Hoxd10 (homeo box D10) - Rat Genome Database

Name: Hoxd10
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Hoxd10 (homeo box D10) Rattus norvegicus

Analyze

Symbol:

Hoxd10

Name:

homeo box D10

RGD ID:

1306511

Description:

Predicted to enable DNA-binding transcription activator activity, RNA polymerase II-specific; RNA polymerase II cis-regulatory region sequence-specific DNA binding activity; and chromatin binding activity. Predicted to be involved in regulation of transcription by RNA polymerase II. Predicted to act upstream of or within several processes, including limb morphogenesis; neuron differentiation; and regionalization. Predicted to be located in cytoplasmic ribonucleoprotein granule; cytosol; and nucleoplasm. Predicted to be active in nucleus. Human ortholog(s) of this gene implicated in congenital vertical talus. Orthologous to human HOXD10 (homeobox D10); INTERACTS WITH 1,2-dimethylhydrazine; 2,3,7,8-tetrachlorodibenzodioxine; all-trans-retinoic acid.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

homeobox protein Hox-D10; LOC303991

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	HOXD10 (homeobox D10)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Hoxd10 (homeobox D10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Hoxd10 (homeobox D10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	HOXD10 (homeobox D10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	HOXD10 (homeobox D10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Hoxd10 (homeobox D10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	HOXD10 (homeobox D10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	HOXD10 (homeobox D10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Hoxd10 (homeobox D10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	HOXD10 (homeobox D10)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Hoxd10 (homeobox D10)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	hoxd10a (homeobox D10a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Abd-B	Alliance	DIOPT (OrthoFinder\|OrthoInspector\|PANTHER)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	3	59,594,516 - 59,597,725 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	59,594,516 - 59,597,725 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	62,981,799 - 62,985,002 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	3	71,565,442 - 71,568,647 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	3	69,330,514 - 69,333,715 (+)	NCBI	Rnor_WKY
Rnor_6.0	3	61,614,133 - 61,617,342 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	61,613,774 - 61,617,367 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	68,080,469 - 68,083,678 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	57,306,064 - 57,309,273 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	57,202,503 - 57,205,646 (+)	NCBI
Celera	3	59,116,330 - 59,119,539 (+)	NCBI		Celera
Cytogenetic Map	3	q23	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Charcot-Marie-Tooth disease (ISO)

congenital vertical talus (ISO)

Disease Progression (ISO)

Flatfoot (ISO)

genetic disease (ISO)

glioblastoma (ISO)

head and neck squamous cell carcinoma (ISO)

Kyphoscoliosis (IEP)

Lower Extremity Deformities, Congenital (ISO)

Mouth Neoplasms (ISO)

rheumatoid arthritis (ISO)

split hand-foot malformation 5 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (EXP)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

4-hydroperoxycyclophosphamide (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (EXP,ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

butanal (ISO)

cadmium atom (ISO)

choline (ISO)

cisplatin (ISO)

copper atom (EXP)

copper(0) (EXP)

folic acid (ISO)

formaldehyde (ISO)

gentamycin (EXP)

L-methionine (ISO)

lipopolysaccharide (ISO)

paracetamol (EXP)

pentanal (ISO)

perfluorodecanoic acid (ISO)

perfluorononanoic acid (ISO)

perfluorooctanoic acid (ISO)

propanal (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

silver atom (ISO)

silver(0) (ISO)

trimellitic anhydride (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adult locomotory behavior (ISO)

anterior/posterior pattern specification (ISO)

embryonic limb morphogenesis (ISO)

embryonic skeletal system morphogenesis (ISO)

forelimb morphogenesis (ISO)

hindlimb morphogenesis (ISO)

neuromuscular process (ISO)

peripheral nervous system neuron development (ISO)

positive regulation of transcription by RNA polymerase II (ISO)

proximal/distal pattern formation (ISO)

regulation of gene expression (ISO)

regulation of transcription by RNA polymerase II (IBA)

single fertilization (ISO)

skeletal muscle tissue development (ISO)

skeletal system development (ISO)

spinal cord motor neuron cell fate specification (ISO)

