Symbol:
Chmp2a
Name:
charged multivesicular body protein 2A
RGD ID:
1305050
Description:
Predicted to enable phosphatidylcholine binding activity and protein domain specific binding activity. Predicted to be involved in several processes, including mitotic nuclear division; protein-containing complex assembly; and regulation of cell cycle process. Predicted to be located in several cellular components, including bounding membrane of organelle; chromosome; and kinetochore microtubule. Predicted to be part of ESCRT III complex; membrane coat; and nuclear pore. Orthologous to human CHMP2A (charged multivesicular body protein 2A); PARTICIPATES IN endocytosis pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 4,4'-sulfonyldiphenol; amphetamine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
chromatin modifying protein 2A; LOC365191; RGD1305050; similar to RIKEN cDNA 1500016L11
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 82,731,212 - 82,735,088 (-) NCBI GRCr8 mRatBN7.2 1 73,660,045 - 73,662,894 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 73,660,046 - 73,662,452 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 79,040,454 - 79,042,837 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 87,604,795 - 87,607,178 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 80,795,536 - 80,797,919 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 65,540,808 - 65,543,708 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 65,541,322 - 65,543,707 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 66,352,033 - 66,354,941 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 72,889,349 - 72,891,734 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 72,966,677 - 72,969,771 (+) NCBI Celera 1 60,177,374 - 60,179,759 (+) NCBI Celera Cytogenetic Map 1 q21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Chmp2a Rat 1,2-dimethylhydrazine multiple interactions ISO RGD:1550598 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of CHMP2A mRNA CTD PMID:22206623 Chmp2a Rat 17alpha-ethynylestradiol affects expression ISO RGD:1550598 6480464 Ethinyl Estradiol affects the expression of CHMP2A mRNA CTD PMID:17555576 Chmp2a Rat 17beta-estradiol decreases expression ISO RGD:1603659 6480464 Estradiol results in decreased expression of CHMP2A mRNA CTD PMID:23019147 Chmp2a Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1550598 6480464 Tetrachlorodibenzodioxin affects the expression of CHMP2A mRNA CTD PMID:21570461 Chmp2a Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of CHMP2A mRNA CTD PMID:33387578 Chmp2a Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:1550598 6480464 bisphenol S results in increased expression of CHMP2A mRNA CTD PMID:39298647 Chmp2a Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of more ... CTD PMID:36041667 Chmp2a Rat 4,4'-sulfonyldiphenol decreases methylation ISO RGD:1550598 6480464 bisphenol S results in decreased methylation of CHMP2A promoter CTD PMID:33297965 Chmp2a Rat all-trans-retinoic acid increases expression ISO RGD:1603659 6480464 Tretinoin results in increased expression of CHMP2A mRNA CTD PMID:33167477 Chmp2a Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of CHMP2A mRNA CTD PMID:30779732 Chmp2a Rat aristolochic acid A decreases expression ISO RGD:1603659 6480464 aristolochic acid I results in decreased expression of CHMP2A mRNA; aristolochic acid I results in more ... CTD PMID:33212167 Chmp2a Rat benzo[a]pyrene increases expression ISO RGD:1550598 6480464 Benzo(a)pyrene results in increased expression of CHMP2A mRNA CTD PMID:22228805 Chmp2a Rat benzo[a]pyrene affects methylation ISO RGD:1603659 6480464 Benzo(a)pyrene affects the methylation of CHMP2A 5' UTR; Benzo(a)pyrene affects the methylation of CHMP2A promoter CTD PMID:27901495 Chmp2a Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of CHMP2A mRNA CTD PMID:25181051 Chmp2a Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of more ... CTD PMID:36041667 Chmp2a Rat bisphenol A decreases expression ISO RGD:1550598 6480464 bisphenol A results in decreased expression of CHMP2A mRNA CTD PMID:33221593 Chmp2a Rat bisphenol AF increases expression ISO RGD:1603659 6480464 bisphenol AF results in increased expression of CHMP2A protein CTD PMID:34186270 Chmp2a Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of more ... CTD PMID:36041667 Chmp2a Rat bisphenol F increases expression ISO RGD:1603659 6480464 bisphenol F results in increased expression of CHMP2A protein CTD PMID:34186270 Chmp2a Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of CHMP2A mRNA CTD PMID:33453195 Chmp2a Rat carbamazepine affects expression ISO RGD:1603659 6480464 Carbamazepine affects the expression of CHMP2A mRNA CTD PMID:25979313 Chmp2a Rat choline multiple interactions ISO RGD:1550598 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation more ... CTD PMID:20938992 Chmp2a Rat cobalt dichloride decreases expression ISO RGD:1603659 6480464 cobaltous chloride results in decreased expression of CHMP2A mRNA CTD PMID:19320972 Chmp2a Rat cyclosporin A increases expression ISO RGD:1603659 6480464 Cyclosporine results in increased expression of CHMP2A mRNA CTD PMID:25562108 Chmp2a Rat DDE decreases expression ISO RGD:1603659 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of CHMP2A mRNA CTD PMID:38568856 Chmp2a Rat dextran sulfate decreases expression ISO RGD:1550598 6480464 Dextran Sulfate results in decreased expression of CHMP2A protein CTD PMID:32272095 Chmp2a Rat dextran sulfate multiple interactions ISO RGD:1550598 6480464 Erianin inhibits the reaction [Dextran Sulfate results in decreased expression of CHMP2A protein] CTD PMID:32272095 Chmp2a Rat disodium selenite increases expression ISO RGD:1603659 6480464 Sodium Selenite results in increased expression of CHMP2A mRNA CTD PMID:18175754 Chmp2a Rat diuron increases expression EXP 6480464 Diuron results in increased expression of CHMP2A mRNA CTD PMID:21551480 Chmp2a Rat doxorubicin increases expression ISO RGD:1603659 6480464 Doxorubicin results in increased expression of CHMP2A mRNA CTD PMID:29803840 Chmp2a Rat elemental selenium increases expression ISO RGD:1603659 6480464 Selenium results in increased expression of CHMP2A mRNA CTD PMID:19244175 Chmp2a Rat erianin multiple interactions ISO RGD:1550598 6480464 Erianin inhibits the reaction [Dextran Sulfate results in decreased expression of CHMP2A protein] CTD PMID:32272095 Chmp2a Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of CHMP2A mRNA CTD PMID:24136188 Chmp2a Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of CHMP2A mRNA CTD PMID:24136188|PMID:24793618 Chmp2a Rat folic acid multiple interactions ISO RGD:1550598 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of CHMP2A mRNA; [Methionine deficiency co-treated more ... CTD PMID:20938992|PMID:22206623 Chmp2a Rat folic acid decreases expression ISO RGD:1603659 6480464 Folic Acid results in decreased expression of CHMP2A mRNA CTD PMID:21867686 Chmp2a Rat hexane decreases methylation EXP 6480464 n-hexane results in decreased methylation of CHMP2A promoter CTD PMID:23740543 Chmp2a Rat ivermectin decreases expression ISO RGD:1603659 6480464 Ivermectin results in decreased expression of CHMP2A protein CTD PMID:32959892 Chmp2a Rat L-methionine multiple interactions ISO RGD:1550598 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation more ... CTD PMID:20938992 Chmp2a Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of CHMP2A mRNA CTD PMID:30467583 Chmp2a Rat methidathion increases expression ISO RGD:1550598 6480464 methidathion results in increased expression of CHMP2A mRNA CTD PMID:34813904 Chmp2a Rat selenium atom increases expression ISO RGD:1603659 6480464 Selenium results in increased expression of CHMP2A mRNA CTD PMID:19244175 Chmp2a Rat sulindac decreases expression EXP 6480464 Sulindac results in decreased expression of CHMP2A mRNA CTD PMID:24136188 Chmp2a Rat tamoxifen affects expression ISO RGD:1550598 6480464 Tamoxifen affects the expression of CHMP2A mRNA CTD PMID:17555576 Chmp2a Rat temozolomide decreases expression ISO RGD:1603659 6480464 Temozolomide results in decreased expression of CHMP2A mRNA CTD PMID:31758290 Chmp2a Rat tert-butyl hydroperoxide decreases expression ISO RGD:1603659 6480464 tert-Butylhydroperoxide results in decreased expression of CHMP2A mRNA CTD PMID:15336504 Chmp2a Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of CHMP2A mRNA CTD PMID:34492290 Chmp2a Rat titanium dioxide decreases methylation ISO RGD:1550598 6480464 titanium dioxide results in decreased methylation of CHMP2A gene CTD PMID:35295148 Chmp2a Rat triphenyl phosphate affects expression ISO RGD:1603659 6480464 triphenyl phosphate affects the expression of CHMP2A mRNA CTD PMID:37042841 Chmp2a Rat triptonide increases expression ISO RGD:1550598 6480464 triptonide results in increased expression of CHMP2A mRNA CTD PMID:33045310 Chmp2a Rat valproic acid affects expression ISO RGD:1603659 6480464 Valproic Acid affects the expression of CHMP2A mRNA CTD PMID:25979313 Chmp2a Rat valproic acid increases methylation ISO RGD:1603659 6480464 Valproic Acid results in increased methylation of CHMP2A gene CTD PMID:29154799 Chmp2a Rat valproic acid increases expression ISO RGD:1603659 6480464 Valproic Acid results in increased expression of CHMP2A mRNA CTD PMID:23179753|PMID:23527032|PMID:27188386
Molecular Function
Only show annotations with direct experimental evidence (0 objects hidden)
Chmp2a Rat phosphatidylcholine binding enables ISO RGD:1603659 1624291 PMID:18687924 RGD PMID:18687924 Chmp2a Rat protein binding enables ISO RGD:1603659 1624291 UniProtKB:O75351|UniProtKB:O95630|UniProtKB:P42858|UniProtKB:P53990|UniProtKB:Q8NF50-2|UniProtKB:Q8WV92|UniProtKB:Q9BY43|UniProtKB:Q9H444|UniProtKB:Q9NP79|UniProtKB:Q9UN37|UniProtKB:Q9Y3E7|UniProtKB:Q9Y3E7-1 PMID:14505570, PMID:14519844, PMID:16730941, PMID:18385515, PMID:18687924, PMID:19129480, PMID:19525971, PMID:21543490, PMID:21975012, PMID:23045692, PMID:23051622, PMID:23105106, PMID:25416956, more ... RGD PMID:14505570|PMID:14519844|PMID:16730941|PMID:18385515|PMID:18687924|PMID:19129480|PMID:19525971|PMID:21543490|PMID:21975012|PMID:23045692|PMID:23051622|PMID:23105106|PMID:25416956|PMID:26496610|PMID:28514442|PMID:32296183|PMID:32814053|PMID:33961781|PMID:35271311 Chmp2a Rat protein binding enables ISO RGD:1550598 1624291 PR:P46467 PMID:15173323 RGD PMID:15173323 Chmp2a Rat protein domain specific binding enables ISO RGD:1603659 1624291 UniProtKB:O75351|UniProtKB:Q9UN37 PMID:17928862 RGD PMID:17928862
Imported Annotations - KEGG (archival)
Chmp2a Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 82,731,212 - 82,735,088 (-) NCBI GRCr8 mRatBN7.2 1 73,660,045 - 73,662,894 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 73,660,046 - 73,662,452 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 79,040,454 - 79,042,837 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 87,604,795 - 87,607,178 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 80,795,536 - 80,797,919 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 65,540,808 - 65,543,708 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 65,541,322 - 65,543,707 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 66,352,033 - 66,354,941 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 72,889,349 - 72,891,734 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 72,966,677 - 72,969,771 (+) NCBI Celera 1 60,177,374 - 60,179,759 (+) NCBI Celera Cytogenetic Map 1 q21 NCBI
CHMP2A Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 58,551,566 - 58,555,105 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 58,551,452 - 58,555,105 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 59,062,933 - 59,066,472 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 63,754,745 - 63,758,298 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 19 56,106,112 - 56,109,665 (-) NCBI Celera Cytogenetic Map 19 q13.43 NCBI HuRef 19 55,373,170 - 55,376,723 (-) NCBI HuRef CHM1_1 19 59,056,762 - 59,060,315 (-) NCBI CHM1_1 T2T-CHM13v2.0 19 61,649,242 - 61,652,782 (-) NCBI T2T-CHM13v2.0
Chmp2a Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 12,765,933 - 12,768,704 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 12,765,937 - 12,768,734 (-) Ensembl GRCm39 Ensembl GRCm38 7 13,032,006 - 13,034,777 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 13,032,010 - 13,034,807 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 13,617,355 - 13,620,126 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 11,932,198 - 11,934,923 (-) NCBI MGSCv36 mm8 Celera 7 10,659,197 - 10,661,968 (-) NCBI Celera Cytogenetic Map 7 A1 NCBI cM Map 7 7.73 NCBI
Chmp2a Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955584 1,156,828 - 1,160,056 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955584 1,156,828 - 1,160,056 (-) NCBI ChiLan1.0 ChiLan1.0
CHMP2A Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 64,837,136 - 64,840,736 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 66,620,025 - 66,623,594 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 55,564,622 - 55,568,214 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 64,377,986 - 64,381,641 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 19 64,377,986 - 64,381,417 (-) Ensembl panpan1.1 panPan2
CHMP2A Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 99,405,322 - 99,408,257 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 1 99,405,337 - 99,410,163 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 99,803,589 - 99,806,504 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 100,018,434 - 100,021,349 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 100,019,387 - 100,021,348 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 99,663,797 - 99,666,712 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 99,376,629 - 99,379,542 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 100,131,268 - 100,134,183 (+) NCBI UU_Cfam_GSD_1.0
Chmp2a
CHMP2A
CHMP2A Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 6 50,827,200 - 50,830,730 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 6 50,827,284 - 50,830,702 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666045 4,133,029 - 4,160,880 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Chmp2a
.
Predicted Target Of
Count of predictions: 38 Count of miRNA genes: 35 Interacting mature miRNAs: 36 Transcripts: ENSRNOT00000030931 Prediction methods: Microtar, Rnahybrid Result types: miRGate_prediction
1331732 Srn4 Serum renin concentration QTL 4 4.467 renin activity (VT:0005581) plasma renin activity level (CMO:0000116) 1 35239598 78430678 Rat 2313059 Bss55 Bone structure and strength QTL 55 3.2 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 631688 Hcas2 Hepatocarcinoma susceptibility QTL 2 3 0.0001 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 5925874 115540829 Rat 1578649 Bmd8 Bone mineral density QTL 8 4.9 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 1 49393172 94393172 Rat 1358359 Sradr1 Stress Responsive Adrenal Weight QTL 1 4.74 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 30882023 123479925 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 4889929 Bss87 Bone structure and strength QTL 87 6.7 tibia area (VT:1000281) tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722) 1 53895117 82174945 Rat 1331792 Rf29 Renal function QTL 29 4.589 urine potassium amount (VT:0010539) urine potassium level (CMO:0000128) 1 35239598 78430678 Rat 2313062 Bmd73 Bone mineral density QTL 73 3.9 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 11481312 82174945 Rat 8552900 Pigfal1 Plasma insulin-like growth factor 1 level QTL 1 7.4 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 1 34836858 79836858 Rat 1578654 Bss10 Bone structure and strength QTL 10 4 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 1 49393172 159356837 Rat 1554320 Bmd1 Bone mineral density QTL 1 12.2 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 509108 86060548 Rat 1354643 Foco2 Food consumption QTL 2 7.17 0.0001 eating behavior trait (VT:0001431) food intake rate (CMO:0000427) 1 33449848 78449848 Rat 2302059 Pia36 Pristane induced arthritis QTL 36 3.8 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 1 43333002 88333002 Rat 2313065 Bss67 Bone structure and strength QTL 67 3.1 0.0001 tibia area (VT:1000281) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 1300121 Hrtrt1 Heart rate QTL 1 3.7 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 65789093 115540829 Rat 7421628 Bp361 Blood pressure QTL 361 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 66023617 118608521 Rat 2313069 Bss68 Bone structure and strength QTL 68 2.9 0.0001 tibia size trait (VT:0100001) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 631495 Bp96 Blood pressure QTL 96 4.52 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 22340647 102268831 Rat 2313075 Bss66 Bone structure and strength QTL 66 3.4 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 11481312 82174945 Rat 70225 Bp58 Blood pressure QTL 58 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32356093 162846471 Rat 631512 Scl6 Serum cholesterol level QTL 6 9.6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 1 72197680 90508767 Rat 2298545 Neuinf8 Neuroinflammation QTL 8 4.6 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 1 57336763 151090257 Rat 2313072 Bss53 Bone structure and strength QTL 53 4.3 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 43284731 118944897 Rat 1300167 Hrtrt2 Heart rate QTL 2 4.35 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 11481312 75088344 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 2313078 Bss54 Bone structure and strength QTL 54 3.5 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 2313077 Bss69 Bone structure and strength QTL 69 3.5 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 11481312 82174945 Rat 1331778 Rf28 Renal function QTL 28 4.66 urine potassium amount (VT:0010539) urine potassium excretion rate (CMO:0000761) 1 45803140 78430678 Rat 2313402 Anxrr24 Anxiety related response QTL 24 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 1 48963584 144267916 Rat 1331785 Rf27 Renal function QTL 27 4.643 urine sodium amount (VT:0006274) urine sodium level (CMO:0000129) 1 28879780 78430678 Rat 61342 Bp27 Blood pressure QTL 27 3.4 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 56732668 98773277 Rat 1300172 Bp172 Blood pressure QTL 172 3.56 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 32737273 90665040 Rat 4889962 Bss94 Bone structure and strength QTL 94 3.8 tibia area (VT:1000281) tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722) 1 49361465 82174945 Rat 2313094 Bss58 Bone structure and strength QTL 58 3.7 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 43284731 118944897 Rat 6903308 Scl36 Serum cholesterol QTL 36 2 0.0125 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 53863041 90532583 Rat 2313092 Bmd72 Bone mineral density QTL 72 2.5 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 1 11481312 82174945 Rat 2300164 Bmd44 Bone mineral density QTL 44 5.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 1 56949932 101949932 Rat 2313099 Bss56 Bone structure and strength QTL 56 2.4 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 1 43284731 118944897 Rat 2313098 Bmd70 Bone mineral density QTL 70 3.6 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 43284731 118944897 Rat 2313097 Bss70 Bone structure and strength QTL 70 3.5 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 9589820 Insglur3 Insulin/glucose ratio QTL 3 10.75 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 1 34836858 79836858 Rat 152025249 Scl82 Serum cholesterol level QTL 82 4.77 blood cholesterol amount (VT:0000180) 1 50343510 99980958 Rat 1354599 Bw29 Body weight QTL 29 3.46 0.001 body mass (VT:0001259) body weight (CMO:0000012) 1 33449848 78449848 Rat 4889919 Bss86 Bone structure and strength QTL 86 4.1 tibia area (VT:1000281) tibia midshaft total cross-sectional area (CMO:0001715) 1 53895117 82174945 Rat 8552948 Pigfal11 Plasma insulin-like growth factor 1 level QTL 11 4.7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 1 34836858 79836858 Rat 2313051 Bss57 Bone structure and strength QTL 57 3.7 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 43284731 118944897 Rat
Ubc-rs2
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 73,663,058 - 73,663,265 (-) MAPPER mRatBN7.2 Rnor_6.0 1 65,540,488 - 65,540,694 NCBI Rnor6.0 Rnor_5.0 1 66,351,721 - 66,351,927 UniSTS Rnor5.0 RGSC_v3.4 1 72,888,515 - 72,888,721 UniSTS RGSC3.4 Celera 1 60,176,540 - 60,176,746 UniSTS Cytogenetic Map 1 q21 UniSTS
