Advanced Search (OLGA)

Gene: Mettl23 (methyltransferase 23, arginine) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Mettl23

Name:

methyltransferase 23, arginine

RGD ID:

1306284

Description:

Predicted to enable DNA-binding transcription factor binding activity; heat shock protein binding activity; and histone H3R17 methyltransferase activity. Predicted to be involved in cognition; epigenetic programming in the zygotic pronuclei; and positive regulation of transcription by RNA polymerase II. Predicted to act upstream of with a positive effect on epigenetic programing of male pronucleus. Predicted to be located in female pronucleus. Predicted to be part of protein-containing complex. Predicted to be active in cytoplasm and male pronucleus. Human ortholog(s) of this gene implicated in autosomal recessive intellectual developmental disorder 44. Orthologous to human METTL23 (methyltransferase 23, arginine); INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 3-chloropropane-1,2-diol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

histone-arginine methyltransferase METTL23; hypothetical protein LOC287918; LOC287918; methyltransferase like 23; methyltransferase-like protein 23; MGC105570; probable methyltransferase-like protein 23; RGD1306284; similar to RIKEN cDNA 1110005A03

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	METTL23 (methyltransferase 23, arginine)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB
Mus musculus (house mouse):	Mettl23 (methyltransferase like 23)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Mettl23 (methyltransferase 23, arginine)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	METTL23 (methyltransferase 23, arginine)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	METTL23 (methyltransferase like 23)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Mettl23 (methyltransferase 23, arginine)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	METTL23 (methyltransferase like 23)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	METTL23 (methyltransferase 23, arginine)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Mettl23 (methyltransferase 23, arginine)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	HTR1F (5-hydroxytryptamine receptor 1F)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Mettl23 (methyltransferase like 23)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	METTL23 (methyltransferase 23, arginine)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	mettl23 (methyltransferase like 23)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG5013	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	mettl23	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	102,546,102 - 102,550,782 (+)	NCBI		GRCr8
mRatBN7.2	10	102,047,090 - 102,053,379 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	102,047,314 - 102,051,977 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	107,151,290 - 107,155,954 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	106,614,379 - 106,619,043 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	101,968,145 - 101,972,809 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	105,787,935 - 105,793,307 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	105,787,935 - 105,792,598 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	105,446,488 - 105,451,857 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	106,948,784 - 106,953,448 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	106,963,290 - 106,967,951 (+)	NCBI
Celera	10	100,615,774 - 100,620,438 (+)	NCBI		Celera
Cytogenetic Map	10	q32.2	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Mettl23	Rat	autosomal recessive intellectual developmental disorder 44		ISO	METTL23 (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:24501276 more ...
Mettl23	Rat	genetic disease		ISO	METTL23 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar	PMID:24501276 more ...
Mettl23	Rat	intellectual disability		ISO	METTL23 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Intellectual disability	ClinVar	PMID:24501276 more ...

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Mettl23	Rat	intellectual disability		ISO	METTL23 (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:24626631

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Mettl23	Rat	glaucoma		ISS	Mettl23 (Mus musculus)	13592920		MouseDO

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Mettl23	Rat	autosomal recessive intellectual developmental disorder 44		ISO	METTL23 (Homo sapiens)	7240710		OMIM