Cellular Component

cytoplasmic ribonucleoprotein granule (IEA,ISO)

cytosol (IEA,ISO)

nucleoplasm (IEA,ISO)

nucleus (IBA)

Molecular Function

chromatin binding (ISO)

DNA binding (ISO)

DNA-binding transcription activator activity, RNA polymerase II-specific (ISO)

DNA-binding transcription factor activity (ISO)

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA)

protein binding (ISO)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA)

RNA polymerase II transcription regulatory region sequence-specific DNA binding (ISO)

sequence-specific double-stranded DNA binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
5.	GOA pipeline	RGD automated data pipeline
6.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	Abnormalities of vertebral formation and Hox expression in congenital kyphoscoliotic rats.	Seki T, etal., Mol Cell Biochem. 2008 May;312(1-2):193-9. doi: 10.1007/s11010-008-9734-4. Epub 2008 Mar 9.

Additional References at PubMed

PMID:1756725	PMID:9409668	PMID:10642795	PMID:11432851	PMID:12869760	PMID:16672333	PMID:18065432	PMID:23760953	PMID:26699387	PMID:33307856

Genomics

Comparative Map Data

Hoxd10
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	3	59,594,516 - 59,597,725 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	59,594,516 - 59,597,725 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	62,981,799 - 62,985,002 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	3	71,565,442 - 71,568,647 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	3	69,330,514 - 69,333,715 (+)	NCBI	Rnor_WKY
Rnor_6.0	3	61,614,133 - 61,617,342 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	61,613,774 - 61,617,367 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	68,080,469 - 68,083,678 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	57,306,064 - 57,309,273 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	57,202,503 - 57,205,646 (+)	NCBI
Celera	3	59,116,330 - 59,119,539 (+)	NCBI		Celera
Cytogenetic Map	3	q23	NCBI

HOXD10
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	176,116,778 - 176,119,937 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	2	176,108,790 - 176,119,937 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	176,981,506 - 176,984,665 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	176,689,738 - 176,692,916 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	2	176,807,006 - 176,809,933	NCBI
Celera	2	170,590,637 - 170,593,821 (+)	NCBI		Celera
Cytogenetic Map	2	q31.1	NCBI
HuRef	2	168,858,717 - 168,861,901 (+)	NCBI		HuRef
CHM1_1	2	176,987,360 - 176,990,538 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	2	176,604,906 - 176,608,071 (+)	NCBI		T2T-CHM13v2.0

Hoxd10
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	74,514,617 - 74,525,450 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	74,522,268 - 74,525,449 (+)	Ensembl		GRCm39 Ensembl
GRCm38	2	74,684,273 - 74,695,106 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	74,691,924 - 74,695,105 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	74,530,005 - 74,533,159 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	74,492,809 - 74,495,942 (+)	NCBI		MGSCv36	mm8
Celera	2	76,362,069 - 76,365,223 (+)	NCBI		Celera
Cytogenetic Map	2	C3	NCBI
cM Map	2	44.13	NCBI

Hoxd10
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955403	20,543,224 - 20,548,801 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955403	20,543,224 - 20,548,801 (-)	NCBI	ChiLan1.0	ChiLan1.0

HOXD10
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	2B	181,104,876 - 181,108,942 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2B	181,104,876 - 181,110,963 (+)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	2B	63,395,636 - 63,399,704 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

HOXD10
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	36	19,924,352 - 19,927,706 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	36	19,916,175 - 19,927,724 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	36	19,934,317 - 19,937,598 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	36	20,065,513 - 20,068,794 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	36	20,065,309 - 20,068,808 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	36	20,139,724 - 20,143,005 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	36	20,140,432 - 20,143,713 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	36	20,252,251 - 20,255,532 (+)	NCBI		UU_Cfam_GSD_1.0

Hoxd10
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	137,048,837 - 137,053,185 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936509	5,603,642 - 5,606,850 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936509	5,603,661 - 5,606,850 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

