Symbol:
Grap2
Name:
GRB2-related adaptor protein 2
RGD ID:
1307605
Description:
Predicted to enable phosphotyrosine residue binding activity. Predicted to be involved in regulation of MAPK cascade and signal transduction. Predicted to be located in cytosol; endosome; and nucleus. Predicted to be active in cytoplasm; nucleoplasm; and plasma membrane. Human ortholog(s) of this gene implicated in hepatitis C. Orthologous to human GRAP2 (GRB2 related adaptor protein 2); PARTICIPATES IN T cell receptor signaling pathway; INTERACTS WITH 1-naphthyl isothiocyanate; alpha-Zearalanol; bisphenol A.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
GRB2-related adapter protein 2; LOC366962; MGC125066
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 113,997,356 - 114,071,073 (+) NCBI GRCr8 mRatBN7.2 7 112,117,142 - 112,190,880 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 112,117,142 - 112,190,877 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 113,872,662 - 113,946,895 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 116,096,186 - 116,170,437 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 116,065,563 - 116,139,810 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 121,791,330 - 121,864,835 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 121,841,855 - 121,864,679 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 121,781,461 - 121,854,021 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 118,856,130 - 118,931,148 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 118,882,484 - 118,965,381 (+) NCBI Celera 7 108,442,874 - 108,515,048 (+) NCBI Celera Cytogenetic Map 7 q34 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Grap2 Rat (-)-demecolcine decreases expression ISO RGD:1316895 6480464 Demecolcine results in decreased expression of GRAP2 mRNA CTD PMID:23649840 Grap2 Rat 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene multiple interactions ISO RGD:1552736 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Grap2 Rat 1-chloro-2,4-dinitrobenzene increases expression ISO RGD:1552736 6480464 Dinitrochlorobenzene results in increased expression of GRAP2 mRNA CTD PMID:21404309 Grap2 Rat 1-naphthyl isothiocyanate decreases expression EXP 6480464 1-Naphthylisothiocyanate results in decreased expression of GRAP2 mRNA CTD PMID:30723492 Grap2 Rat 17beta-estradiol multiple interactions ISO RGD:1316895 6480464 [Estradiol co-treated with TGFB1 protein] results in increased expression of GRAP2 mRNA CTD PMID:30165855 Grap2 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO RGD:1552736 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Grap2 Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO RGD:1552736 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Grap2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1552736 6480464 Tetrachlorodibenzodioxin affects the expression of GRAP2 mRNA CTD PMID:21570461|PMID:24680724 Grap2 Rat 2,4,4'-trichlorobiphenyl multiple interactions ISO RGD:1552736 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Grap2 Rat 4,4'-sulfonyldiphenol affects expression ISO RGD:1552736 6480464 bisphenol S affects the expression of GRAP2 mRNA CTD PMID:30951980 Grap2 Rat 4-(ethoxymethylene)-2-phenyloxazol-5-one increases expression ISO RGD:1552736 6480464 Oxazolone results in increased expression of GRAP2 mRNA CTD PMID:21404309 Grap2 Rat aflatoxin B1 increases methylation ISO RGD:1316895 6480464 Aflatoxin B1 results in increased methylation of GRAP2 intron CTD PMID:30157460 Grap2 Rat Aflatoxin B2 alpha increases methylation ISO RGD:1316895 6480464 aflatoxin B2 results in increased methylation of GRAP2 intron CTD PMID:30157460 Grap2 Rat aldehydo-D-glucose multiple interactions ISO RGD:1552736 6480464 [lard co-treated with Cholesterol, Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose more ... CTD PMID:37567420 Grap2 Rat alpha-Zearalanol increases expression EXP 6480464 Zeranol results in increased expression of GRAP2 mRNA CTD PMID:35163327 Grap2 Rat benzo[a]pyrene affects methylation ISO RGD:1316895 6480464 Benzo(a)pyrene affects the methylation of GRAP2 intron CTD PMID:30157460 Grap2 Rat benzo[e]pyrene increases methylation ISO RGD:1316895 6480464 benzo(e)pyrene results in increased methylation of GRAP2 intron CTD PMID:30157460 Grap2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of GRAP2 mRNA CTD PMID:25181051|PMID:30816183|PMID:32528016 Grap2 Rat bisphenol A increases expression ISO RGD:1552736 6480464 bisphenol A results in increased expression of GRAP2 mRNA CTD PMID:38701888 Grap2 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of GRAP2 mRNA CTD PMID:32145629 Grap2 Rat buta-1,3-diene decreases expression ISO RGD:1552736 6480464 1,3-butadiene results in decreased expression of GRAP2 mRNA CTD PMID:29038090 Grap2 Rat CGP 52608 multiple interactions ISO RGD:1316895 6480464 CGP 52608 promotes the reaction [RORA protein binds to GRAP2 gene] CTD PMID:28238834 Grap2 Rat clofibrate increases expression ISO RGD:1552736 6480464 Clofibrate results in increased expression of GRAP2 mRNA CTD PMID:17585979 Grap2 Rat crocidolite asbestos affects expression ISO RGD:1316895 6480464 Asbestos, Crocidolite affects the expression of GRAP2 mRNA CTD PMID:17331233 Grap2 Rat crocidolite asbestos decreases expression ISO RGD:1552736 6480464 Asbestos, Crocidolite results in decreased expression of GRAP2 mRNA CTD PMID:29279043 Grap2 Rat D-glucose multiple interactions ISO RGD:1552736 6480464 [lard co-treated with Cholesterol, Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose more ... CTD PMID:37567420 Grap2 Rat DDE increases expression ISO RGD:1316895 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of GRAP2 mRNA CTD PMID:38568856 Grap2 Rat dexamethasone increases expression ISO RGD:1316895 6480464 Dexamethasone results in increased expression of GRAP2 mRNA CTD PMID:12782123 Grap2 Rat Dibutyl phosphate affects expression ISO RGD:1316895 6480464 di-n-butylphosphoric acid affects the expression of GRAP2 mRNA CTD PMID:37042841 Grap2 Rat dioxygen decreases expression ISO RGD:1552736 6480464 Oxygen deficiency results in decreased expression of GRAP2 mRNA CTD PMID:24205000 Grap2 Rat diuron decreases expression ISO RGD:1316895 6480464 Diuron results in decreased expression of GRAP2 mRNA CTD PMID:35967413 Grap2 Rat ethyl methanesulfonate decreases expression ISO RGD:1316895 6480464 Ethyl Methanesulfonate results in decreased expression of GRAP2 mRNA CTD PMID:23649840 Grap2 Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of GRAP2 mRNA CTD PMID:30307764 Grap2 Rat formaldehyde decreases expression ISO RGD:1316895 6480464 Formaldehyde results in decreased expression of GRAP2 mRNA CTD PMID:23649840 Grap2 Rat fructose multiple interactions ISO RGD:1552736 6480464 [lard co-treated with Cholesterol, Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose more ... CTD PMID:37567420 Grap2 Rat furan decreases methylation EXP 6480464 furan results in decreased methylation of GRAP2 gene; furan results in decreased methylation of GRAP2 more ... CTD PMID:22079235 Grap2 Rat glucose multiple interactions ISO RGD:1552736 6480464 [lard co-treated with Cholesterol, Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose more ... CTD PMID:37567420 Grap2 Rat glyphosate multiple interactions ISO RGD:1552736 6480464 [lard co-treated with Cholesterol, Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose more ... CTD PMID:37567420 Grap2 Rat Lasiocarpine increases expression ISO RGD:1316895 6480464 lasiocarpine results in increased expression of GRAP2 mRNA CTD PMID:32234424 Grap2 Rat lipopolysaccharide multiple interactions ISO RGD:1316895 6480464 [S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of GRAP2 mRNA; [S-(1,2-dichlorovinyl)cysteine more ... CTD PMID:35811015 Grap2 Rat lipopolysaccharide decreases expression ISO RGD:1316895 6480464 Lipopolysaccharides results in decreased expression of GRAP2 mRNA CTD PMID:35811015 Grap2 Rat methapyrilene increases methylation ISO RGD:1316895 6480464 Methapyrilene results in increased methylation of GRAP2 intron CTD PMID:30157460 Grap2 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of GRAP2 gene CTD PMID:35440735 Grap2 Rat methyl methanesulfonate decreases expression ISO RGD:1316895 6480464 Methyl Methanesulfonate results in decreased expression of GRAP2 mRNA CTD PMID:23649840 Grap2 Rat nitrates multiple interactions ISO RGD:1552736 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of GRAP2 more ... CTD PMID:35964746 Grap2 Rat ozone multiple interactions ISO RGD:1552736 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased more ... CTD PMID:34911549 Grap2 Rat PCB138 multiple interactions ISO RGD:1552736 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Grap2 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO RGD:1316895 6480464 [S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of GRAP2 mRNA; [S-(1,2-dichlorovinyl)cysteine more ... CTD PMID:35811015 Grap2 Rat silicon dioxide increases expression ISO RGD:1552736 6480464 Silicon Dioxide results in increased expression of GRAP2 mRNA CTD PMID:29341224 Grap2 Rat sodium arsenite increases expression ISO RGD:1316895 6480464 sodium arsenite results in increased expression of GRAP2 mRNA CTD PMID:38568856 Grap2 Rat toluene 2,4-diisocyanate increases expression ISO RGD:1552736 6480464 Toluene 2,4-Diisocyanate results in increased expression of GRAP2 mRNA CTD PMID:21404309 Grap2 Rat Tributyltin oxide decreases phosphorylation ISO RGD:1552736 6480464 bis(tri-n-butyltin)oxide results in decreased phosphorylation of GRAP2 protein CTD PMID:22174045 Grap2 Rat triclosan decreases expression ISO RGD:1316895 6480464 Triclosan results in decreased expression of GRAP2 mRNA CTD PMID:30510588 Grap2 Rat triphenyl phosphate affects expression ISO RGD:1316895 6480464 triphenyl phosphate affects the expression of GRAP2 mRNA CTD PMID:37042841 Grap2 Rat tungsten decreases expression ISO RGD:1552736 6480464 Tungsten results in decreased expression of GRAP2 mRNA CTD PMID:30912803 Grap2 Rat valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of GRAP2 mRNA CTD PMID:35594946 Grap2 Rat vincristine decreases expression ISO RGD:1316895 6480464 Vincristine results in decreased expression of GRAP2 mRNA CTD PMID:23649840
Molecular Function
Only show annotations with direct experimental evidence (0 objects hidden)
Grap2 Rat phosphotyrosine residue binding enables IBA FB:FBgn0004638|PANTHER:PTN005273574|RGD:619758|UniProtKB:P62993 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Grap2 Rat protein binding enables ISO RGD:1316895 1624291 UniProtKB:O14672|UniProtKB:O43597|UniProtKB:O95630|UniProtKB:P00533|UniProtKB:P00540|UniProtKB:P04626|UniProtKB:P0CG20|UniProtKB:P10721|UniProtKB:P15622-3|UniProtKB:P30039|UniProtKB:P54646|UniProtKB:Q08460|UniProtKB:Q13094|UniProtKB:Q13480|UniProtKB:Q5T749|UniProtKB:Q7Z783|UniProtKB:Q8IWV1|UniProtKB:Q8IY67|UniProtKB:Q8TBB1|UniProtKB:Q9H3S7|UniProtKB:Q9H706|UniProtKB:Q9H788|UniProtKB:Q9P2F9|UniProtKB:Q9UQC2|UniProtKB:Q9Y5A6 PMID:12359715, PMID:15929943, PMID:16189514, PMID:16273093, PMID:16730941, PMID:17010654, PMID:17065230, PMID:17235283, PMID:20534575, PMID:21179510, PMID:21516116, PMID:24658140, PMID:24728074, more ... RGD PMID:12359715|PMID:15929943|PMID:16189514|PMID:16273093|PMID:16730941|PMID:17010654|PMID:17065230|PMID:17235283|PMID:20534575|PMID:21179510|PMID:21516116|PMID:24658140|PMID:24728074|PMID:25036101|PMID:25241761|PMID:25416956|PMID:25814554|PMID:27107012|PMID:28514442|PMID:29997244|PMID:31467278|PMID:31515488|PMID:31980649|PMID:32296183|PMID:32814053|PMID:33961781|PMID:37398436 Grap2 Rat protein binding enables ISO RGD:1552736 1624291 PR:P70218|UniProtKB:Q13094|UniProtKB:Q60787|UniProtKB:Q6PB44|UniProtKB:Q9H3S7 PMID:15100220, PMID:16511262, PMID:17010654, PMID:19523899, PMID:24584089 RGD PMID:15100220|PMID:16511262|PMID:17010654|PMID:19523899|PMID:24584089
Imported Annotations - KEGG (archival)
(-)-demecolcine (ISO) 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO) 1-chloro-2,4-dinitrobenzene (ISO) 1-naphthyl isothiocyanate (EXP) 17beta-estradiol (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4,4'-trichlorobiphenyl (ISO) 4,4'-sulfonyldiphenol (ISO) 4-(ethoxymethylene)-2-phenyloxazol-5-one (ISO) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) aldehydo-D-glucose (ISO) alpha-Zearalanol (EXP) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) bisphenol A (EXP,ISO) buta-1,3-diene (ISO) CGP 52608 (ISO) clofibrate (ISO) crocidolite asbestos (ISO) D-glucose (ISO) DDE (ISO) dexamethasone (ISO) Dibutyl phosphate (ISO) dioxygen (ISO) diuron (ISO) ethyl methanesulfonate (ISO) fenvalerate (EXP) formaldehyde (ISO) fructose (ISO) furan (EXP) glucose (ISO) glyphosate (ISO) Lasiocarpine (ISO) lipopolysaccharide (ISO) methapyrilene (ISO) methoxychlor (EXP) methyl methanesulfonate (ISO) nitrates (ISO) ozone (ISO) PCB138 (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) silicon dioxide (ISO) sodium arsenite (ISO) toluene 2,4-diisocyanate (ISO) Tributyltin oxide (ISO) triclosan (ISO) triphenyl phosphate (ISO) tungsten (ISO) valproic acid (EXP) vincristine (ISO)
Grap2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 113,997,356 - 114,071,073 (+) NCBI GRCr8 mRatBN7.2 7 112,117,142 - 112,190,880 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 112,117,142 - 112,190,877 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 113,872,662 - 113,946,895 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 116,096,186 - 116,170,437 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 116,065,563 - 116,139,810 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 121,791,330 - 121,864,835 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 121,841,855 - 121,864,679 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 121,781,461 - 121,854,021 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 118,856,130 - 118,931,148 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 118,882,484 - 118,965,381 (+) NCBI Celera 7 108,442,874 - 108,515,048 (+) NCBI Celera Cytogenetic Map 7 q34 NCBI
GRAP2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 22 39,893,820 - 39,973,721 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 22 39,901,084 - 39,973,721 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 22 40,297,088 - 40,369,725 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 22 38,627,032 - 38,697,330 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 22 38,621,585 - 38,691,884 NCBI Celera 22 24,099,151 - 24,169,444 (+) NCBI Celera Cytogenetic Map 22 q13.1 NCBI HuRef 22 23,260,094 - 23,330,327 (+) NCBI HuRef CHM1_1 22 40,256,126 - 40,326,591 (+) NCBI CHM1_1 T2T-CHM13v2.0 22 40,364,806 - 40,444,710 (+) NCBI T2T-CHM13v2.0
Grap2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 15 80,456,798 - 80,537,055 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 15 80,456,795 - 80,537,055 (+) Ensembl GRCm39 Ensembl GRCm38 15 80,572,597 - 80,652,854 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 15 80,572,594 - 80,652,854 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 15 80,453,913 - 80,480,728 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 15 80,450,738 - 80,477,553 (+) NCBI MGSCv36 mm8 Celera 15 82,743,068 - 82,770,161 (+) NCBI Celera Cytogenetic Map 15 E1 NCBI cM Map 15 37.88 NCBI
Grap2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955413 25,691,439 - 25,758,813 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955413 25,691,824 - 25,758,461 (+) NCBI ChiLan1.0 ChiLan1.0
GRAP2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 23 49,740,213 - 49,826,205 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 22 52,431,531 - 52,517,497 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 22 20,831,191 - 20,878,867 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 22 38,651,719 - 38,696,566 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 22 38,651,719 - 38,696,566 (+) Ensembl panpan1.1 panPan2
GRAP2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 10 25,156,233 - 25,220,106 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 10 25,157,841 - 25,220,222 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 10 25,092,401 - 25,156,329 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 10 25,908,310 - 25,972,290 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 10 25,909,919 - 25,972,202 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 10 25,619,908 - 25,683,843 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 10 25,942,524 - 26,006,115 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 10 26,117,033 - 26,181,059 (-) NCBI UU_Cfam_GSD_1.0
Grap2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 8,745,057 - 8,816,596 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936492 1,759,298 - 1,796,049 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936492 1,759,182 - 1,796,049 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
GRAP2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 5 8,375,762 - 8,445,068 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 5 8,372,920 - 8,445,128 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 5 5,668,663 - 5,744,087 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
GRAP2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 19 22,478,744 - 22,548,829 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 19 22,524,851 - 22,552,977 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666045 103,050,792 - 103,121,149 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Grap2
.
Predicted Target Of
Count of predictions: 36 Count of miRNA genes: 30 Interacting mature miRNAs: 32 Transcripts: ENSRNOT00000024673 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1300179 Kidm5 Kidney mass QTL 5 3.51 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 43747012 135012528 Rat 1300112 Bp183 Blood pressure QTL 183 3.51 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 7 111182207 135012528 Rat 1331728 Bp214 Blood pressure QTL 214 2.825 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 80221299 124373579 Rat 1331731 Bp216 Blood pressure QTL 216 2.851 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 102297359 133492884 Rat 2298475 Eau6 Experimental allergic uveoretinitis QTL 6 0.0029 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 7 84257275 129257275 Rat 71114 Niddm14 Non-insulin dependent diabetes mellitus QTL 14 4.5 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 7 84257275 129257275 Rat 1357336 Gluco6 Glucose level QTL 6 3.4 blood glucose amount (VT:0000188) serum glucose level (CMO:0000543) 7 94811326 116294265 Rat 1357338 Stl17 Serum triglyceride level QTL 17 3.23 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 7 69736356 112729554 Rat 631687 Hcas1 Hepatocarcinoma susceptibility QTL 1 3.9 0.001 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 7 91412594 129807172 Rat 70159 Bp61 Blood pressure QTL 61 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 103146217 116738842 Rat 634331 Pia17 Pristane induced arthritis QTL 17 4.7 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 7 73829340 130221005 Rat 1358914 Bp266 Blood pressure QTL 266 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat 631504 Cm27 Cardiac mass QTL 27 3.45 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 7 44421311 118198041 Rat 634322 Bw12 Body weight QTL 12 0 body mass (VT:0001259) body weight (CMO:0000012) 7 83153392 128153392 Rat 70173 Niddm19 Non-insulin dependent diabetes mellitus QTL 19 4.33 0.00005 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 7 64002457 135012528 Rat 1549899 Stresp8 Stress response QTL 8 4.37 0.0008 stress-related behavior trait (VT:0010451) defensive burying duration (CMO:0001961) 7 90482196 135012528 Rat 2317052 Aia17 Adjuvant induced arthritis QTL 17 2.13 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 7 81737938 126737938 Rat 731176 Glom5 Glomerulus QTL 5 2.5 0.0035 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 7 96670164 135012528 Rat 7411607 Foco15 Food consumption QTL 15 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 75918751 120918751 Rat 2306821 Bp335 Blood pressure QTL 335 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 106571501 135012528 Rat 631663 Bw6 Body weight QTL 6 3.4 body mass (VT:0001259) body weight (CMO:0000012) 7 111075573 134976056 Rat 1558655 Swd4 Spike wave discharge measurement QTL 4 3.68 0.0002 brain electrophysiology trait (VT:0010557) brain spike-and-wave discharge severity grade (CMO:0001988) 7 86983365 131983365 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 1331768 Kidm10 Kidney mass QTL 10 4.62096 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 80221299 125221299 Rat 61357 Bp38 Blood pressure QTL 38 1.6 0.052 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 41333674 119109060 Rat 2313102 Bmd79 Bone mineral density QTL 79 2.3 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 7 94811085 116738842 Rat 731174 Uae23 Urinary albumin excretion QTL 23 2.4 0.0042 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 7 104603555 135012528 Rat 2316947 Rf58 Renal function QTL 58 7.8 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 7 68938720 113886318 Rat 1331746 Kidm9 Kidney mass QTL 9 3.934 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 7 80221299 112308525 Rat 7411654 Foco25 Food consumption QTL 25 9.3 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 75918751 120918751 Rat 2316955 Stl24 Serum triglyceride level QTL 24 7.1 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 7 68938720 113886318 Rat 2299163 Iddm34 Insulin dependent diabetes mellitus QTL 34 2.71 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 7 91281130 135012528 Rat 2316952 Pur22 Proteinuria QTL 22 5.2 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 7 68938720 113886318 Rat 631540 Bw9 Body weight QTL 9 4.5 body mass (VT:0001259) body weight (CMO:0000012) 7 69736226 117455174 Rat 1358891 Bp265 Blood pressure QTL 265 2.21 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat
BI277894
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 112,173,694 - 112,173,799 (+) MAPPER mRatBN7.2 Rnor_6.0 7 121,847,849 - 121,847,953 NCBI Rnor6.0 Rnor_5.0 7 121,837,628 - 121,837,732 UniSTS Rnor5.0 RGSC_v3.4 7 118,912,401 - 118,912,505 UniSTS RGSC3.4 Celera 7 108,498,465 - 108,498,569 UniSTS Cytogenetic Map 7 q34 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
10
49
113
91
90
59
25
59
6
217
96
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000024673 ⟹ ENSRNOP00000024673
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 112,117,142 - 112,190,877 (+) Ensembl Rnor_6.0 Ensembl 7 121,841,855 - 121,864,679 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000095205 ⟹ ENSRNOP00000094684
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 112,117,142 - 112,190,877 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000099654 ⟹ ENSRNOP00000079385
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 112,117,142 - 112,189,629 (+) Ensembl
RefSeq Acc Id:
NM_001034944 ⟹ NP_001030116
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 113,997,356 - 114,071,073 (+) NCBI mRatBN7.2 7 112,117,142 - 112,190,880 (+) NCBI Rnor_6.0 7 121,791,330 - 121,864,835 (+) NCBI Rnor_5.0 7 121,781,461 - 121,854,021 (+) NCBI RGSC_v3.4 7 118,856,130 - 118,931,148 (+) RGD Celera 7 108,442,874 - 108,515,048 (+) RGD
Sequence:
CGGCGCGGTAAACTTGACATTTGAGTGCATCTTCCCACCGGCAAAAGACGAACCTAATAACTCGTTGTCAAAGCCGAGATACACACTCAACTCAGGCTCTTCGCTTCCCAAAGCTTCTCGTCAAGACA
hide sequence
RefSeq Acc Id:
NP_001030116 ⟸ NM_001034944
- UniProtKB:
Q3KR57 (UniProtKB/TrEMBL), D3ZG10 (UniProtKB/TrEMBL)
- Sequence:
MEAIAKFDFMASGEDELSFHTGDILKILSNQEEWLKAELGSQEGYVPKNFIDIKFPEWFHEGLSRHQAENLLMGKEIGFFVIRASQSSPGDFSISVRHEDDVQHFKVMRDTKGNYFLWTEKFPSLNKL
hide sequence
Ensembl Acc Id:
ENSRNOP00000024673 ⟸ ENSRNOT00000024673
Ensembl Acc Id:
ENSRNOP00000079385 ⟸ ENSRNOT00000099654
Ensembl Acc Id:
ENSRNOP00000094684 ⟸ ENSRNOT00000095205
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2005-12-06
Grap2
GRB2-related adaptor protein 2
Grap2_predicted
GRB2-related adaptor protein 2 (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Grap2_predicted
GRB2-related adaptor protein 2 (predicted)
Symbol and Name status set to approved
70820 APPROVED
