQLFYKRPDFAQQQAMQQLTFDGKRMRKAVNRKTIDYNPSVIKYLENRIWQRDQRDMRAIQPDAGYYNDLVPPIGMLNNPMNAVTTKFVRTSTNKVKCPVFVVRWT
hide sequence
RefSeq Acc Id:
XP_006526361 ⟸ XM_006526298
- Peptide Label:
isoform X1
- Sequence:
MATEIGSPPRFFHMPRFQHQAPRQLFYKRPDFAQQQAMQQLTFDGKRMRKAVNRKTIDYNPSVI
hide sequence
RefSeq Acc Id:
XP_006526363 ⟸ XM_006526300
- Peptide Label:
isoform X2
- Sequence:
MATEIGSPPRFFHMPRFQHQAPRQLFYKRPDFAQQQAMQQLTFDGKRMRKAVNRKTIDYNPSVIKYLENRIWQRDQRDMRAIQPDAGYYNDLVPPIGMLNNPMNAVTTKFVRTSTNKVKCPVFVVRWT
hide sequence
RefSeq Acc Id:
XP_006526364 ⟸ XM_006526301
- Peptide Label:
isoform X3
- Sequence:
MATEIGSPPRFFHMPRFQHQAPRQLFYKRPDFAQQQAMQQLTFDGKRMRKAVNRKTIDYNPSVI
hide sequence
RefSeq Acc Id:
XP_017173485 ⟸ XM_017317996
- Peptide Label:
isoform X1
- Sequence:
MATEIGSPPRFFHMPRFQHQAPRQLFYKRPDFAQQQAMQQLTFDGKRMRKAVNRKTIDYNPSVIKYLENRIWQRDQRDMRAIQPDAGYYNDLVPPIGMLNNPMNAVTTKFVRTSTNKVKCPVFVVRWT
hide sequence
Ensembl Acc Id:
ENSMUSP00000025264 ⟸ ENSMUST00000025264
Ensembl Acc Id:
ENSMUSP00000157157 ⟸ ENSMUST00000234957
Ensembl Acc Id:
ENSMUSP00000157238 ⟸ ENSMUST00000234344
Ensembl Acc Id:
ENSMUSP00000080936 ⟸ ENSMUST00000082319
RefSeq Acc Id:
XP_036017190 ⟸ XM_036161297
- Peptide Label:
isoform X5
RefSeq Acc Id:
XP_036017189 ⟸ XM_036161296
- Peptide Label:
isoform X4
- UniProtKB:
A0A3Q4EGD8 (UniProtKB/TrEMBL)
RGD ID: 13677302 Promoter ID: EPDNEW_M22800 Type: initiation region Name: Wdr33_1 Description: Mus musculus WD repeat domain 33 , transcript variant 1, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M22801 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 18 31,804,098 - 31,804,158 EPDNEW
RGD ID: 13677306 Promoter ID: EPDNEW_M22801 Type: multiple initiation site Name: Wdr33_2 Description: Mus musculus WD repeat domain 33 , transcript variant 1, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M22800 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 18 31,809,235 - 31,809,295 EPDNEW