HOXD10
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	15	81,917,637 - 81,921,461 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	15	81,911,372 - 81,921,164 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	15	91,377,674 - 91,393,538 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

HOXD10
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	10	61,686,868 - 61,694,965 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	10	61,691,797 - 61,694,415 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666040	137,915,507 - 137,919,932 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Hoxd10
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624787	13,257,387 - 13,262,685 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624787	13,256,600 - 13,260,664 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Hoxd10
5 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	110
Count of miRNA genes:	71
Interacting mature miRNAs:	97
Transcripts:	ENSRNOT00000002148
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2290452	Scl56	Serum cholesterol level QTL 56	2.26		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	3	1	91609953	Rat
1358905	Hrtrt17	Heart rate QTL 17	5.9	0.000014	heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	10861912	89878372	Rat
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
2298542	Neuinf11	Neuroinflammation QTL 11	3.9		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	3	15005422	76927699	Rat
631676	Cm8	Cardiac mass QTL 8	7.03	0.0001	aorta mass (VT:0002845)	aorta weight (CMO:0000076)	3	16954708	61954708	Rat
10450804	Scl70	Serum cholesterol level QTL 70	4.7	0.001	blood LDL cholesterol amount (VT:0000181)	blood low density lipoprotein cholesterol level (CMO:0000053)	3	20714090	65714090	Rat
10450794	Scl69	Serum cholesterol level QTL 69	6.3	0.001	blood LDL cholesterol amount (VT:0000181)	blood low density lipoprotein cholesterol level (CMO:0000053)	3	20714090	65714090	Rat
2302055	Pia30	Pristane induced arthritis QTL 30	3.5	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111)	3	27936919	72936919	Rat
9590286	Uminl1	Urine mineral level QTL 1	3.5	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	3	28249687	73249687	Rat
8694196	Abfw2	Abdominal fat weight QTL 2	16.58	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	3	28249687	73249687	Rat
8694386	Bw159	Body weight QTL 159	4.52	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	3	28249687	73249687	Rat
8552950	Pigfal12	Plasma insulin-like growth factor 1 level QTL 12	7.3		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	3	28249687	73249687	Rat
9590136	Scort3	Serum corticosterone level QTL 3	23.37	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	28249687	73249687	Rat
2303593	Gluco46	Glucose level QTL 46	3		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	28468571	73468571	Rat
1354590	Despr11	Despair related QTL 11		0.000031	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	3	28468571	73468571	Rat
737818	Hcar12	Hepatocarcinoma resistance QTL 12	2.6		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	3	29463235	118376539	Rat
61419	Cia11	Collagen induced arthritis QTL 11	5.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	3	30356773	98535386	Rat
61356	Bp37	Blood pressure QTL 37	3		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	3	30684642	75684642	Rat
631647	Bp122	Blood pressure QTL 122	6.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	30684642	75684642	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
11565451	Bw177	Body weight QTL 177		0.002	body mass (VT:0001259)	body weight (CMO:0000012)	3	31426403	70668733	Rat
11565452	Kidm57	Kidney mass QTL 57		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	31426403	70668733	Rat
12879866	Cm94	Cardiac mass QTL 94		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	31426403	70668733	Rat
12879867	Cm95	Cardiac mass QTL 95		0.047	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	3	31426403	70668733	Rat
12879868	Am6	Aortic mass QTL 6		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	3	31426403	70668733	Rat
2301400	Cm68	Cardiac mass QTL 68		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	3	31426403	70668733	Rat
1300169	Bp177	Blood pressure QTL 177	2.96		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	3	33703347	61017857	Rat
1354589	Bw31	Body weight QTL 31	3.3		body mass (VT:0001259)	body weight (CMO:0000012)	3	33703347	78196190	Rat
1354604	Bw36	Body weight QTL 36	2.9		body mass (VT:0001259)	body weight (CMO:0000012)	3	33703347	104104347	Rat
1358362	Srcrt2	Stress Responsive Cort QTL 2	2.78		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	38192233	133483320	Rat
738019	Anxrr10	Anxiety related response QTL 10	3.9		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	3	38517803	83517803	Rat
2302276	Bw82	Body weight QTL 82	4.32		body mass (VT:0001259)	body weight (CMO:0000012)	3	39454637	62951183	Rat
1331777	Bw24	Body weight QTL 24	3.503		body mass (VT:0001259)	body weight (CMO:0000012)	3	39454637	89115240	Rat
1331795	Rf30	Renal function QTL 30	3.708		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	3	39454637	89115240	Rat
1354597	Kidm13	Kidney mass QTL 13	2.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	3	41874578	104104347	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	41874578	155617519	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	41874578	155617519	Rat
1300178	Hrtrt4	Heart rate QTL 4	3.74		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	43827364	90905114	Rat
1581503	Cm58	Cardiac mass QTL 58	2.7	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	43827364	121056321	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	47233211	147415807	Rat
1358186	Ept2	Estrogen-induced pituitary tumorigenesis QTL 2	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	47233430	110362260	Rat
2292613	Ept16	Estrogen-induced pituitary tumorigenesis QTL 16	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	47233430	110362260	Rat
631665	Bw8	Body weight QTL 8	5.5		body mass (VT:0001259)	body weight (CMO:0000012)	3	50437042	119183768	Rat
724523	Tsu1	Thymus enlargement suppressive QTL 1	3.84		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	3	50437504	115638231	Rat
1582249	Bw77	Body weight QTL 77	3.2	0.0025	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	3	53184593	64655484	Rat
1582218	Bw74	Body weight QTL 74	3.9	0.0021	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
1582238	Bw68	Body weight QTL 68	3.2	0.0064	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
1582239	Epfw1	Epididymal fat weight QTL 1	4.5	0.0006	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	3	53184593	115665732	Rat
61377	Edpm3	Estrogen-dependent pituitary mass QTL 3	7.05	0.038	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	53184692	89878207	Rat
731180	Bp152	Blood pressure QTL 152		0.03	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	53781112	91609953	Rat
731180	Bp152	Blood pressure QTL 152		0.03	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	3	53781112	91609953	Rat
731180	Bp152	Blood pressure QTL 152		0.03	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	53781112	91609953	Rat
1581568	Rf53	Renal function QTL 53			urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	3	56395968	161299569	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	59242096	157323038	Rat

