Symbol:
Epyc
Name:
epiphycan
RGD ID:
1305904
Description:
Predicted to be involved in articular cartilage development and bone development. Predicted to act upstream of or within sensory perception of sound. Predicted to be located in extracellular region. Predicted to be active in extracellular matrix. Orthologous to human EPYC (epiphycan); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; acrylamide; atrazine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
dermatan sulphate proteoglycan 3; Dspg3; LOC314772
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
EPYC (epiphycan) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Epyc (epiphycan) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Epyc (epiphycan) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
EPYC (epiphycan) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
EPYC (epiphycan) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Epyc (epiphycan) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
EPYC (epiphycan) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
EPYC (epiphycan) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Epyc (epiphycan) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
RNF169 (ring finger protein 169) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
EPYC (epiphycan)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Epyc (epiphycan)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
epyc (epiphycan)
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
optc (opticin)
Alliance
DIOPT (Hieranoid|InParanoid|PANTHER)
Xenopus tropicalis (tropical clawed frog):
epyc
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 34,323,332 - 34,360,845 (+) NCBI GRCr8 mRatBN7.2 7 32,436,620 - 32,474,326 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 32,436,620 - 32,474,135 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 34,410,533 - 34,448,089 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 36,592,032 - 36,629,589 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 36,333,092 - 36,370,648 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 38,897,278 - 38,934,989 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 38,897,278 - 38,934,985 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 38,938,395 - 38,984,932 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 35,160,934 - 35,198,459 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 35,184,757 - 35,218,169 (+) NCBI Celera 7 29,474,164 - 29,511,625 (+) NCBI Celera Cytogenetic Map 7 q13 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Epyc Rat 1,2-dichloroethane decreases expression ISO Epyc (Mus musculus) 6480464 ethylene dichloride results in decreased expression of EPYC mRNA CTD PMID:28960355 Epyc Rat 1,2-dimethylhydrazine decreases expression ISO Epyc (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of EPYC mRNA CTD PMID:22206623 Epyc Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO EPYC (Homo sapiens) 6480464 Cycloheximide inhibits the reaction [Tetrachlorodibenzodioxin results in decreased expression of EPYC mRNA] CTD PMID:11007951 Epyc Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of EPYC mRNA CTD PMID:32109520 Epyc Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Epyc (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of EPYC mRNA CTD PMID:15328365 more ... Epyc Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO EPYC (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of EPYC mRNA CTD PMID:11007951 Epyc Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Epyc (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Epyc Rat 4,4'-diaminodiphenylmethane increases expression ISO Epyc (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of EPYC mRNA CTD PMID:18648102 Epyc Rat 5-fluorouracil affects expression ISO EPYC (Homo sapiens) 6480464 Fluorouracil affects the expression of EPYC mRNA CTD PMID:15205334 Epyc Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of EPYC mRNA CTD PMID:28959563 Epyc Rat aflatoxin B1 decreases methylation ISO EPYC (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of EPYC gene CTD PMID:27153756 Epyc Rat all-trans-retinoic acid increases expression ISO Epyc (Mus musculus) 6480464 Tretinoin results in increased expression of EPYC mRNA CTD PMID:36189433 Epyc Rat arsenous acid decreases expression ISO EPYC (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of EPYC mRNA CTD PMID:26705709 Epyc Rat atrazine increases expression ISO EPYC (Homo sapiens) 6480464 Atrazine results in increased expression of EPYC mRNA CTD PMID:22378314 Epyc Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of EPYC gene CTD PMID:35440735 Epyc Rat benzo[a]pyrene decreases expression ISO EPYC (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of EPYC mRNA CTD PMID:22316170 Epyc Rat bis(2-ethylhexyl) phthalate increases expression ISO Epyc (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of EPYC mRNA CTD PMID:34319233 Epyc Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of EPYC mRNA CTD PMID:25181051 Epyc Rat cadmium sulfate decreases expression ISO EPYC (Homo sapiens) 6480464 cadmium sulfate results in decreased expression of EPYC mRNA CTD PMID:12064557 Epyc Rat CGP 52608 multiple interactions ISO EPYC (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to EPYC gene] CTD PMID:28238834 Epyc Rat cycloheximide multiple interactions ISO EPYC (Homo sapiens) 6480464 Cycloheximide inhibits the reaction [Tetrachlorodibenzodioxin results in decreased expression of EPYC mRNA] CTD PMID:11007951 Epyc Rat diarsenic trioxide decreases expression ISO EPYC (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of EPYC mRNA CTD PMID:26705709 Epyc Rat doxorubicin affects expression ISO EPYC (Homo sapiens) 6480464 Doxorubicin affects the expression of EPYC mRNA CTD PMID:15205334 Epyc Rat entinostat increases expression ISO EPYC (Homo sapiens) 6480464 entinostat results in increased expression of EPYC mRNA CTD PMID:27188386 Epyc Rat ethanol affects expression ISO Epyc (Mus musculus) 6480464 Ethanol affects the expression of EPYC mRNA CTD PMID:30319688 Epyc Rat pioglitazone multiple interactions ISO Epyc (Mus musculus) 6480464 [N-nitroso-tris-chloroethylurea co-treated with pioglitazone] results in decreased expression of EPYC mRNA CTD PMID:27935865 Epyc Rat sodium arsenite decreases expression ISO Epyc (Mus musculus) 6480464 sodium arsenite results in decreased expression of EPYC mRNA CTD PMID:28206643 Epyc Rat T-2 toxin decreases expression ISO EPYC (Homo sapiens) 6480464 T-2 Toxin results in decreased expression of EPYC mRNA CTD PMID:31863870 Epyc Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of EPYC mRNA CTD PMID:33387578 Epyc Rat trimellitic anhydride decreases expression ISO Epyc (Mus musculus) 6480464 trimellitic anhydride results in decreased expression of EPYC mRNA CTD PMID:19042947 Epyc Rat XL147 multiple interactions ISO Epyc (Mus musculus) 6480464 [N-nitroso-tris-chloroethylurea co-treated with XL147] results in decreased expression of EPYC mRNA CTD PMID:27935865
1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 4,4'-diaminodiphenylmethane (ISO) 5-fluorouracil (ISO) acrylamide (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) arsenous acid (ISO) atrazine (EXP,ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP) cadmium sulfate (ISO) CGP 52608 (ISO) cycloheximide (ISO) diarsenic trioxide (ISO) doxorubicin (ISO) entinostat (ISO) ethanol (ISO) pioglitazone (ISO) sodium arsenite (ISO) T-2 toxin (ISO) trichloroethene (EXP) trimellitic anhydride (ISO) XL147 (ISO)
Epyc Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 34,323,332 - 34,360,845 (+) NCBI GRCr8 mRatBN7.2 7 32,436,620 - 32,474,326 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 32,436,620 - 32,474,135 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 34,410,533 - 34,448,089 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 36,592,032 - 36,629,589 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 36,333,092 - 36,370,648 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 38,897,278 - 38,934,989 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 38,897,278 - 38,934,985 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 38,938,395 - 38,984,932 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 35,160,934 - 35,198,459 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 35,184,757 - 35,218,169 (+) NCBI Celera 7 29,474,164 - 29,511,625 (+) NCBI Celera Cytogenetic Map 7 q13 NCBI
EPYC Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 90,963,682 - 91,004,972 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 90,963,682 - 91,005,026 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 91,357,459 - 91,398,749 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 89,881,591 - 89,922,934 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 12 89,859,933 - 89,901,275 NCBI Celera 12 91,028,588 - 91,069,952 (-) NCBI Celera Cytogenetic Map 12 q21.33 NCBI HuRef 12 88,425,207 - 88,466,578 (-) NCBI HuRef CHM1_1 12 91,322,430 - 91,363,770 (-) NCBI CHM1_1 T2T-CHM13v2.0 12 90,941,190 - 90,982,485 (-) NCBI T2T-CHM13v2.0
Epyc Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 10 97,479,930 - 97,517,770 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 10 97,479,930 - 97,518,316 (+) Ensembl GRCm39 Ensembl GRCm38 10 97,644,068 - 97,681,908 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 97,644,068 - 97,682,454 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 10 97,106,702 - 97,144,534 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 10 97,073,756 - 97,111,588 (+) NCBI MGSCv36 mm8 Celera 10 99,615,059 - 99,652,892 (+) NCBI Celera Cytogenetic Map 10 C3 NCBI cM Map 10 50.35 NCBI
Epyc Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955405 28,182,829 - 28,212,870 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955405 28,182,890 - 28,212,864 (-) NCBI ChiLan1.0 ChiLan1.0
EPYC Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 98,996,926 - 99,038,247 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 98,993,320 - 99,034,641 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 88,497,063 - 88,538,440 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 91,812,513 - 91,853,875 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 12 91,812,513 - 91,853,875 (-) Ensembl panpan1.1 panPan2
EPYC Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 15 31,670,926 - 31,708,667 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 15 31,671,182 - 31,708,674 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 15 32,125,595 - 32,163,398 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 15 32,326,679 - 32,364,492 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 15 32,326,938 - 32,364,484 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 15 31,619,635 - 31,657,393 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 15 31,682,947 - 31,720,906 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 15 31,976,132 - 32,014,138 (-) NCBI UU_Cfam_GSD_1.0
Epyc Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 28,473,084 - 28,509,259 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936507 7,726,646 - 7,759,989 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936507 7,726,539 - 7,759,989 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
EPYC Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 5 91,832,291 - 91,877,982 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 5 91,837,672 - 91,877,779 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 5 96,316,644 - 96,356,417 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
EPYC Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 11 86,373,807 - 86,423,670 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 11 86,374,285 - 86,419,226 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 158,763,843 - 158,811,341 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Epyc
.
Predicted Target Of
Count of predictions: 470 Count of miRNA genes: 220 Interacting mature miRNAs: 260 Transcripts: ENSRNOT00000006450, ENSRNOT00000072166 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1354644 Spl4 Serum phospholipid level QTL 4 4.9 blood phospholipid amount (VT:0006084) blood phospholipid level (CMO:0001169) 7 19654317 49753746 Rat 7411569 Bw137 Body weight QTL 137 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 7 21921195 66921195 Rat 9590102 Sffal5 Serum free fatty acids level QTL 5 8.62 0.001 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 7 5329019 50329019 Rat 1578652 Bmd15 Bone mineral density QTL 15 5.2 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 7 9866467 60460686 Rat 1641885 Alcrsp9 Alcohol response QTL 9 alcohol metabolism trait (VT:0015089) blood ethanol level (CMO:0000535) 7 24099606 69099606 Rat 631503 Bp102 Blood pressure QTL 102 1.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 1 44822433 Rat 1549840 Bss5 Bone structure and strength QTL 5 9.8 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 7 24751841 69751841 Rat 10755438 Coatc9 Coat color QTL 9 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 3529280 48529280 Rat 1300127 Srn1 Serum renin concentration QTL 1 3.87 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 7 29409683 84928080 Rat 2298547 Neuinf5 Neuroinflammation QTL 5 3.7 nervous system integrity trait (VT:0010566) spinal cord Cd74 protein level (CMO:0002131) 7 9462246 58265113 Rat 10059592 Kidm45 Kidney mass QTL 45 3.95 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 7 7573985 52573985 Rat 2317047 Wbc4 White blood cell count QTL 4 0.01 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 7 1 35342956 Rat 10755440 Coatc10 Coat color QTL 10 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 7496499 52496499 Rat 1354637 Scl30 Serum cholesterol level QTL 30 3.7 blood cholesterol amount (VT:0000180) blood total cholesterol level (CMO:0000051) 7 19654317 49753746 Rat 10755453 Coatc12 Coat color QTL 12 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 31112832 76112832 Rat 724560 Plsm3 Polydactyly-luxate syndrome (PLS) morphotypes QTL 3 0.0003 tibia length (VT:0004357) tibia length (CMO:0000450) 7 1 34000259 Rat 1354639 Spl5 Serum phospholipid level QTL 5 3.9 blood LDL phospholipid amount (VT:0010505) blood low density lipoprotein phospholipid level (CMO:0001568) 7 19654317 52888450 Rat 10755451 Coatc11 Coat color QTL 11 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 17944357 62944357 Rat 2317059 Aia15 Adjuvant induced arthritis QTL 15 2.46 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 7 17004598 62004598 Rat 61410 Bw19 Body weight QTL 19 6.2 0.001 body mass (VT:0001259) body weight (CMO:0000012) 7 1 44782185 Rat 1643004 Pain2 Pain QTL 2 1 mechanical nociception trait (VT:0002734) self mutilation severity score (CMO:0002145) 7 9462246 98011544 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 1582260 Bw72 Body weight QTL 72 3.2 0.0043 body mass (VT:0001259) body weight (CMO:0000012) 7 15795565 38073970 Rat 1582261 Bw69 Body weight QTL 69 3.2 0.0048 body mass (VT:0001259) body weight (CMO:0000012) 7 15795565 38073970 Rat 1582262 Bw75 Body weight QTL 75 3 0.0038 body mass (VT:0001259) body weight (CMO:0000012) 7 15795565 38073970 Rat 70190 Mcs6 Mammary carcinoma susceptibility QTL 6 2.29 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 7 26737401 63902784 Rat 1300132 Bp182 Blood pressure QTL 182 3.49 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 7 19654317 84928080 Rat 61369 Mcs2 Mammary carcinoma susceptibility QTL 2 3.38 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 7 19032807 35526300 Rat 1300138 Hrtrt9 Heart rate QTL 9 4.72 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 7 29409683 53612950 Rat 10402855 Bp379 Blood pressure QTL 379 0.21 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 29409683 74409683 Rat 738033 Anxrr6 Anxiety related response QTL 6 4.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 7 15573889 60573889 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
5
8
42
100
48
46
19
21
19
6
140
76
83
32
58
27
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000006450 ⟹ ENSRNOP00000006450
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 32,436,620 - 32,474,135 (+) Ensembl Rnor_6.0 Ensembl 7 38,897,278 - 38,934,798 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000072166 ⟹ ENSRNOP00000067851
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 7 38,900,593 - 38,934,985 (+) Ensembl
RefSeq Acc Id:
NM_001108088 ⟹ NP_001101558
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 34,323,332 - 34,360,845 (+) NCBI mRatBN7.2 7 32,436,620 - 32,474,135 (+) NCBI Rnor_6.0 7 38,897,278 - 38,934,798 (+) NCBI Rnor_5.0 7 38,938,395 - 38,984,932 (+) NCBI RGSC_v3.4 7 35,160,934 - 35,198,459 (+) RGD Celera 7 29,474,164 - 29,511,625 (+) RGD
Sequence:
GTAATGTGCCACCAAGACAAATGAAACATACCAGAATTCATATCCATTGGTCAGAGGTAAATACCAAGGACTCTGTATGCTCAGTCACCCTGTGCCACTTCGTCAAGTCGGAGCCAAAGAAATCTCAA
hide sequence
RefSeq Acc Id:
XM_006241286 ⟹ XP_006241348
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 34,326,541 - 34,360,727 (+) NCBI mRatBN7.2 7 32,439,824 - 32,474,326 (+) NCBI Rnor_6.0 7 38,900,440 - 38,934,989 (+) NCBI Rnor_5.0 7 38,938,395 - 38,984,932 (+) NCBI
Sequence:
TCGAGATTTCAGTTAACATTAGTGAAAAGGGAACCATGTAATCCAAGATATGCAAAGTGAGGGGGAATTATTCCTTCTTAGTCTATTTACTTAAGAAACCCTCGCCTACAATAACCTCATGCCCATTC
hide sequence
RefSeq Acc Id:
NP_001101558 ⟸ NM_001108088
- Sequence:
MKHTRIHIHWSEVNTKDSVCSVTLCHFVKSEPKKSQKMRMAARIVLVLIIIDATLAAPTTELFNYDSEVYDAILEDTGTFYNYEHIPDNQVETEKVAERLSGNRELLTPGPQLGDSQDEDKDEESTPR
hide sequence
RefSeq Acc Id:
XP_006241348 ⟸ XM_006241286
- Peptide Label:
isoform X1
- Sequence:
MRMAARIVLVLIIIDATLAAPTTELFNYDSEVYDAILEDTGTFYNYEHIPDNQVETEKVAERLSGNRELLTPGPQLGDSQDEDKDEESTPRLIDGSSPQEPEFPGLLGPHTNEDFPTCLLCTCISTTV
hide sequence
Ensembl Acc Id:
ENSRNOP00000006450 ⟸ ENSRNOT00000006450
Ensembl Acc Id:
ENSRNOP00000067851 ⟸ ENSRNOT00000072166
RGD ID: 13695172 Promoter ID: EPDNEW_R5690 Type: initiation region Name: Epyc_1 Description: epiphycan SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R5691 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 7 38,900,578 - 38,900,638 EPDNEW
RGD ID: 13695166 Promoter ID: EPDNEW_R5691 Type: initiation region Name: Epyc_2 Description: epiphycan SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R5690 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 7 38,900,881 - 38,900,941 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-03-04
Epyc
epiphycan
Dspg3_predicted
dermatan sulphate proteoglycan 3 (predicted)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-12
Dspg3_predicted
dermatan sulphate proteoglycan 3 (predicted)
Symbol and Name status set to approved
70820 APPROVED