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Mettl23	Rat	(+)-schisandrin B	multiple interactions	EXP		6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of METTL23 mRNA]	CTD	PMID:31150632
Mettl23	Rat	(1->4)-beta-D-glucan	multiple interactions	ISO	Mettl23 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of METTL23 mRNA	CTD	PMID:36331819
Mettl23	Rat	1,2-dimethylhydrazine	multiple interactions	ISO	Mettl23 (Mus musculus)	6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of METTL23 mRNA	CTD	PMID:22206623
Mettl23	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of METTL23 mRNA	CTD	PMID:21215274 and PMID:32109520
Mettl23	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of METTL23 mRNA	CTD	PMID:33387578
Mettl23	Rat	2-hydroxypropanoic acid	decreases expression	ISO	METTL23 (Homo sapiens)	6480464	Lactic Acid results in decreased expression of METTL23 mRNA	CTD	PMID:30851411
Mettl23	Rat	3-chloropropane-1,2-diol	decreases expression	EXP		6480464	alpha-Chlorohydrin results in decreased expression of METTL23 mRNA	CTD	PMID:28522335
Mettl23	Rat	3-isobutyl-1-methyl-7H-xanthine	multiple interactions	ISO	METTL23 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of METTL23 mRNA	CTD	PMID:28628672
Mettl23	Rat	aristolochic acid A	decreases expression	ISO	METTL23 (Homo sapiens)	6480464	aristolochic acid I results in decreased expression of METTL23 mRNA	CTD	PMID:33212167
Mettl23	Rat	arsane	multiple interactions	ISO	METTL23 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of METTL23 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of METTL23 mRNA	CTD	PMID:39836092
Mettl23	Rat	arsenic atom	multiple interactions	ISO	METTL23 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of METTL23 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of METTL23 mRNA	CTD	PMID:39836092
Mettl23	Rat	benzo[a]pyrene	affects methylation	ISO	METTL23 (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of METTL23 3' UTR and Benzo(a)pyrene affects the methylation of METTL23 promoter	CTD	PMID:27901495
Mettl23	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of METTL23 mRNA	CTD	PMID:25181051
Mettl23	Rat	bisphenol A	increases expression	ISO	Mettl23 (Mus musculus)	6480464	bisphenol A results in increased expression of METTL23 mRNA	CTD	PMID:33221593 and PMID:38074096
Mettl23	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of METTL23 mRNA	CTD	PMID:30816183 and PMID:32528016
Mettl23	Rat	bisphenol A	increases methylation	EXP		6480464	bisphenol A results in increased methylation of METTL23 gene	CTD	PMID:28505145
Mettl23	Rat	bisphenol F	multiple interactions	ISO	METTL23 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of METTL23 mRNA	CTD	PMID:28628672
Mettl23	Rat	buspirone	increases expression	EXP		6480464	Buspirone results in increased expression of METTL23 mRNA	CTD	PMID:24136188
Mettl23	Rat	carbon nanotube	decreases expression	ISO	Mettl23 (Mus musculus)	6480464	Nanotubes and Carbon analog results in decreased expression of METTL23 mRNA	CTD	PMID:25620056
Mettl23	Rat	chlorpyrifos	increases expression	ISO	Mettl23 (Mus musculus)	6480464	Chlorpyrifos results in increased expression of METTL23 mRNA	CTD	PMID:37019170
Mettl23	Rat	cisplatin	decreases expression	ISO	METTL23 (Homo sapiens)	6480464	Cisplatin results in decreased expression of METTL23 mRNA	CTD	PMID:27594783
Mettl23	Rat	dexamethasone	multiple interactions	ISO	METTL23 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of METTL23 mRNA	CTD	PMID:28628672
Mettl23	Rat	dicrotophos	decreases expression	ISO	METTL23 (Homo sapiens)	6480464	dicrotophos results in decreased expression of METTL23 mRNA	CTD	PMID:28302478
Mettl23	Rat	finasteride	increases expression	EXP		6480464	Finasteride results in increased expression of METTL23 mRNA	CTD	PMID:24136188
Mettl23	Rat	folic acid	multiple interactions	ISO	Mettl23 (Mus musculus)	6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of METTL23 mRNA	CTD	PMID:22206623
Mettl23	Rat	indometacin	increases expression	ISO	METTL23 (Homo sapiens)	6480464	Indomethacin results in increased expression of METTL23 mRNA	CTD	PMID:16984733
Mettl23	Rat	indometacin	multiple interactions	ISO	METTL23 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of METTL23 mRNA	CTD	PMID:28628672
Mettl23	Rat	manganese atom	multiple interactions	ISO	METTL23 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of METTL23 mRNA	CTD	PMID:39836092
Mettl23	Rat	manganese(0)	multiple interactions	ISO	METTL23 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of METTL23 mRNA	CTD	PMID:39836092
Mettl23	Rat	manganese(II) chloride	multiple interactions	ISO	METTL23 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of METTL23 mRNA	CTD	PMID:39836092
Mettl23	Rat	methapyrilene	decreases expression	EXP		6480464	Methapyrilene results in decreased expression of METTL23 mRNA	CTD	PMID:30467583
Mettl23	Rat	nitrates	multiple interactions	ISO	Mettl23 (Mus musculus)	6480464	[Particulate Matter results in increased abundance of Nitrates] which results in increased expression of METTL23 mRNA	CTD	PMID:35964746
Mettl23	Rat	paracetamol	increases expression	ISO	METTL23 (Homo sapiens)	6480464	Acetaminophen results in increased expression of METTL23 mRNA	CTD	PMID:22230336
Mettl23	Rat	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	Mettl23 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of METTL23 mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of METTL23 mRNA	CTD	PMID:36331819
Mettl23	Rat	rac-lactic acid	decreases expression	ISO	METTL23 (Homo sapiens)	6480464	Lactic Acid results in decreased expression of METTL23 mRNA	CTD	PMID:30851411
Mettl23	Rat	resveratrol	multiple interactions	ISO	METTL23 (Homo sapiens)	6480464	[Plant Extracts co-treated with Resveratrol] results in increased expression of METTL23 mRNA	CTD	PMID:23557933
Mettl23	Rat	sodium arsenite	multiple interactions	ISO	METTL23 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of METTL23 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of METTL23 mRNA	CTD	PMID:39836092
Mettl23	Rat	sulindac	increases expression	EXP		6480464	Sulindac results in increased expression of METTL23 mRNA	CTD	PMID:24136188
Mettl23	Rat	temozolomide	increases expression	ISO	METTL23 (Homo sapiens)	6480464	Temozolomide results in increased expression of METTL23 mRNA	CTD	PMID:31758290
Mettl23	Rat	tetrachloromethane	decreases expression	EXP		6480464	Carbon Tetrachloride results in decreased expression of METTL23 mRNA	CTD	PMID:31150632
Mettl23	Rat	tetrachloromethane	decreases expression	ISO	Mettl23 (Mus musculus)	6480464	Carbon Tetrachloride results in decreased expression of METTL23 mRNA	CTD	PMID:31919559
Mettl23	Rat	tetrachloromethane	multiple interactions	EXP		6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of METTL23 mRNA]	CTD	PMID:31150632
Mettl23	Rat	thioacetamide	decreases expression	EXP		6480464	Thioacetamide results in decreased expression of METTL23 mRNA	CTD	PMID:34492290
Mettl23	Rat	thiram	decreases expression	ISO	METTL23 (Homo sapiens)	6480464	Thiram results in decreased expression of METTL23 mRNA	CTD	PMID:38568856
Mettl23	Rat	trichloroethene	increases expression	EXP		6480464	Trichloroethylene results in increased expression of METTL23 mRNA	CTD	PMID:33387578
Mettl23	Rat	valproic acid	affects expression	ISO	METTL23 (Homo sapiens)	6480464	Valproic Acid affects the expression of METTL23 mRNA	CTD	PMID:25979313
Mettl23	Rat	vinclozolin	affects expression	EXP		6480464	vinclozolin affects the expression of METTL23 mRNA	CTD	PMID:19015723
Mettl23	Rat	vinclozolin	decreases expression	EXP		6480464	vinclozolin results in decreased expression of METTL23 mRNA	CTD	PMID:23034163