Markers in Region

RH130068

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	59,597,392 - 59,597,583 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	61,617,010 - 61,617,200	NCBI	Rnor6.0
Rnor_5.0	3	68,083,346 - 68,083,536	UniSTS	Rnor5.0
RGSC_v3.4	3	57,308,941 - 57,309,131	UniSTS	RGSC3.4
Celera	3	59,119,207 - 59,119,397	UniSTS
Cytogenetic Map	3	q23	UniSTS

AI385591

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	59,597,084 - 59,597,191 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	61,616,702 - 61,616,808	NCBI	Rnor6.0
Rnor_5.0	3	68,083,038 - 68,083,144	UniSTS	Rnor5.0
RGSC_v3.4	3	57,308,633 - 57,308,739	UniSTS	RGSC3.4
Celera	3	59,118,899 - 59,119,005	UniSTS
Cytogenetic Map	3	q23	UniSTS

Hoxd9

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	59,596,750 - 59,596,964 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	61,616,368 - 61,616,581	NCBI	Rnor6.0
Rnor_5.0	3	68,082,704 - 68,082,917	UniSTS	Rnor5.0
RGSC_v3.4	3	57,308,299 - 57,308,512	UniSTS	RGSC3.4
Celera	3	59,118,565 - 59,118,778	UniSTS
Cytogenetic Map	3	q23	UniSTS