MARC_7283-7284:996687724:1
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 1 82,735,865 - 82,736,565 (+) Marker Load Pipeline mRatBN7.2 1 73,663,680 - 73,664,380 (-) MAPPER mRatBN7.2 Rnor_6.0 1 65,539,373 - 65,540,072 NCBI Rnor6.0 Rnor_5.0 1 66,350,606 - 66,351,305 UniSTS Rnor5.0 RGSC_v3.4 1 72,887,400 - 72,888,099 UniSTS RGSC3.4 Celera 1 60,175,425 - 60,176,124 UniSTS Cytogenetic Map 1 q21 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000030931 ⟹ ENSRNOP00000038229
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 73,660,046 - 73,662,452 (-) Ensembl Rnor_6.0 Ensembl 1 65,541,322 - 65,543,707 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000097443 ⟹ ENSRNOP00000082830
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 73,660,046 - 73,662,452 (-) Ensembl
RefSeq Acc Id:
NM_001108906 ⟹ NP_001102376
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 82,732,230 - 82,734,618 (-) NCBI mRatBN7.2 1 73,660,045 - 73,662,433 (-) NCBI Rnor_6.0 1 65,541,322 - 65,543,707 (+) NCBI Rnor_5.0 1 66,352,033 - 66,354,941 (+) NCBI RGSC_v3.4 1 72,889,349 - 72,891,734 (+) RGD Celera 1 60,177,374 - 60,179,759 (+) RGD
Sequence:
GTGGTCTCTGCTGAGCCGCAGGTCCCGTTTGGGCGGCAGCGTAGGAGGGCTTTTAGGCTGGAGCATCGGATGCCGTGCGGTCCGCCTGTCCCTGCCCACATCGAGGTCTTCACCTCTGCCTGCTCTCG
hide sequence
RefSeq Acc Id:
NM_001416000 ⟹ NP_001402929
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 82,732,230 - 82,734,744 (-) NCBI mRatBN7.2 1 73,660,045 - 73,662,559 (-) NCBI
RefSeq Acc Id:
XM_006228117 ⟹ XP_006228179
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 82,732,234 - 82,735,088 (-) NCBI mRatBN7.2 1 73,660,045 - 73,662,894 (-) NCBI Rnor_6.0 1 65,540,808 - 65,543,708 (+) NCBI Rnor_5.0 1 66,352,033 - 66,354,941 (+) NCBI
Sequence:
ACTCACTGGGATGAGGCGCAAGCAATGGAAGAATCAGGTAATTTCAGCTCCTGGCCCTTACACC
hide sequence
RefSeq Acc Id:
XM_063269019 ⟹ XP_063125089
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 82,731,212 - 82,735,088 (-) NCBI
RefSeq Acc Id:
XM_063269023 ⟹ XP_063125093
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 82,731,212 - 82,735,088 (-) NCBI
RefSeq Acc Id:
NP_001102376 ⟸ NM_001108906
- UniProtKB:
B2RZB5 (UniProtKB/TrEMBL), A6KQL1 (UniProtKB/TrEMBL), A6KQL2 (UniProtKB/TrEMBL)
- Sequence:
MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAKQGQMDAVRIMAKDLVRTRRYVRKFVLMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMGTMNRQLKLPQIQKIMME
hide sequence
RefSeq Acc Id:
XP_006228179 ⟸ XM_006228117
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I5ZY10 (UniProtKB/TrEMBL)
- Sequence:
MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAKQGQMDAVRIMAKDLVRTRRYVRKFVLMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMGTMNRQVCPSQSTFPSPL
hide sequence
Ensembl Acc Id:
ENSRNOP00000038229 ⟸ ENSRNOT00000030931
Ensembl Acc Id:
ENSRNOP00000082830 ⟸ ENSRNOT00000097443
RefSeq Acc Id:
NP_001402929 ⟸ NM_001416000
- UniProtKB:
B2RZB5 (UniProtKB/TrEMBL), A6KQL1 (UniProtKB/TrEMBL), A6KQL2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063125093 ⟸ XM_063269023
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_063125089 ⟸ XM_063269019
- Peptide Label:
isoform X1
RGD ID: 13689670 Promoter ID: EPDNEW_R195 Type: initiation region Name: Chmp2a_1 Description: charged multivesicular body protein 2A SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 65,541,306 - 65,541,366 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2011-09-29
Chmp2a
charged multivesicular body protein 2A
Chmp2a
chromatin modifying protein 2A
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-03-06
Chmp2a
chromatin modifying protein 2A
RGD1305050_predicted
similar to RIKEN cDNA 1500016L11 (predicted)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-20
RGD1305050_predicted
similar to RIKEN cDNA 1500016L11 (predicted)
LOC365191_predicted
Symbol and Name status set to approved
1331353 APPROVED
2005-01-12
LOC365191_predicted
similar to RIKEN cDNA 1500016L11 (predicted)
Symbol and Name status set to provisional
70820 PROVISIONAL