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Mettl23	Rat	chromatin organization	involved_in	IEA	UniProtKB-KW:KW-0156	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Mettl23	Rat	cognition	involved_in	ISO	METTL23 (Homo sapiens)	1624291	PMID:24501276	RGD	PMID:24501276
Mettl23	Rat	epigenetic programing of male pronucleus	acts_upstream_of_positive_effect	ISS	UniProtKB:A2AA28	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Mettl23	Rat	epigenetic programing of male pronucleus	acts_upstream_of_positive_effect	ISO	Mettl23 (Mus musculus)	1624291	PMID:28930672	RGD	PMID:28930672
Mettl23	Rat	epigenetic programming in the zygotic pronuclei	involved_in	ISO	Mettl23 (Mus musculus)	1624291	PMID:28930672	RGD	PMID:28930672
Mettl23	Rat	epigenetic programming in the zygotic pronuclei	involved_in	ISS	UniProtKB:A2AA28	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Mettl23	Rat	epigenetic regulation of gene expression	involved_in	IBA	MGI:1921569 and PANTHER:PTN000378684	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Mettl23	Rat	methylation	involved_in	IEA	UniProtKB-KW:KW-0489	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Mettl23	Rat	positive regulation of transcription by RNA polymerase II	involved_in	ISO	METTL23 (Homo sapiens)	1624291	PMID:24501276	RGD	PMID:24501276

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Mettl23	Rat	cytoplasm	located_in	ISO	Mettl23 (Mus musculus)	1624291	PMID:28930672	RGD	PMID:28930672
Mettl23	Rat	cytoplasm	located_in	IEA	UniProtKB-SubCell:SL-0086	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Mettl23	Rat	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Mettl23	Rat	cytoplasm	is_active_in	IBA	MGI:1921569 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Mettl23	Rat	cytoplasm	located_in	ISS	UniProtKB:A2AA28	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Mettl23	Rat	cytoplasm	located_in	ISO	METTL23 (Homo sapiens)	1624291	PMID:23349634 and PMID:24501276	RGD	PMID:23349634 and PMID:24501276
Mettl23	Rat	female pronucleus	located_in	ISS	UniProtKB:A2AA28	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Mettl23	Rat	female pronucleus	located_in	ISO	Mettl23 (Mus musculus)	1624291	PMID:28930672	RGD	PMID:28930672
Mettl23	Rat	male pronucleus	is_active_in	ISS	UniProtKB:A2AA28	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Mettl23	Rat	male pronucleus	is_active_in	ISO	Mettl23 (Mus musculus)	1624291	PMID:28930672	RGD	PMID:28930672
Mettl23	Rat	nucleus	located_in	ISO	METTL23 (Homo sapiens)	1624291	PMID:24501276	RGD	PMID:24501276
Mettl23	Rat	nucleus	located_in	IEA	UniProtKB-SubCell:SL-0191	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Mettl23	Rat	nucleus	located_in	IEA	UniProtKB-KW:KW-0539	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Mettl23	Rat	nucleus	is_active_in	IBA	MGI:1921569 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Mettl23	Rat	protein-containing complex	part_of	ISO	METTL23 (Homo sapiens)	1624291	PMID:23349634	RGD	PMID:23349634