GDB:192883

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	59,597,184 - 59,597,275 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	61,616,802 - 61,616,892	NCBI	Rnor6.0
Rnor_5.0	3	68,083,138 - 68,083,228	UniSTS	Rnor5.0
RGSC_v3.4	3	57,308,733 - 57,308,823	UniSTS	RGSC3.4
Celera	3	59,118,999 - 59,119,089	UniSTS
Cytogenetic Map	3	q23	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	1									29	24
Low	1						8	8		6	10		8
Below cutoff		1	5	3	1	3		2	2		7	3

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001107094	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473949	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000115	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000002148 ⟹ ENSRNOP00000002148

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	59,594,516 - 59,597,725 (+)	Ensembl
Rnor_6.0 Ensembl	3	61,613,774 - 61,617,367 (+)	Ensembl

RefSeq Acc Id:

NM_001107094 ⟹ NP_001100564

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	3	59,594,516 - 59,597,725 (+)	NCBI
Rnor_6.0	3	61,614,133 - 61,617,342 (+)	NCBI
Rnor_5.0	3	68,080,469 - 68,083,678 (+)	NCBI
RGSC_v3.4	3	57,306,064 - 57,309,273 (+)	RGD
Celera	3	59,116,330 - 59,119,539 (+)	RGD

Sequence:

show sequence

ATGTGGTCGGCAGAGGCATCCACAATTACACCGGGAATGTTTTCCTAGCGATGTCAGCCTACAA
AGGACACAATCTCTCTTCTTCAAATTCCTCCCCAAAATGTCCTTTCCCAACAGCTCTCCTGCTG
CTAATACTTTTTTAGTAGATTCCTTGATCAGTGCCTGCAGGAGTGACAGTTTTTATTCGAGCAG
CGCCAGCATGTACATGCCACCACCTAGCGCAGACATGGGGACCTATGGAATGCAAACCTGTGGA
CTGCTCCCGTCTCTGGCCAAAAGAGAAGTGAACCACCAAAATATGGGTATGAATGTACATCCTT
ATATACCTCAAGTAGACAGTTGGACAGACCCGAACAGATCTTGTCGAATAGAGCAACCTGTTAC
ACAGCAAGTCCCCACTTGCTCATTCACCGCCAACATTAAAGAAGAATCCAATTGCTGCATGTAT
TCTGATAAGCGCAACAAACTCATTTCTGCCGAGGTCCCTTCGTACCAGAGGCTGGTCCCCGAGT
CTTGTCCTGTTGAGAACCCCGAGGTTCCTGTCCCTGGATATTTTAGACTGAGTCAGACCTACGC
CACCGGGAAAACCCAAGAGTACAATAACAACCCCGAAGGCAGCTCCACTGTCATGCTCCAGCTC
AACCCTCGTGGCGCGGCCAAGCCGCAGCTCTCGGCTGCCCAGCTGCAGATGGAAAAGAAGATGA
ACGAAACCGCGAGCGGCCAGGAGCCCACTAAAGTCTCCCAAGTGGAGAGCCCCGAGGCCAAAGG
CGGCCTTCCAGAAGAGAGGAGCTGCCTGGCTGAGGTCTCCGTGTCCAGCCCCGAAGTGCAGGAG
AAGGAAAGCAAAGAGGAAATCAAGTCTGATACTCCAACCAGCAATTGGCTCACTGCAAAGAGTG
GCAGAAAGAAGAGGTGCCCTTACACTAAACACCAAACGCTGGAATTAGAAAAAGAGTTCTTGTT
CAATATGTACCTCACCCGCGAGCGCCGCCTAGAGATCAGTAAGAGCGTTAACCTCACCGACAGG
CAGGTCAAGATTTGGTTTCAAAACCGCCGAATGAAACTCAAGAAGATGAGCCGAGAGAATCGAA
TCCGAGAACTGACCGCCAACCTCACCTTTTCTTAGGTCTGAGGCCCATGTGAGGCCAGGATCCG
AGAGGGGGCACCGAGTTCCAGGCCCGAGTACTGAAGGACTAGGGAGGCGGAAACAAAACCTTCA
TTGCTCTTTGGTTGTTTTGTTTTGTTTTGTTTTGTTCTGTTCTGTTTTCCTGCTAGAATGTGAC
TTTGGGGTCATTCTGTTCGTGCTGCAAGTGATCTGTAATCCCTACGAGTATACATATATATATA
TTAAAAAAACTTAGCACGTGTAATTTATTTTTTCATCGTAATGCAGGGTAACTATTACTGCGCA
TTTTCATTTGGGTCTTAACTTATTGGAACTGTAGAGCATCCATCTAACCTTATCCACCCAGCCA
GCCAGCCAGCAATGTGACTTTTCCATGTTTTTCCTAACATAAAAGTTCTCTCTGTGTGTGGTTA
GCCCATGAACTCATGACATTTTGAAAACATCCAGTACTTAAAAAAAACAACAAAAAAATCCTAT
ATCTATATATATTTCAAAAGATTAAGAAAACCCACAAGCTTTGGGGGGGAGGGGGACTTTAAAA
GCACATTACAATGTATCTTTTCACAAACGAACTTAGCAATTGTCCTTGGTGAAATGGATTATTG
ACTTATGCCTTGTAGCCTTTCCTTGTGGTGCATCTGTGGTTTGGTAGAAATACAAGAGCAACCT
GTGCTTTTTTGTGCATGTTCTGGTCGCATGTGTAATGCAATAAACTCTGGAAATGA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001100564	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL79181	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_001100564 ⟸ NM_001107094

- UniProtKB:

D4ACD8 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSFPNSSPAANTFLVDSLISACRSDSFYSSSASMYMPPPSADMGTYGMQTCGLLPSLAKREVNH
QNMGMNVHPYIPQVDSWTDPNRSCRIEQPVTQQVPTCSFTANIKEESNCCMYSDKRNKLISAEV
PSYQRLVPESCPVENPEVPVPGYFRLSQTYATGKTQEYNNNPEGSSTVMLQLNPRGAAKPQLSA
AQLQMEKKMNETASGQEPTKVSQVESPEAKGGLPEERSCLAEVSVSSPEVQEKESKEEIKSDTP
TSNWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISKSVNLTDRQVKIWFQNRRMK
LKKMSRENRIRELTANLTFS

hide sequence

RefSeq Acc Id:

ENSRNOP00000002148 ⟸ ENSRNOT00000002148

Protein Domains

Homeobox

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4ACD8-F1-model_v2	AlphaFold	D4ACD8	1-410	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1306511	AgrOrtholog
BioCyc Gene	G2FUF-49332	BioCyc
Ensembl Genes	ENSRNOG00000001581	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000002148	ENTREZGENE
	ENSRNOP00000002148.5	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000002148	ENTREZGENE
	ENSRNOT00000002148.6	UniProtKB/TrEMBL
Gene3D-CATH	Homeodomain-like	UniProtKB/TrEMBL
InterPro	Homeobox	UniProtKB/TrEMBL
	Homeobox_CS	UniProtKB/TrEMBL
	Homeobox_region	UniProtKB/TrEMBL
	Homeodomain-like	UniProtKB/TrEMBL
	HXA10/ABDB-like	UniProtKB/TrEMBL
NCBI Gene	303991	ENTREZGENE
PANTHER	HOMEOBOX PROTEIN HOX-D10	UniProtKB/TrEMBL
	PTHR45874	UniProtKB/TrEMBL
Pfam	Homeobox	UniProtKB/TrEMBL
PhenoGen	Hoxd10	PhenoGen
PRINTS	HOMEOBOX	UniProtKB/TrEMBL
PROSITE	HOMEOBOX_1	UniProtKB/TrEMBL
	HOMEOBOX_2	UniProtKB/TrEMBL
SMART	HOX	UniProtKB/TrEMBL
Superfamily-SCOP	Homeodomain_like	UniProtKB/TrEMBL
UniProt	D4ACD8	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-04-30	Hoxd10	homeo box D10	Hoxd10_predicted	homeo box D10 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Hoxd10_predicted	homeo box D10 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM