Symbol:
Clcn6
Name:
chloride voltage-gated channel 6
RGD ID:
1305379
Description:
Predicted to enable voltage-gated chloride channel activity. Involved in response to mechanical stimulus. Predicted to be located in membrane. Predicted to be active in intracellular membrane-bounded organelle. Human ortholog(s) of this gene implicated in coronary artery disease. Orthologous to human CLCN6 (chloride voltage-gated channel 6); INTERACTS WITH 1-naphthyl isothiocyanate; 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
chloride channel 6; chloride channel, voltage-sensitive 6; chloride transport protein 6; H(+)/Cl(-) exchange transporter 6; LOC295586
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CLCN6 (chloride voltage-gated channel 6) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther
Mus musculus (house mouse):
Clcn6 (chloride channel, voltage-sensitive 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Clcn6 (chloride voltage-gated channel 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CLCN6 (chloride voltage-gated channel 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CLCN6 (chloride voltage-gated channel 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Clcn6 (chloride voltage-gated channel 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CLCN6 (chloride voltage-gated channel 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CLCN6 (chloride voltage-gated channel 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Clcn6 (chloride voltage-gated channel 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
CLCN6 (chloride voltage-gated channel 6)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Clcn6 (chloride channel, voltage-sensitive 6)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
clcn6 (chloride channel 6)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
clcn6
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Allele / Splice:
Clcn6em2Mcwi
Genetic Models:
SS-Clcn6em2Mcwi
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 163,715,593 - 163,748,301 (-) NCBI GRCr8 mRatBN7.2 5 158,434,299 - 158,465,174 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 158,434,299 - 158,465,059 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 161,151,048 - 161,181,808 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 162,978,934 - 163,010,217 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 162,935,283 - 162,966,566 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 164,811,815 - 164,844,554 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 164,811,816 - 164,844,586 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 168,469,718 - 168,502,323 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 165,079,773 - 165,110,594 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 165,090,327 - 165,120,752 (-) NCBI Celera 5 156,716,141 - 156,746,803 (-) NCBI Celera Cytogenetic Map 5 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Clcn6 Rat 1,1-dichloroethene decreases expression ISO Clcn6 (Mus musculus) 6480464 vinylidene chloride results in decreased expression of CLCN6 mRNA CTD PMID:26682919 Clcn6 Rat 1,2-dimethylhydrazine increases expression ISO Clcn6 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of CLCN6 mRNA CTD PMID:22206623 Clcn6 Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of CLCN6 mRNA CTD PMID:30723492 Clcn6 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression EXP 6480464 2 more ... CTD PMID:27291303 Clcn6 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of CLCN6 mRNA CTD PMID:22298810 Clcn6 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of CLCN6 mRNA CTD PMID:33387578 Clcn6 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Clcn6 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of CLCN6 mRNA CTD PMID:21570461 Clcn6 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of CLCN6 mRNA CTD PMID:21346803 Clcn6 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of CLCN6 mRNA CTD PMID:21346803 Clcn6 Rat 2-bromohexadecanoic acid multiple interactions ISO CLCN6 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of CLCN6 protein] CTD PMID:38195004 Clcn6 Rat 2-methylcholine affects expression ISO CLCN6 (Homo sapiens) 6480464 beta-methylcholine affects the expression of CLCN6 mRNA CTD PMID:21179406 Clcn6 Rat 4,4'-diaminodiphenylmethane affects expression ISO Clcn6 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane affects the expression of CLCN6 mRNA CTD PMID:18648102 Clcn6 Rat 4,4'-sulfonyldiphenol increases methylation ISO CLCN6 (Homo sapiens) 6480464 bisphenol S results in increased methylation of CLCN6 gene CTD PMID:31601247 Clcn6 Rat 4,4'-sulfonyldiphenol affects methylation ISO Clcn6 (Mus musculus) 6480464 bisphenol S affects the methylation of CLCN6 gene CTD PMID:31683443 Clcn6 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of CLCN6 mRNA CTD PMID:31881176 Clcn6 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of CLCN6 mRNA CTD PMID:28959563 Clcn6 Rat aflatoxin B1 increases expression ISO Clcn6 (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of CLCN6 mRNA CTD PMID:19770486 Clcn6 Rat aflatoxin B1 increases methylation ISO CLCN6 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of CLCN6 gene CTD PMID:27153756 Clcn6 Rat all-trans-retinoic acid increases expression ISO CLCN6 (Homo sapiens) 6480464 Tretinoin results in increased expression of CLCN6 mRNA CTD PMID:23724009 and PMID:33167477 Clcn6 Rat amiodarone increases expression ISO CLCN6 (Homo sapiens) 6480464 Amiodarone results in increased expression of CLCN6 mRNA CTD PMID:19774075 Clcn6 Rat arsane multiple interactions ISO CLCN6 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of CLCN6 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of CLCN6 mRNA CTD PMID:39836092 Clcn6 Rat arsenic atom multiple interactions ISO CLCN6 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of CLCN6 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of CLCN6 mRNA CTD PMID:39836092 Clcn6 Rat benzo[a]pyrene decreases expression ISO CLCN6 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of CLCN6 mRNA CTD PMID:26238291 Clcn6 Rat benzo[a]pyrene decreases methylation ISO CLCN6 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of CLCN6 promoter CTD PMID:27901495 Clcn6 Rat beta-lapachone decreases expression ISO CLCN6 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of CLCN6 mRNA CTD PMID:38218311 Clcn6 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of CLCN6 mRNA CTD PMID:25181051 Clcn6 Rat bisphenol A increases expression ISO Clcn6 (Mus musculus) 6480464 bisphenol A results in increased expression of CLCN6 mRNA CTD PMID:38074096 Clcn6 Rat bisphenol A decreases expression ISO Clcn6 (Mus musculus) 6480464 bisphenol A results in decreased expression of CLCN6 mRNA CTD PMID:32156529 Clcn6 Rat bisphenol A affects methylation ISO CLCN6 (Homo sapiens) 6480464 bisphenol A affects the methylation of CLCN6 gene CTD PMID:31601247 Clcn6 Rat bisphenol A multiple interactions ISO CLCN6 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of CLCN6 gene CTD PMID:31601247 Clcn6 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of CLCN6 mRNA CTD PMID:32145629 Clcn6 Rat butan-1-ol multiple interactions ISO CLCN6 (Homo sapiens) 6480464 [[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in decreased expression of CLCN6 mRNA CTD PMID:29432896 Clcn6 Rat cadmium atom multiple interactions ISO CLCN6 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of CLCN6 protein] and [Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of CLCN6 protein CTD PMID:38195004 Clcn6 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of CLCN6 mRNA CTD PMID:33453195 Clcn6 Rat cadmium dichloride multiple interactions ISO CLCN6 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of CLCN6 protein] and [Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of CLCN6 protein CTD PMID:38195004 Clcn6 Rat cadmium dichloride decreases expression ISO CLCN6 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of CLCN6 mRNA CTD PMID:26472689 Clcn6 Rat chlorpyrifos increases expression ISO Clcn6 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of CLCN6 mRNA CTD PMID:37019170 Clcn6 Rat copper(II) chloride increases expression ISO CLCN6 (Homo sapiens) 6480464 cupric chloride results in increased expression of CLCN6 mRNA CTD PMID:17211630 Clcn6 Rat copper(II) chloride decreases expression ISO CLCN6 (Homo sapiens) 6480464 cupric chloride results in decreased expression of CLCN6 mRNA CTD PMID:34921933 Clcn6 Rat CU-O LINKAGE increases expression ISO CLCN6 (Homo sapiens) 6480464 cupric oxide results in increased expression of CLCN6 mRNA CTD PMID:22077320 Clcn6 Rat curcumin decreases expression ISO CLCN6 (Homo sapiens) 6480464 Curcumin results in decreased expression of CLCN6 mRNA CTD PMID:17198877 Clcn6 Rat cyclosporin A increases expression ISO CLCN6 (Homo sapiens) 6480464 Cyclosporine results in increased expression of CLCN6 mRNA CTD PMID:25562108 Clcn6 Rat DDE decreases expression ISO CLCN6 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of CLCN6 mRNA CTD PMID:38568856 Clcn6 Rat diazinon increases methylation ISO CLCN6 (Homo sapiens) 6480464 Diazinon results in increased methylation of CLCN6 gene CTD PMID:22964155 Clcn6 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of CLCN6 mRNA CTD PMID:21266533 Clcn6 Rat dicrotophos increases expression ISO CLCN6 (Homo sapiens) 6480464 dicrotophos results in increased expression of CLCN6 mRNA CTD PMID:28302478 Clcn6 Rat disodium selenite decreases expression ISO CLCN6 (Homo sapiens) 6480464 Sodium Selenite results in decreased expression of CLCN6 mRNA CTD PMID:18175754 Clcn6 Rat doxorubicin decreases expression ISO CLCN6 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of CLCN6 mRNA CTD PMID:29803840 Clcn6 Rat epoxiconazole affects expression ISO Clcn6 (Mus musculus) 6480464 epoxiconazole affects the expression of CLCN6 mRNA CTD PMID:35436446 Clcn6 Rat ethanol increases expression ISO Clcn6 (Mus musculus) 6480464 Ethanol results in increased expression of CLCN6 mRNA CTD PMID:30319688 Clcn6 Rat ethanol affects splicing ISO Clcn6 (Mus musculus) 6480464 Ethanol affects the splicing of CLCN6 mRNA CTD PMID:30319688 Clcn6 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of CLCN6 mRNA CTD PMID:24793618 Clcn6 Rat fulvestrant multiple interactions ISO CLCN6 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of CLCN6 gene CTD PMID:31601247 Clcn6 Rat furan decreases expression EXP 6480464 furan results in decreased expression of CLCN6 mRNA CTD PMID:26194646 Clcn6 Rat genistein increases expression ISO Clcn6 (Mus musculus) 6480464 Genistein results in increased expression of CLCN6 mRNA CTD PMID:32186404 Clcn6 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of CLCN6 mRNA CTD PMID:33387578 Clcn6 Rat isobutanol multiple interactions ISO CLCN6 (Homo sapiens) 6480464 [[Gasoline co-treated with isobutyl alcohol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in decreased expression of CLCN6 mRNA CTD PMID:29432896 Clcn6 Rat manganese atom multiple interactions ISO CLCN6 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of CLCN6 mRNA CTD PMID:39836092 Clcn6 Rat manganese(0) multiple interactions ISO CLCN6 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of CLCN6 mRNA CTD PMID:39836092 Clcn6 Rat manganese(II) chloride multiple interactions ISO CLCN6 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of CLCN6 mRNA CTD PMID:39836092 Clcn6 Rat methamphetamine increases expression ISO Clcn6 (Mus musculus) 6480464 Methamphetamine results in increased expression of CLCN6 mRNA CTD PMID:26307267 Clcn6 Rat ozone multiple interactions ISO Clcn6 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of CLCN6 mRNA CTD PMID:34911549 Clcn6 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of CLCN6 mRNA CTD PMID:33387578 Clcn6 Rat phenytoin decreases expression EXP 6480464 Phenytoin results in decreased expression of CLCN6 mRNA CTD PMID:20345932 Clcn6 Rat pravastatin increases expression ISO Clcn6 (Mus musculus) 6480464 Pravastatin results in increased expression of CLCN6 mRNA CTD PMID:27225895 Clcn6 Rat pravastatin increases expression EXP 6480464 Pravastatin results in increased expression of CLCN6 mRNA CTD PMID:27225895 Clcn6 Rat raloxifene increases expression ISO CLCN6 (Homo sapiens) 6480464 Raloxifene Hydrochloride results in increased expression of CLCN6 mRNA CTD PMID:16497877 Clcn6 Rat sodium arsenite affects expression ISO CLCN6 (Homo sapiens) 6480464 sodium arsenite affects the expression of CLCN6 mRNA CTD PMID:29319823 Clcn6 Rat sodium arsenite multiple interactions ISO CLCN6 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of CLCN6 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of CLCN6 mRNA CTD PMID:39836092 Clcn6 Rat sunitinib increases expression ISO CLCN6 (Homo sapiens) 6480464 Sunitinib results in increased expression of CLCN6 mRNA CTD PMID:31533062 Clcn6 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of CLCN6 mRNA CTD PMID:31150632 Clcn6 Rat titanium dioxide decreases expression ISO Clcn6 (Mus musculus) 6480464 titanium dioxide results in decreased expression of CLCN6 mRNA CTD PMID:29264374 Clcn6 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of CLCN6 mRNA CTD PMID:33387578 Clcn6 Rat triphenyl phosphate affects expression ISO CLCN6 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of CLCN6 mRNA CTD PMID:37042841 Clcn6 Rat zaragozic acid A increases expression EXP 6480464 squalestatin 1 results in increased expression of CLCN6 mRNA CTD PMID:27225895 Clcn6 Rat zaragozic acid A increases expression ISO Clcn6 (Mus musculus) 6480464 squalestatin 1 results in increased expression of CLCN6 mRNA CTD PMID:27225895
1,1-dichloroethene (ISO) 1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (EXP) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 2-bromohexadecanoic acid (ISO) 2-methylcholine (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) acetamide (EXP) acrylamide (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) amiodarone (ISO) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) beta-lapachone (ISO) bisphenol A (EXP,ISO) butan-1-ol (ISO) cadmium atom (ISO) cadmium dichloride (EXP,ISO) chlorpyrifos (ISO) copper(II) chloride (ISO) CU-O LINKAGE (ISO) curcumin (ISO) cyclosporin A (ISO) DDE (ISO) diazinon (ISO) dibutyl phthalate (EXP) dicrotophos (ISO) disodium selenite (ISO) doxorubicin (ISO) epoxiconazole (ISO) ethanol (ISO) flutamide (EXP) fulvestrant (ISO) furan (EXP) genistein (ISO) gentamycin (EXP) isobutanol (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methamphetamine (ISO) ozone (ISO) paracetamol (EXP) phenytoin (EXP) pravastatin (EXP,ISO) raloxifene (ISO) sodium arsenite (ISO) sunitinib (ISO) tetrachloromethane (EXP) titanium dioxide (ISO) trichloroethene (EXP) triphenyl phosphate (ISO) zaragozic acid A (EXP,ISO)
Clcn6 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 163,715,593 - 163,748,301 (-) NCBI GRCr8 mRatBN7.2 5 158,434,299 - 158,465,174 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 158,434,299 - 158,465,059 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 161,151,048 - 161,181,808 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 162,978,934 - 163,010,217 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 162,935,283 - 162,966,566 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 164,811,815 - 164,844,554 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 164,811,816 - 164,844,586 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 168,469,718 - 168,502,323 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 165,079,773 - 165,110,594 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 165,090,327 - 165,120,752 (-) NCBI Celera 5 156,716,141 - 156,746,803 (-) NCBI Celera Cytogenetic Map 5 q36 NCBI
CLCN6 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 11,806,191 - 11,843,130 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 11,806,096 - 11,848,079 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 11,866,248 - 11,903,187 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 11,788,794 - 11,825,788 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 1 10,979,829 - 11,016,824 (+) NCBI Celera Cytogenetic Map 1 p36.22 NCBI HuRef 1 11,021,210 - 11,058,258 (+) NCBI HuRef CHM1_1 1 11,854,047 - 11,891,095 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 11,350,275 - 11,387,211 (+) NCBI T2T-CHM13v2.0
Clcn6 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 148,088,716 - 148,123,270 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 148,088,716 - 148,123,278 (-) Ensembl GRCm39 Ensembl GRCm38 4 148,004,259 - 148,038,813 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 148,004,259 - 148,038,821 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 147,380,593 - 147,412,876 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 146,850,284 - 146,882,567 (-) NCBI MGSCv36 mm8 Celera 4 150,272,852 - 150,305,364 (-) NCBI Celera Cytogenetic Map 4 E1 NCBI cM Map 4 78.67 NCBI
Clcn6 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955486 2,064,916 - 2,096,317 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955486 2,066,317 - 2,096,317 (-) NCBI ChiLan1.0 ChiLan1.0
CLCN6 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 216,380,834 - 216,418,073 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 215,026,384 - 215,063,498 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 10,568,222 - 10,605,459 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 11,785,643 - 11,822,505 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 11,785,643 - 11,822,505 (+) Ensembl panpan1.1 panPan2
CLCN6 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 2 84,410,740 - 84,443,874 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 2 84,413,612 - 84,445,033 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 2 80,943,970 - 80,978,766 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 2 85,075,630 - 85,110,501 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 2 85,075,631 - 85,108,811 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 2 81,824,232 - 81,859,027 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 2 82,824,152 - 82,858,937 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 2 83,886,934 - 83,921,795 (-) NCBI UU_Cfam_GSD_1.0
Clcn6
CLCN6 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 71,881,972 - 71,916,029 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 71,881,912 - 71,915,016 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 65,791,512 - 65,825,675 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CLCN6 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 119,948,442 - 119,987,553 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 119,948,448 - 119,987,419 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666054 23,816,466 - 23,855,604 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Clcn6
.
Predicted Target Of
Count of predictions: 136 Count of miRNA genes: 103 Interacting mature miRNAs: 118 Transcripts: ENSRNOT00000011287 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
10053720 Scort26 Serum corticosterone level QTL 26 2.06 0.0147 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 5 124965598 166875058 Rat 631272 Lanf1 Left ventricular atrial natriuretic factor QTL 1 12 heart left ventricle natriuretic peptide A amount (VT:0010596) heart left ventricle natriuretic peptide A level (CMO:0002165) 5 151113452 166875058 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 2302369 Scl60 Serum cholesterol level QTL 60 3.13 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 143608201 161165651 Rat 631562 Apr2 Acute phase response QTL 2 3.7 blood murinoglobulin 1 amount (VT:0010597) plasma murinoglobulin 1 level (CMO:0001931) 5 135927956 166875058 Rat 634349 Bp139 Blood pressure QTL 139 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 128924607 166875058 Rat 61444 Strs2 Sensitivity to stroke QTL 2 4.7 cerebrum integrity trait (VT:0010549) post-insult time to onset of cerebrovascular lesion (CMO:0002343) 5 135929696 166875058 Rat 724525 Bp147 Blood pressure QTL 147 4.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 126424772 166875058 Rat 1549904 Neuinf1 Neuroinflammation QTL 1 3 0 nervous system integrity trait (VT:0010566) blood T lymphocyte count (CMO:0000110) 5 154828214 166875058 Rat 738018 Anxrr4 Anxiety related response QTL 4 5.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 5 130130159 166875058 Rat 2313096 Bmd78 Bone mineral density QTL 78 3.1 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 5 144377876 161317411 Rat 8552908 Pigfal4 Plasma insulin-like growth factor 1 level QTL 4 6.6 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 128506074 166875058 Rat 61393 Bp7 Blood pressure QTL 7 4.5 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 60293434 161481680 Rat 7794791 Mcs33 Mammary carcinoma susceptibility QTL 33 1.93 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 5 131345754 166875058 Rat 1354631 Swd2 Spike wave discharge measurement QTL 2 3.64 0.0002 brain electrophysiology trait (VT:0010557) brain total spike-and-wave discharge duration (CMO:0001740) 5 151113452 164465185 Rat 1302790 Scl20 Serum cholesterol level QTL 20 6.4 0.0001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 82394392 166664054 Rat 1598861 Cm64 Cardiac mass QTL 64 2.9 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 127798274 166875058 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 631505 Bp103 Blood pressure QTL 103 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 132717196 165560427 Rat 1641920 Colcs1 Colorectal carcinoma susceptibility QTL 1 2.99 0.0055 intestine integrity trait (VT:0010554) benign colorectal tumor surface area measurement (CMO:0001799) 5 121846814 166846814 Rat 1298090 Bp155 Blood pressure QTL 155 3.8 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 5 151006154 161165494 Rat 1598819 Bp292 Blood pressure QTL 292 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 127798274 166875058 Rat 8694169 Bw148 Body weight QTL 148 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 128506074 166875058 Rat 1331721 Bp210 Blood pressure QTL 210 3.413 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 5 143069996 166846814 Rat
This gene Clcn6 is modified in the following models/strains:
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000011287 ⟹ ENSRNOP00000011287
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 158,434,299 - 158,465,059 (-) Ensembl Rnor_6.0 Ensembl 5 164,811,816 - 164,844,586 (-) Ensembl
RefSeq Acc Id:
NM_001106479 ⟹ NP_001099949
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 163,717,439 - 163,748,198 (-) NCBI mRatBN7.2 5 158,434,299 - 158,465,059 (-) NCBI Rnor_6.0 5 164,813,662 - 164,844,421 (-) NCBI Rnor_5.0 5 168,469,718 - 168,502,323 (-) NCBI RGSC_v3.4 5 165,079,773 - 165,110,594 (-) RGD Celera 5 156,716,141 - 156,746,803 (-) RGD
Sequence:
GGTGGTCCGGAGTGGCAGGAAAGGAGGAAGATGGCGGGGTGCAGGGGGTCTGTGTGCTGCTGCTGCAGGTGGTGCTGCTGCTGCGGCGAACGCGAGAGCCGCACTCCCGAGGAGCTGACCATCCTTGG
hide sequence
RefSeq Acc Id:
XM_006239378 ⟹ XP_006239440
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 163,715,593 - 163,747,944 (-) NCBI mRatBN7.2 5 158,434,804 - 158,464,826 (-) NCBI Rnor_6.0 5 164,811,815 - 164,844,192 (-) NCBI Rnor_5.0 5 168,469,718 - 168,502,323 (-) NCBI
Sequence:
GGGCCCGGGGACCGCTGCCTGAGCTCTGGAAGCATCCGTCTTTCTTGGCGCGCCCAAGTCAGAGTTCTATTCTCATAACCTCTCTCTGGACTCTGAGGGAGGATCTCGGCCAGCTTGGGTTGATGCCA
hide sequence
RefSeq Acc Id:
XM_039109375 ⟹ XP_038965303
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 163,722,509 - 163,748,301 (-) NCBI mRatBN7.2 5 158,439,370 - 158,465,174 (-) NCBI
RefSeq Acc Id:
XM_039109377 ⟹ XP_038965305
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 163,715,593 - 163,729,510 (-) NCBI mRatBN7.2 5 158,434,804 - 158,446,373 (-) NCBI
RefSeq Acc Id:
XR_592730
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 163,720,409 - 163,748,293 (-) NCBI mRatBN7.2 5 158,437,269 - 158,465,168 (-) NCBI Rnor_6.0 5 164,816,648 - 164,844,554 (-) NCBI
Sequence:
TGTGACGCGAGCTCTCGCCCCACCCGTCTGCAGCCACTCCCTGTCTCCGGACCCAAAGCTCGAGAGGGCCACGTGACCCTCCCGGGGCCAGTCACGTGAGGCGCAGATCCTGGGTGGGAGGGGGGTTG
hide sequence
RefSeq Acc Id:
NP_001099949 ⟸ NM_001106479
- UniProtKB:
D4A3H5 (UniProtKB/TrEMBL), A6IU39 (UniProtKB/TrEMBL)
- Sequence:
MAGCRGSVCCCCRWCCCCGERESRTPEELTILGETQEEEDEILPRKDYESLDYDRCINDPYLEVLETMDNKKGRRHEAVKWMVVFAIGVCTGLVGLFVDFSVRLFTQLKFGVVQTSVEECSQKGCLAL
hide sequence
RefSeq Acc Id:
XP_006239440 ⟸ XM_006239378
- Peptide Label:
isoform X1
- UniProtKB:
D4A3H5 (UniProtKB/TrEMBL)
- Sequence:
MDNKKGRRHEAVKWMVVFAIGVCTGLVGLFVDFSVRLFTQLKFGVVQTSVEECSQKGCLALSLLELLGFNLTFVFLASLLVLIEPVAAGSGIPEIKCYLNGVKVPGIVRLRTLLCKVFGVLFSVAGGL
hide sequence
Ensembl Acc Id:
ENSRNOP00000011287 ⟸ ENSRNOT00000011287
RefSeq Acc Id:
XP_038965305 ⟸ XM_039109377
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_038965303 ⟸ XM_039109375
- Peptide Label:
isoform X2
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2013-05-24
Clcn6
chloride channel, voltage-sensitive 6
LOC680079
similar to Chloride channel protein 6 (ClC-6)
Data merged from RGD:1596809
1643240 APPROVED
2012-07-05
LOC680079
similar to Chloride channel protein 6 (ClC-6)
LOC680079
similar to Chloride channel protein 6 (ClC-6)
Gene reactivated at release of RGSC5.0 assembly
2298974 REACTIVATED
2008-04-30
Clcn6
chloride channel 6
Clcn6_predicted
chloride channel 6 (predicted)
'predicted' is removed
2292626 APPROVED
2006-11-20
LOC680079
similar to Chloride channel protein 6 (ClC-6)
Symbol and Name status set to provisional
70820 PROVISIONAL
2005-01-12
Clcn6_predicted
chloride channel 6 (predicted)
Symbol and Name status set to approved
70820 APPROVED