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Mettl23	Rat	DNA-binding transcription factor binding	enables	ISO	METTL23 (Homo sapiens)	1624291	UniProtKB:Q06546 and PMID:24501276	RGD	PMID:24501276
Mettl23	Rat	heat shock protein binding	enables	ISO	METTL23 (Homo sapiens)	1624291	UniProtKB:P11021 more ...	RGD	PMID:23349634
Mettl23	Rat	histone H3R17 methyltransferase activity	enables	ISS	UniProtKB:A2AA28	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Mettl23	Rat	histone H3R17 methyltransferase activity	enables	ISO	Mettl23 (Mus musculus)	1624291	PMID:28930672	RGD	PMID:28930672
Mettl23	Rat	histone H3R17 methyltransferase activity	enables	IBA	MGI:1921569 and PANTHER:PTN000378684	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Mettl23	Rat	methyltransferase activity	enables	IEA	UniProtKB-KW:KW-0489	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Mettl23	Rat	protein binding	enables	ISO	Mettl23 (Mus musculus)	1624291	UniProtKB:Q8BG87 more ...	RGD	PMID:28930672
Mettl23	Rat	protein binding	enables	ISO	METTL23 (Homo sapiens)	1624291	UniProtKB:Q9NYU1 more ...	RGD	PMID:23349634
Mettl23	Rat	protein methyltransferase activity	enables	IEA	ARBA:ARBA00027511	1600115	GO_REF:0000117	UniProt	GO_REF:0000117
Mettl23	Rat	protein-arginine omega-N asymmetric methyltransferase activity	enables	IEA	RHEA:48096	1600115	GO_REF:0000116	RHEA	GO_REF:0000116
Mettl23	Rat	transferase activity	enables	IEA	UniProtKB-KW:KW-0808	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:12477932	PMID:23349634	PMID:24501276

Mettl23
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	102,546,102 - 102,550,782 (+)	NCBI		GRCr8
mRatBN7.2	10	102,047,090 - 102,053,379 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	102,047,314 - 102,051,977 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	107,151,290 - 107,155,954 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	106,614,379 - 106,619,043 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	101,968,145 - 101,972,809 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	105,787,935 - 105,793,307 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	105,787,935 - 105,792,598 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	105,446,488 - 105,451,857 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	106,948,784 - 106,953,448 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	106,963,290 - 106,967,951 (+)	NCBI
Celera	10	100,615,774 - 100,620,438 (+)	NCBI		Celera
Cytogenetic Map	10	q32.2	NCBI

METTL23
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	76,726,041 - 76,733,881 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	76,726,830 - 76,733,936 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	17	74,722,123 - 74,729,963 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	72,234,545 - 72,241,557 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	17	71,315,319 - 71,322,335 (+)	NCBI		Celera
Cytogenetic Map	17	q25.1	NCBI
HuRef	17	70,150,623 - 70,157,677 (+)	NCBI		HuRef
CHM1_1	17	74,787,720 - 74,794,774 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	17	77,623,024 - 77,630,868 (+)	NCBI		T2T-CHM13v2.0

Mettl23
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	116,734,341 - 116,740,566 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	116,734,104 - 116,745,089 (+)	Ensembl		GRCm39 Ensembl
GRCm38	11	116,843,515 - 116,849,740 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	116,843,278 - 116,854,263 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	116,704,829 - 116,711,054 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	116,659,690 - 116,665,824 (+)	NCBI		MGSCv36	mm8
Celera	11	128,583,996 - 128,590,229 (+)	NCBI		Celera
Cytogenetic Map	11	E2	NCBI
cM Map	11	81.49	NCBI

Mettl23
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955506	5,572,380 - 5,577,676 (-)	NCBI	ChiLan1.0	ChiLan1.0

METTL23
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	92,776,578 - 92,782,425 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	97,602,363 - 97,608,139 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	70,803,797 - 70,809,702 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	76,370,157 - 76,375,727 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	17	76,370,184 - 76,375,727 (+)	Ensembl	panpan1.1		panPan2

METTL23
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	4,031,941 - 4,037,012 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	9	4,031,955 - 4,037,127 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	4,712,547 - 4,718,514 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	4,706,888 - 4,712,854 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	4,707,775 - 4,712,855 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	4,732,757 - 4,738,721 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	4,852,396 - 4,858,363 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	4,933,446 - 4,939,415 (-)	NCBI		UU_Cfam_GSD_1.0

Mettl23
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	4,636,758 - 4,640,607 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936594	1,773,719 - 1,774,995 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936594	1,771,141 - 1,775,593 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

METTL23
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	12	4,804,037 - 4,808,913 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	12	4,802,404 - 4,808,948 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	12	4,655,404 - 4,660,799 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

METTL23
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	44,948,737 - 44,955,587 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	16	44,946,066 - 44,955,606 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666077	15,686,697 - 15,693,751 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Mettl23
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624801	6,571,378 - 6,575,022 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Mettl23
19 total Variants

Assembly: Rnor_5.0

Chromosome	Start Pos	End Pos	Reference Nucleotide	Variant Nucleotide	Variant Type	Strain	Variant Page
10	105446583	105446584	T	C	snv	LE/Stm (KyushuU), IS/Kyo (KyushuU)	View more Information

Predicted Target Of

	Summary Value
Count of predictions:	33
Count of miRNA genes:	26
Interacting mature miRNAs:	33
Transcripts:	ENSRNOT00000000266
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354641	Bvd2	Brain ventricular dilatation QTL 2	6.36	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	10	93223816	107057807	Rat
61449	Ciaa2	CIA Autoantibody QTL 2	7.1		blood autoantibody amount (VT:0003725)	calculated serum anti-type 2 collagen antibody titer (CMO:0001279)	10	63221094	107211142	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
1298078	Stresp5	Stress response QTL 5	2.99	0.00025	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	42045676	104670812	Rat
1549831	Bss6	Bone structure and strength QTL 6	4		lumbar vertebra strength trait (VT:0010574)	vertebra ultimate force (CMO:0001678)	10	57576521	102576521	Rat
1579915	Bp280	Blood pressure QTL 280		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	90404397	107211142	Rat
2298548	Neuinf7	Neuroinflammation QTL 7	3.4		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	10	72224939	107211142	Rat
1302404	Cia27	Collagen induced arthritis QTL 27	2.6	0.0045	joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	10	76452683	107211142	Rat
2317754	Glom25	Glomerulus QTL 25	3.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	82685200	107211142	Rat
70171	Cari1	Carrageenan-induced inflammation QTL 1	4.9	0.0005	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	10	53797385	107211142	Rat
10450493	Bp382	Blood pressure QTL 382		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	94759759	107211142	Rat
1578672	Bmd16	Bone mineral density QTL 16	6.2		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	10	96703043	107057807	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
2313103	Bss80	Bone structure and strength QTL 80	2	0.0001	tibia strength trait (VT:1000284)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	10	62057807	107057807	Rat
2293646	Bss25	Bone structure and strength QTL 25	10.96	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	10	69738412	107211142	Rat
2303118	Mamtr7	Mammary tumor resistance QTL 7		0.003	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	9658275	104670812	Rat
2300172	Bmd57	Bone mineral density QTL 57	9.8	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	10	69738412	107211142	Rat
70193	Mcs7	Mammary carcinoma susceptibility QTL 7	2.38		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	10	72224939	107211142	Rat
2313105	Bss79	Bone structure and strength QTL 79	1.8	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	62057807	107057807	Rat
61363	Oia3	Oil induced arthritis QTL 3		0.001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	87307617	107211142	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14487011	107057807	Rat
724530	Bp149	Blood pressure QTL 149		0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	90627439	107211142	Rat
1300137	Bp186	Blood pressure QTL 186	3.57		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	10	90627439	107057807	Rat
2293663	Bss33	Bone structure and strength QTL 33	9.34	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	10	69738412	107211142	Rat
1578663	Bss18	Bone structure and strength QTL 18	3.6		femur width (VT:1000666)	femoral neck width (CMO:0001695)	10	96703043	107057807	Rat
7387312	Bw125	Body weight QTL 125	3	0.0047	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight (CMO:0000356)	10	64890616	107211142	Rat
2312672	Insul15	Insulin level QTL 15		0.01	blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	10	57134272	102134272	Rat
12880384	Cm107	Cardiac mass QTL 107		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)		90404397	107211142	Rat
12880385	Cm108	Cardiac mass QTL 108		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)		90404397	107211142	Rat
2317029	Aia19	Adjuvant induced arthritis QTL 19	2.98		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	10	66978955	107211142	Rat
2303589	Bw87	Body weight QTL 87	2		body mass (VT:0001259)	body weight (CMO:0000012)	10	81285008	107211142	Rat
12880396	Am13	Aortic mass QTL 13		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	90404397	107211142	Rat
12880398	Kidm67	Kidney mass QTL 67		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	10	90404397	107211142	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	51770177	107211142	Rat
2317039	Aia6	Adjuvant induced arthritis QTL 6	4.31		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	10	66978955	107211142	Rat
12880395	Cm109	Cardiac mass QTL 109		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	10	90404397	107211142	Rat
61396	Bp9	Blood pressure QTL 9	4.8	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	68420376	107211142	Rat
634320	Niddm49	Non-insulin dependent diabetes mellitus QTL 49	4.41		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	10	88539139	107211142	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29299504	107211142	Rat
10450498	Bp384	Blood pressure QTL 384		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	67750049	107211142	Rat
4889492	Pancm2	Pancreatic morphology QTL 2	3.2		pancreatic beta cell morphology trait (VT:0005217)	ratio of insulin-positive cell area to total area of splenic region of pancreas (CMO:0001814)	10	76748906	107211142	Rat
6893366	Bw106	Body weight QTL 106	0.3	0.47	body mass (VT:0001259)	body weight (CMO:0000012)	10	70199100	107211142	Rat
2293698	Bss43	Bone structure and strength QTL 43	5.33	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra cross-sectional area (CMO:0001689)	10	59209888	104209888	Rat
1576313	Pia25	Pristane induced arthritis QTL 25			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	96120911	104060283	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
1576307	Cia28	Collagen induced arthritis QTL 28			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	96120911	104060283	Rat
1576308	Schws1	Schwannoma susceptibility QTL 1		0.0041	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	40035094	102359817	Rat
631269	Cia22	Collagen induced arthritis QTL 22	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14487011	104060283	Rat
631270	Cia23	Collagen induced arthritis QTL 23	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
2292438	Bp311	Blood pressure QTL 311			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	76246085	107211142	Rat
2312662	Slep8	Serum leptin concentration QTL 8		0.05	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	10	57134272	102134272	Rat
2292436	Bp310	Blood pressure QTL 310			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	94759759	107211142	Rat
1600367	Mcs15	Mammary carcinoma susceptibility QTL 15	4.5		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	10	85565469	103884409	Rat
631539	Oia6	Oil induced arthritis QTL 6			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	97010147	104670812	Rat
631538	Oia5	Oil induced arthritis QTL 5			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	87055121	107211142	Rat
61436	Cia5	Collagen induced arthritis QTL 5	4.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	91228102	104060283	Rat
1642980	Bp300	Blood pressure QTL 300			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	68383129	107211142	Rat
2312668	Scl65	Serum cholesterol level QTL 65		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	10	57134272	102134272	Rat

D11Wsu175e

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	102,052,252 - 102,052,476 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	105,792,874 - 105,793,097	NCBI	Rnor6.0
Rnor_5.0	10	105,451,427 - 105,451,650	UniSTS	Rnor5.0
RGSC_v3.4	10	106,953,723 - 106,953,946	UniSTS	RGSC3.4
Celera	10	100,620,713 - 100,620,936	UniSTS
Cytogenetic Map	10	q32.3	UniSTS

RH133307

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	10	102,550,151 - 102,550,518 (+)	Marker Load Pipeline
mRatBN7.2	10	102,051,347 - 102,051,714 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	105,791,969 - 105,792,335	NCBI	Rnor6.0
Rnor_5.0	10	105,450,522 - 105,450,888	UniSTS	Rnor5.0
RGSC_v3.4	10	106,952,818 - 106,953,184	UniSTS	RGSC3.4
Celera	10	100,619,808 - 100,620,174	UniSTS
Cytogenetic Map	10	q32.3	UniSTS

RH139654

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	102,051,833 - 102,052,049 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	105,792,455 - 105,792,670	NCBI	Rnor6.0
Rnor_5.0	10	105,451,008 - 105,451,223	UniSTS	Rnor5.0
RGSC_v3.4	10	106,953,304 - 106,953,519	UniSTS	RGSC3.4
Celera	10	100,620,294 - 100,620,509	UniSTS
Cytogenetic Map	10	q32.3	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001008283	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006247798	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085698	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063268791	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC123144	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC086594	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000000266 ⟹ ENSRNOP00000000266

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	102,047,314 - 102,051,977 (+)	Ensembl
Rnor_6.0 Ensembl	10	105,787,935 - 105,792,598 (+)	Ensembl

RefSeq Acc Id:

NM_001008283 ⟹ NP_001008284

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	102,546,118 - 102,550,782 (+)	NCBI
mRatBN7.2	10	102,047,314 - 102,051,978 (+)	NCBI
Rnor_6.0	10	105,787,935 - 105,792,599 (+)	NCBI
Rnor_5.0	10	105,446,488 - 105,451,857 (+)	NCBI
RGSC_v3.4	10	106,948,784 - 106,953,448 (+)	RGD
Celera	10	100,615,774 - 100,620,438 (+)	RGD

Sequence:

show sequence

CGCCCTGGAGCCCCTGAGCACCGCCCCTTAACCCGGCGTCCCTGGACACCCCTCCGTGTGAGCTCGGCCTCATGGCCGGAGCCCGGCTCTTTCGGTTCCGGGACGAGCCAGGCCCCGGAGCCGACCCG
ACCGTGCTGGAGGTCCGCGTCCCGCAGGTCCTGCATGTCCAGTATGGGATGTATGTTTGGCCCTGTGCTGTAGTCCTGGCCCAATACCTGTGGTTTCACAGAAGAGTTCTGCCAGGCAAAGCTGTCTT
AGAGATTGGAGCTGGAGTGAGCCTTCCAGGAATTTTGGCTGCCAAATGTGGTGCTAAAGTAACACTATCTGACAGCCCAGAGCTTCCTCATTGTCTGGATATTTGTTGGCAAAGTTGCCAGATGAATA
ACCTGCCACAGGTGCAAATTGTAGGACTGACGTGGGGCCACATATCAAAGGACACTTTGTCATTGCCACCACAAGACATCATTCTTGGATCTGATGTTTTCTTTGAACCAGAAGACTTTGAAAGCATT
TTAGCCACAGTATACTTTCTGATGCAGAAGAATCCCAAAGTTCAATTCTGGTCTACATACCAGGTCAGAAGTGCTGACTGGTCACTGGAAGGCTTGCTCTACAAGTGGGATATGAGGTGTGTGCACAT
TCCTCTGGAGTCTTTTGATGCAGACAAGGAAGATATAGCAGAGTCTACCCTTCCAGGAAGACATACTATTGAAATGCTGATCATCTCCTTTGCAAAGGATAGTTCCTGAATGAATTATACCTCAAGCT
ATTCTGGGACAATGTCTAAATAACATGGCATAAAGATGAATTATCTTGAGAAAACTCAGCGGGTGCAAGTCTTAATGCTGTGATGTCATGCCTACGGCCAACATTTAACTTCAACAAAATTAAACATT
GAAAAGGAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_006247798 ⟹ XP_006247860

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	102,546,102 - 102,550,782 (+)	NCBI
mRatBN7.2	10	102,047,475 - 102,053,379 (+)	NCBI
Rnor_6.0	10	105,788,096 - 105,793,307 (+)	NCBI
Rnor_5.0	10	105,446,488 - 105,451,857 (+)	NCBI

Sequence:

show sequence

GCATCGGCACCCACGTGGAAGCGCCCTCTGGTTGGAGCGTTGGGAATGGGGCATCCCTCACTTC
TGGACTTCGTTCATTAGTGGCGGGTCTGGTATGAAGCCCGATGAAGAGTTCTAGCGGGAAAGTCTTGTCCTGTGATGGTCCTGCATGTCCAGTATGGGATGTATGTTTGGCCCTGTGCTGTAGTCCTG
GCCCAATACCTGTGGTTTCACAGAAGAGTTCTGCCAGGCAAAGCTGTCTTAGAGATTGGAGCTGGAGTGAGCCTTCCAGGAATTTTGGCTGCCAAATGTGGTGCTAAAGTAACACTATCTGACAGCCC
AGAGCTTCCTCATTGTCTGGATATTTGTTGGCAAAGTTGCCAGATGAATAACCTGCCACAGGTGCAAATTGTAGGACTGACGTGGGGCCACATATCAAAGGACACTTTGTCATTGCCACCACAAGACA
TCATTCTTGGATCTGATGTTTTCTTTGAACCAGAAGACTTTGAAAGCATTTTAGCCACAGTATACTTTCTGATGCAGAAGAATCCCAAAGTTCAATTCTGGTCTACATACCAGGTCAGAAGTGCTGAC
TGGTCACTGGAAGGCTTGCTCTACAAGTGGGATATGAGGTGTGTGCACATTCCTCTGGAGTCTTTTGATGCAGACAAGGAAGATATAGCAGAGTCTACCCTTCCAGGAAGACATACTATTGAAATGCT
GATCATCTCCTTTGCAAAGGATAGTTCCTGAATGAATTATACCTCAAGCTATTCTGGGACAATGTCTAAATAACATGGCATAAAGATGAATTATCTTGAGAAAACTCAGCGGGTGCAAGTCTTAATGC
TGTGATGTCATGCCTACGGCCAACATTTAACTTCAACAAAATTAAACATTGAAAAGGACTTGGTCTCTGTTCCCAATCGTTAAAGTTGGTACTGCTATGCCACTAAAAAGCAGAGTCCAACCCACATT
TTCATACCGAGGGAAGGGGCTCAGTATCTTGCATTTTATACTTCTAAGGCTGTTAACATTCAAAGTAATCACATAGACCTTAAGCTGAGGGAAATAAAAGACCAGGACATATTCTCAAAAAAGCTAAC
ACCAAGAAAACACTTTAATCAAACTACAGAAACAATGGTTATAGTACAGAATATTCATAAGCAAAAGATACACCATGTTTTAAGTACTTACAAAGTTACAAACCATTTGCTTCCTTAACATTTTCTGT
TTTTTTTTTAAGTTCACAACACAAGTATCAGATTTACCATTTTGCGCTTTTTTTTTTTGAGGGAAGGGGGGTGTATTTATCATCAGCTAGATGTGCTCACTGTATGCTCCATTATTTATATGCAAGGC
CCGGGTGACTGGAAGTGCAGTTGTCAGGCATTTTAATAAACTGGACAGCCATTTGTTTCTGCACGACAAGGCATCTTTACACAGGAGCAATCAGGAGAAAACAGGAAACAGCCAAGCACTCTGCACTG
CAACACGCCACCTTAACAGCTAACCAGCATTACTCAACTGCTACACAACTGCGCCTAGTGCACAAAAATACATAAGAGAAGAGATTAGAATTGTGTCGGGTAAACAATCCTTTAAAAAAAAAATAA

hide sequence

RefSeq Acc Id:

XM_039085698 ⟹ XP_038941626

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	102,546,140 - 102,550,782 (+)	NCBI
mRatBN7.2	10	102,047,090 - 102,051,795 (+)	NCBI

RefSeq Acc Id:

XM_063268791 ⟹ XP_063124861

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	102,546,368 - 102,550,782 (+)	NCBI


Protein RefSeqs	NP_001008284	(Get FASTA)	NCBI Sequence Viewer
	XP_006247860	(Get FASTA)	NCBI Sequence Viewer
	XP_038941626	(Get FASTA)	NCBI Sequence Viewer
	XP_063124861	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH86594	(Get FASTA)	NCBI Sequence Viewer
	EDM06700	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000000266.3
GenBank Protein	Q5RJL2	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001008284 ⟸ NM_001008283

- UniProtKB:

Q5RJL2 (UniProtKB/Swiss-Prot), A6HKZ5 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAGARLFRFRDEPGPGADPTVLEVRVPQVLHVQYGMYVWPCAVVLAQYLWFHRRVLPGKAVLEIGAGVSLPGILAAKCGAKVTLSDSPELPHCLDICWQSCQMNNLPQVQIVGLTWGHISKDTLSLPP
QDIILGSDVFFEPEDFESILATVYFLMQKNPKVQFWSTYQVRSADWSLEGLLYKWDMRCVHIPLESFDADKEDIAESTLPGRHTIEMLIISFAKDSS

hide sequence

RefSeq Acc Id:	XP_006247860 ⟸ XM_006247798
- Peptide Label:	isoform X1
- Sequence:	show sequence MVLHVQYGMYVWPCAVVLAQYLWFHRRVLPGKAVLEIGAGVSLPGILAAKCGAKVTLSDSPELPHCLDICWQSCQMNNLPQVQIVGLTWGHISKDTLSLPPQDIILGSDVFFEPEDFESILATVYFLM QKNPKVQFWSTYQVRSADWSLEGLLYKWDMRCVHIPLESFDADKEDIAESTLPGRHTIEMLIISFAKDSS hide sequence

Ensembl Acc Id:

ENSRNOP00000000266 ⟸ ENSRNOT00000000266

RefSeq Acc Id:	XP_038941626 ⟸ XM_039085698
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_063124861 ⟸ XM_063268791
- Peptide Label:	isoform X3

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5RJL2-F1-model_v2	AlphaFold	Q5RJL2	1-225	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13697926

Promoter ID:

EPDNEW_R8451

Type:

initiation region

Name:

Mettl23_1

Description:

methyltransferase like 23

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	10	105,787,871 - 105,787,931	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-22580	BioCyc
Ensembl Genes	ENSRNOG00000000249	Ensembl, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000000266.4	UniProtKB/Swiss-Prot
Gene3D-CATH	3.40.50.150	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7310322	IMAGE-MGC_LOAD
InterPro	Methyltransf_16	UniProtKB/Swiss-Prot
	SAM-dependent_MTases	UniProtKB/Swiss-Prot
KEGG Report	rno:287918	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:105570	IMAGE-MGC_LOAD
NCBI Gene	287918	ENTREZGENE
PANTHER	HISTONE-ARGININE METHYLTRANSFERASE METTL23	UniProtKB/Swiss-Prot
	PTHR14614	UniProtKB/Swiss-Prot
Pfam	Methyltransf_16	UniProtKB/Swiss-Prot
PhenoGen	Mettl23	PhenoGen
RatGTEx	ENSRNOG00000000249	RatGTEx
Superfamily-SCOP	SSF53335	UniProtKB/Swiss-Prot
UniProt	A6HKZ5	ENTREZGENE, UniProtKB/TrEMBL
	MET23_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2023-05-12	Mettl23	methyltransferase 23, arginine	Mettl23	methyltransferase like 23	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2011-05-13	Mettl23	methyltransferase like 23	RGD1306284	similar to RIKEN cDNA 1110005A03	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	RGD1306284	similar to RIKEN cDNA 1110005A03	RGD1306284_predicted	similar to RIKEN cDNA 1110005A03 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-20	RGD1306284_predicted	similar to RIKEN cDNA 1110005A03 (predicted)	LOC287918_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC287918_predicted	similar to RIKEN cDNA 1110005A03 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM