Symbol:
Guca1a
Name:
guanylate cyclase activator 1A
RGD ID:
1308712
Description:
Predicted to enable calcium ion binding activity and calcium sensitive guanylate cyclase activator activity. Involved in positive regulation of cGMP-mediated signaling and positive regulation of guanylate cyclase activity. Located in photoreceptor inner segment and photoreceptor outer segment. Human ortholog(s) of this gene implicated in cone-rod dystrophy 14. Orthologous to several human genes including GUCA1ANB-GUCA1A (GUCA1ANB-GUCA1A readthrough); PARTICIPATES IN calcium/calcium-mediated signaling pathway; visual phototransduction pathway; INTERACTS WITH amitrole; bisphenol A; clotrimazole.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
guanylate cyclase activator 1a (retina); guanylyl cyclase-activating protein 1; LOC301233
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 9 21,080,782 - 21,096,221 (+) NCBI GRCr8 mRatBN7.2 9 13,588,988 - 13,598,566 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 9 13,588,525 - 13,598,565 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 9 22,168,815 - 22,178,406 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 9 27,232,681 - 27,242,268 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 9 25,532,230 - 25,541,815 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 9 15,609,804 - 15,620,030 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 9 15,609,804 - 15,620,029 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 9 14,530,794 - 14,541,020 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 9 9,046,617 - 9,056,984 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 9 9,044,401 - 9,054,301 (+) NCBI Celera 9 11,338,757 - 11,349,075 (+) NCBI Celera Cytogenetic Map 9 q12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Guca1a Rat (S)-nicotine decreases expression ISO GUCA1A (Homo sapiens) 6480464 Nicotine results in decreased expression of GUCA1A mRNA CTD PMID:16949557 Guca1a Rat 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene multiple interactions ISO Guca1a (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Guca1a Rat 17beta-estradiol decreases expression ISO Guca1a (Mus musculus) 6480464 Estradiol results in decreased expression of GUCA1A mRNA CTD PMID:39298647 Guca1a Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Guca1a (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Guca1a Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Guca1a (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Guca1a Rat 2,4,4'-trichlorobiphenyl multiple interactions ISO Guca1a (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Guca1a Rat 4,4'-sulfonyldiphenol decreases expression ISO Guca1a (Mus musculus) 6480464 bisphenol S results in decreased expression of GUCA1A mRNA CTD PMID:39298647 Guca1a Rat 4,4'-sulfonyldiphenol increases methylation ISO GUCA1A (Homo sapiens) 6480464 bisphenol S results in increased methylation of GUCA1A gene CTD PMID:31601247 Guca1a Rat acrylamide decreases expression ISO GUCA1A (Homo sapiens) 6480464 Acrylamide results in decreased expression of GUCA1A mRNA CTD PMID:32763439 Guca1a Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of GUCA1A mRNA CTD PMID:30047161 Guca1a Rat aristolochic acid A increases expression ISO GUCA1A (Homo sapiens) 6480464 aristolochic acid I results in increased expression of GUCA1A mRNA CTD PMID:33212167 Guca1a Rat Azoxymethane multiple interactions ISO Guca1a (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of GUCA1A mRNA CTD PMID:29950665 Guca1a Rat benzo[a]pyrene affects methylation ISO GUCA1A (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of GUCA1A promoter CTD PMID:27901495 Guca1a Rat benzo[a]pyrene multiple interactions ISO Guca1a (Mus musculus) 6480464 AHR protein affects the reaction [Benzo(a)pyrene affects the expression of GUCA1A mRNA] CTD PMID:22228805 Guca1a Rat benzo[a]pyrene increases methylation ISO GUCA1A (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of GUCA1A 3' UTR and Benzo(a)pyrene results in increased methylation of GUCA1A 5' UTR CTD PMID:27901495 Guca1a Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of GUCA1A mRNA CTD PMID:25181051 more ... Guca1a Rat bisphenol A increases expression ISO Guca1a (Mus musculus) 6480464 bisphenol A results in increased expression of GUCA1A mRNA CTD PMID:32156529 Guca1a Rat bisphenol F decreases expression ISO Guca1a (Mus musculus) 6480464 bisphenol F results in decreased expression of GUCA1A mRNA CTD PMID:38685157 Guca1a Rat carbamazepine affects expression ISO GUCA1A (Homo sapiens) 6480464 Carbamazepine affects the expression of GUCA1A mRNA CTD PMID:25979313 Guca1a Rat chlordecone increases expression ISO Guca1a (Mus musculus) 6480464 Chlordecone results in increased expression of GUCA1A mRNA CTD PMID:33711761 Guca1a Rat chlorpyrifos increases expression ISO Guca1a (Mus musculus) 6480464 Chlorpyrifos results in increased expression of GUCA1A mRNA CTD PMID:37019170 Guca1a Rat clofibrate decreases expression ISO Guca1a (Mus musculus) 6480464 Clofibrate results in decreased expression of GUCA1A mRNA CTD PMID:17585979 Guca1a Rat clotrimazole increases expression EXP 6480464 Clotrimazole results in increased expression of GUCA1A mRNA CTD PMID:30047161 Guca1a Rat deoxycholic acid decreases response to substance ISO GUCA1A (Homo sapiens) 6480464 GUCA1A protein results in decreased susceptibility to Deoxycholic Acid CTD PMID:12507930 Guca1a Rat dexamethasone multiple interactions EXP 6480464 Testosterone inhibits the reaction [Dexamethasone results in decreased expression of GUCA1A mRNA] CTD PMID:20032058 Guca1a Rat dexamethasone decreases expression EXP 6480464 Dexamethasone results in decreased expression of GUCA1A mRNA CTD PMID:20032058 Guca1a Rat dextran sulfate multiple interactions ISO Guca1a (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of GUCA1A mRNA CTD PMID:29950665 Guca1a Rat dorsomorphin multiple interactions ISO GUCA1A (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Guca1a Rat entinostat increases expression ISO GUCA1A (Homo sapiens) 6480464 entinostat results in increased expression of GUCA1A mRNA CTD PMID:27188386 Guca1a Rat ethylparaben decreases expression ISO GUCA1A (Homo sapiens) 6480464 ethyl-p-hydroxybenzoate results in decreased expression of GUCA1A mRNA CTD PMID:37690743 Guca1a Rat glyphosate increases methylation EXP 6480464 Glyphosate results in increased methylation of GUCA1A gene CTD PMID:31011160 Guca1a Rat lead diacetate decreases expression EXP 6480464 lead acetate results in decreased expression of GUCA1A mRNA CTD PMID:22641619 Guca1a Rat mercury dibromide decreases expression ISO GUCA1A (Homo sapiens) 6480464 mercuric bromide results in decreased expression of GUCA1A mRNA CTD PMID:26272509 Guca1a Rat mercury dibromide multiple interactions ISO GUCA1A (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of GUCA1A mRNA CTD PMID:27188386 Guca1a Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of GUCA1A mRNA CTD PMID:30047161 Guca1a Rat methylmercury chloride decreases expression ISO GUCA1A (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of GUCA1A mRNA CTD PMID:23179753 more ... Guca1a Rat monosodium L-glutamate decreases expression ISO Guca1a (Mus musculus) 6480464 Sodium Glutamate results in decreased expression of GUCA1A mRNA CTD PMID:22078008 Guca1a Rat nicotine decreases expression ISO GUCA1A (Homo sapiens) 6480464 Nicotine results in decreased expression of GUCA1A mRNA CTD PMID:16949557 Guca1a Rat paracetamol decreases expression ISO GUCA1A (Homo sapiens) 6480464 Acetaminophen results in decreased expression of GUCA1A mRNA CTD PMID:22230336 Guca1a Rat paracetamol affects expression ISO Guca1a (Mus musculus) 6480464 Acetaminophen affects the expression of GUCA1A mRNA CTD PMID:17562736 Guca1a Rat PCB138 multiple interactions ISO Guca1a (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Guca1a Rat phenobarbital affects expression ISO Guca1a (Mus musculus) 6480464 Phenobarbital affects the expression of GUCA1A mRNA CTD PMID:19136022 Guca1a Rat phenylmercury acetate decreases expression ISO GUCA1A (Homo sapiens) 6480464 Phenylmercuric Acetate results in decreased expression of GUCA1A mRNA CTD PMID:26272509 Guca1a Rat phenylmercury acetate multiple interactions ISO GUCA1A (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of GUCA1A mRNA CTD PMID:27188386 Guca1a Rat pirinixic acid decreases expression ISO Guca1a (Mus musculus) 6480464 pirinixic acid results in decreased expression of GUCA1A mRNA CTD PMID:17950772 Guca1a Rat pirinixic acid multiple interactions ISO Guca1a (Mus musculus) 6480464 NCF1 protein promotes the reaction [pirinixic acid results in decreased expression of GUCA1A mRNA] and PPARA protein promotes the reaction [pirinixic acid results in decreased expression of GUCA1A mRNA] CTD PMID:17950772 Guca1a Rat pirinixic acid affects expression ISO Guca1a (Mus musculus) 6480464 pirinixic acid affects the expression of GUCA1A mRNA CTD PMID:19136022 Guca1a Rat SB 431542 multiple interactions ISO GUCA1A (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Guca1a Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of GUCA1A mRNA CTD PMID:30047161 Guca1a Rat testosterone multiple interactions EXP 6480464 Testosterone inhibits the reaction [Dexamethasone results in decreased expression of GUCA1A mRNA] CTD PMID:20032058 Guca1a Rat thimerosal decreases expression ISO GUCA1A (Homo sapiens) 6480464 Thimerosal results in decreased expression of GUCA1A mRNA CTD PMID:27188386 Guca1a Rat titanium dioxide increases expression ISO Guca1a (Mus musculus) 6480464 titanium dioxide results in increased expression of GUCA1A mRNA CTD PMID:35295148 Guca1a Rat titanium dioxide multiple interactions ISO Guca1a (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of GUCA1A mRNA CTD PMID:29950665 Guca1a Rat triadimefon decreases expression ISO GUCA1A (Homo sapiens) 6480464 triadimefon results in decreased expression of GUCA1A mRNA CTD PMID:26705709 Guca1a Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of GUCA1A mRNA CTD PMID:33387578 Guca1a Rat trichostatin A decreases expression ISO GUCA1A (Homo sapiens) 6480464 trichostatin A results in decreased expression of GUCA1A mRNA CTD PMID:24935251 Guca1a Rat trichostatin A increases expression ISO GUCA1A (Homo sapiens) 6480464 trichostatin A results in increased expression of GUCA1A mRNA CTD PMID:26272509 Guca1a Rat triptonide increases expression ISO Guca1a (Mus musculus) 6480464 triptonide results in increased expression of GUCA1A mRNA CTD PMID:33045310 Guca1a Rat valproic acid decreases expression ISO GUCA1A (Homo sapiens) 6480464 Valproic Acid results in decreased expression of GUCA1A mRNA CTD PMID:24935251 Guca1a Rat valproic acid increases expression ISO Guca1a (Mus musculus) 6480464 Valproic Acid results in increased expression of GUCA1A mRNA CTD PMID:21427059 Guca1a Rat valproic acid increases expression ISO GUCA1A (Homo sapiens) 6480464 Valproic Acid results in increased expression of GUCA1A mRNA CTD PMID:23179753 and PMID:27188386 Guca1a Rat valproic acid affects expression ISO GUCA1A (Homo sapiens) 6480464 Valproic Acid affects the expression of GUCA1A mRNA CTD PMID:25979313 Guca1a Rat valproic acid decreases methylation ISO GUCA1A (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of GUCA1A gene CTD PMID:29154799 Guca1a Rat vorinostat increases expression ISO GUCA1A (Homo sapiens) 6480464 Vorinostat results in increased expression of GUCA1A mRNA CTD PMID:26272509 Guca1a Rat vorinostat multiple interactions ISO GUCA1A (Homo sapiens) 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of GUCA1A mRNA CTD PMID:27188386
Imported Annotations - KEGG (archival)
(S)-nicotine (ISO) 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO) 17beta-estradiol (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,4,4'-trichlorobiphenyl (ISO) 4,4'-sulfonyldiphenol (ISO) acrylamide (ISO) amitrole (EXP) aristolochic acid A (ISO) Azoxymethane (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) carbamazepine (ISO) chlordecone (ISO) chlorpyrifos (ISO) clofibrate (ISO) clotrimazole (EXP) deoxycholic acid (ISO) dexamethasone (EXP) dextran sulfate (ISO) dorsomorphin (ISO) entinostat (ISO) ethylparaben (ISO) glyphosate (EXP) lead diacetate (EXP) mercury dibromide (ISO) methimazole (EXP) methylmercury chloride (ISO) monosodium L-glutamate (ISO) nicotine (ISO) paracetamol (ISO) PCB138 (ISO) phenobarbital (ISO) phenylmercury acetate (ISO) pirinixic acid (ISO) SB 431542 (ISO) sulfadimethoxine (EXP) testosterone (EXP) thimerosal (ISO) titanium dioxide (ISO) triadimefon (ISO) trichloroethene (EXP) trichostatin A (ISO) triptonide (ISO) valproic acid (ISO) vorinostat (ISO)
1.
Photoreceptor signaling: supporting vision across a wide range of light intensities.
Arshavsky VY and Burns ME, J Biol Chem. 2012 Jan 13;287(3):1620-6. Epub 2011 Nov 10.
2.
The localization of guanylyl cyclase-activating proteins in the mammalian retina.
Cuenca N, etal., Invest Ophthalmol Vis Sci. 1998 Jun;39(7):1243-50.
3.
p19 detected in the rat retina and pineal gland is a guanylyl cyclase-activating protein (GCAP).
Dejda A, etal., Acta Biochim Pol. 2002;49(4):899-905.
4.
Negatively calcium-modulated membrane guanylate cyclase signaling system in the rat olfactory bulb.
Duda T, etal., Biochemistry. 2001 Apr 17;40(15):4654-62.
5.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
7.
The diversity of calcium sensor proteins in the regulation of neuronal function.
McCue HV, etal., Cold Spring Harb Perspect Biol. 2010 Aug;2(8):a004085. doi: 10.1101/cshperspect.a004085. Epub 2010 Jul 28.
8.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
9.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
10.
A mutation in guanylate cyclase activator 1A (GUCA1A) in an autosomal dominant cone dystrophy pedigree mapping to a new locus on chromosome 6p21.1.
Payne AM, etal., Hum Mol Genet. 1998 Feb;7(2):273-7.
11.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
12.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
13.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
Guca1a Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 9 21,080,782 - 21,096,221 (+) NCBI GRCr8 mRatBN7.2 9 13,588,988 - 13,598,566 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 9 13,588,525 - 13,598,565 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 9 22,168,815 - 22,178,406 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 9 27,232,681 - 27,242,268 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 9 25,532,230 - 25,541,815 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 9 15,609,804 - 15,620,030 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 9 15,609,804 - 15,620,029 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 9 14,530,794 - 14,541,020 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 9 9,046,617 - 9,056,984 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 9 9,044,401 - 9,054,301 (+) NCBI Celera 9 11,338,757 - 11,349,075 (+) NCBI Celera Cytogenetic Map 9 q12 NCBI
GUCA1A Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 42,173,364 - 42,180,056 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 42,173,364 - 42,181,338 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 42,141,102 - 42,147,794 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Cytogenetic Map 6 p21.1 NCBI HuRef 6 41,841,195 - 41,865,841 (+) NCBI HuRef CHM1_1 6 42,125,607 - 42,150,271 (+) NCBI CHM1_1 T2T-CHM13v2.0 6 42,001,569 - 42,008,260 (+) NCBI T2T-CHM13v2.0
Guca1a Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 17 47,705,482 - 47,724,439 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 17 47,705,483 - 47,711,509 (-) Ensembl GRCm39 Ensembl GRCm38 17 47,394,557 - 47,413,514 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 17 47,394,558 - 47,400,584 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 17 47,531,507 - 47,537,533 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 17 46,857,749 - 46,863,775 (-) NCBI MGSCv36 mm8 Celera 17 50,829,365 - 50,835,380 (-) NCBI Celera Cytogenetic Map 17 C NCBI cM Map 17 23.07 NCBI
Guca1a Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955437 8,376,091 - 8,382,640 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955437 8,370,553 - 8,382,640 (+) NCBI ChiLan1.0 ChiLan1.0
GUCA1A Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 56,669,264 - 56,676,039 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 52,539,219 - 52,545,995 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 41,693,593 - 41,774,591 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 43,045,278 - 43,069,312 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 6 43,045,307 - 43,070,520 (+) Ensembl panpan1.1 panPan2
Guca1a Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404946 46,258,921 - 46,269,718 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936476 17,691,045 - 17,701,859 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936476 17,690,484 - 17,701,288 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
GUCA1A Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 37,282,700 - 37,296,717 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 37,282,630 - 37,296,713 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 42,752,943 - 42,760,474 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
GUCA1A Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 17 29,972,216 - 29,984,653 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 17 29,972,862 - 29,977,487 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666044 42,195,158 - 42,201,833 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Guca1a
.
Predicted Target Of
Count of predictions: 292 Count of miRNA genes: 128 Interacting mature miRNAs: 133 Transcripts: ENSRNOT00000020902, ENSRNOT00000065904 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
631211 Bw4 Body weight QTL4 5.31 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 9 5109826 50109826 Rat 10054141 Gmadr4 Adrenal mass QTL 4 2.45 0.0074 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 9 1 14209783 Rat 2303559 Gluco54 Glucose level QTL 54 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 9 1254084 46254084 Rat 7411609 Foco16 Food consumption QTL 16 25.6 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 9 8952560 53952560 Rat 61450 Ciaa3 CIA Autoantibody QTL 3 6.5 blood autoantibody amount (VT:0003725) calculated serum anti-type 2 collagen antibody titer (CMO:0001279) 9 7954720 22071169 Rat 9589055 Scfw5 Subcutaneous fat weight QTL 5 5.55 0.001 subcutaneous adipose mass (VT:1000472) abdominal subcutaneous fat pad weight (CMO:0002069) 9 1 37999212 Rat 1641911 Alcrsp13 Alcohol response QTL 13 response to alcohol trait (VT:0010489) brain neurotensin receptor 1 density (CMO:0002068) 9 1 43718459 Rat 1354650 Despr5 Despair related QTL 5 4.01 0.0017 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 9 1254084 46254084 Rat 1300124 Cm4 Cardiac mass QTL 4 3.55 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 9 1 40594091 Rat 61425 Cia15 Collagen induced arthritis QTL 15 4.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 9 5109826 42921101 Rat 70226 Eae4 Experimental allergic encephalomyelitis QTL 4 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 9 1 25661317 Rat 9589158 Gluco65 Glucose level QTL 65 6.82 0.001 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 9 1 37999212 Rat 10054125 Srcrt7 Stress Responsive Cort QTL 7 3.33 0.0011 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 9 1 87073594 Rat 1600365 Mcs20 Mammary carcinoma susceptibility QTL 20 3 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 9 13533770 42791750 Rat 11353947 Bp392 Blood pressure QTL 392 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 7283252 52283252 Rat 7411592 Foco8 Food consumption QTL 8 7.4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 9 1 37999212 Rat 1331757 Cdexp1 CD45RC expression in CD8 T cells QTL 1 4.3 CD8-positive T cell quantity (VT:0008077) blood CD45RC(high) CD8 T cell count to CD45RC(low) CD8 T cell count ratio (CMO:0001990) 9 1024537 67509080 Rat 1298088 Edpm11 Estrogen-dependent pituitary mass QTL 11 2.5 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 9 1 43718459 Rat 9589133 Insul26 Insulin level QTL 26 17.96 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 9 8952560 53952560 Rat
RH135391
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 9 21,095,965 - 21,096,182 (+) Marker Load Pipeline mRatBN7.2 9 13,598,310 - 13,598,527 (+) MAPPER mRatBN7.2 Rnor_6.0 9 15,619,775 - 15,619,991 NCBI Rnor6.0 Rnor_5.0 9 14,540,765 - 14,540,981 UniSTS Rnor5.0 RGSC_v3.4 9 9,056,730 - 9,056,946 UniSTS RGSC3.4 Celera 9 11,348,821 - 11,349,037 UniSTS RH 3.4 Map 9 60.2 UniSTS Cytogenetic Map 9 q12 UniSTS
RH138598
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 9 13,594,428 - 13,594,558 (+) MAPPER mRatBN7.2 Rnor_6.0 9 15,615,893 - 15,616,022 NCBI Rnor6.0 Rnor_5.0 9 14,536,883 - 14,537,012 UniSTS Rnor5.0 RGSC_v3.4 9 9,052,848 - 9,052,977 UniSTS RGSC3.4 Celera 9 11,344,939 - 11,345,068 UniSTS RH 3.4 Map 9 45.4 UniSTS Cytogenetic Map 9 q12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
1
10
83
44
40
28
10
28
6
84
32
71
14
42
12
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000020902 ⟹ ENSRNOP00000020902
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 9 13,588,525 - 13,598,565 (+) Ensembl Rnor_6.0 Ensembl 9 15,609,804 - 15,620,029 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000065904 ⟹ ENSRNOP00000062988
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 9 15,610,438 - 15,619,811 (+) Ensembl
RefSeq Acc Id:
NM_001106887 ⟹ NP_001100357
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 21,086,642 - 21,096,221 (+) NCBI mRatBN7.2 9 13,588,988 - 13,598,566 (+) NCBI Rnor_6.0 9 15,609,804 - 15,620,029 (+) NCBI Rnor_5.0 9 14,530,794 - 14,541,020 (+) NCBI RGSC_v3.4 9 9,046,617 - 9,056,984 (+) RGD Celera 9 11,338,757 - 11,349,075 (+) RGD
Sequence:
GAGGGAATGCTTCCATCCGGGAGAAATGGAATATACTGTTCGGGGTTCCTTCCAGCTCCTGGGGACATGTCTTAGAAGTCCCTAAAGGCTGAACTTGCACAGTTCTCATGTGACTGAAGCCCTCAGTG
hide sequence
RefSeq Acc Id:
XM_039083176 ⟹ XP_038939104
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 21,093,479 - 21,096,215 (+) NCBI mRatBN7.2 9 13,595,800 - 13,598,566 (+) NCBI
RefSeq Acc Id:
XR_010054578
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 21,080,782 - 21,096,095 (+) NCBI
RefSeq Acc Id:
NP_001100357 ⟸ NM_001106887
- UniProtKB:
D3ZII9 (UniProtKB/TrEMBL), A6JIK4 (UniProtKB/TrEMBL)
- Sequence:
MGNVVEGKSVEELSSTECHQWYKKFMTECPSGQLTLYEFRQFFGLKNLSPSASQYVEQMFETFDFNKDGYIDFMEYVAALSLVLKGKVEQKLRWYFKLYDVDGNGCIDRDELLTIIRAIRTINPWSDS
hide sequence
Ensembl Acc Id:
ENSRNOP00000062988 ⟸ ENSRNOT00000065904
Ensembl Acc Id:
ENSRNOP00000020902 ⟸ ENSRNOT00000020902
RefSeq Acc Id:
XP_038939104 ⟸ XM_039083176
- Peptide Label:
isoform X1
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-11-25
Guca1a
guanylate cyclase activator 1A
Guca1a
guanylate cyclase activator 1a (retina)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Guca1a
guanylate cyclase activator 1a (retina)
Guca1a_predicted
guanylate cyclase activator 1a (retina) (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Guca1a_predicted
guanylate cyclase activator 1a (retina) (predicted)
Symbol and Name status set to approved
70820 APPROVED
