Symbol:
Nrf1
Name:
nuclear respiratory factor 1
RGD ID:
1304603
Description:
Predicted to enable DNA-binding transcription activator activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Involved in several processes, including animal organ regeneration; response to estradiol; and response to lipopolysaccharide. Predicted to be located in cytosol and nucleoplasm. Biomarker of obesity. Human ortholog(s) of this gene implicated in Huntington's disease. Orthologous to human NRF1 (nuclear respiratory factor 1); PARTICIPATES IN Huntington's disease pathway; INTERACTS WITH (+)-schisandrin B; (R)-noradrenaline; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
alpha palindromic-binding protein; alpha-pal; LOC312195; Nfe2l1_retired; NRF-1; nuclear factor (erythroid-derived 2)-like 1; nuclear respiratory factor-1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 59,632,366 - 59,738,166 (+) NCBI GRCr8 mRatBN7.2 4 58,664,932 - 58,772,328 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 58,664,957 - 58,825,328 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 63,642,477 - 63,739,391 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 59,558,637 - 59,655,557 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 57,960,536 - 58,057,462 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 57,335,732 - 57,445,317 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 57,378,069 - 57,445,341 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 57,097,471 - 57,207,118 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 56,949,553 - 57,048,149 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 57,267,163 - 57,331,137 (+) NCBI Celera 4 53,766,265 - 53,861,921 (+) NCBI Celera Cytogenetic Map 4 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Nrf1 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of NRF1 mRNA] CTD PMID:31150632 Nrf1 Rat (R)-noradrenaline multiple interactions EXP 6480464 [Estradiol co-treated with Norepinephrine] results in decreased expression of NRF1 mRNA CTD PMID:16954335 Nrf1 Rat 1-chloro-2,4-dinitrobenzene decreases expression ISO Nrf1 (Mus musculus) 6480464 Dinitrochlorobenzene results in decreased expression of NRF1 mRNA CTD PMID:28219650 Nrf1 Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine decreases expression ISO Nrf1 (Mus musculus) 6480464 1-Methyl-4-phenyl-1 more ... CTD PMID:21856379 Nrf1 Rat 17beta-estradiol multiple interactions ISO NRF1 (Homo sapiens) 6480464 ESR1 protein alternative form inhibits the reaction [Estradiol results in increased expression of NRF1 mRNA] more ... CTD PMID:20302909 and PMID:22105178 Nrf1 Rat 17beta-estradiol increases expression ISO NRF1 (Homo sapiens) 6480464 Estradiol results in increased expression of NRF1 mRNA CTD PMID:20302909 more ... Nrf1 Rat 17beta-estradiol multiple interactions EXP 6480464 [Estradiol co-treated with Norepinephrine] results in decreased expression of NRF1 mRNA CTD PMID:16954335 Nrf1 Rat 1H-[1,2,4]oxadiazolo[4,3-a]quinoxalin-1-one multiple interactions ISO NRF1 (Homo sapiens) 6480464 1H-(1 more ... CTD PMID:24041027 Nrf1 Rat 1H-[1,2,4]oxadiazolo[4,3-a]quinoxalin-1-one multiple interactions EXP 6480464 1H-(1 more ... CTD PMID:17179207 Nrf1 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression EXP 6480464 2 more ... CTD PMID:36269211 Nrf1 Rat 2,2',4,4'-Tetrabromodiphenyl ether multiple interactions EXP 6480464 MIR128-1 promotes the reaction [2 more ... CTD PMID:36269211 Nrf1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Nrf1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of NRF1 mRNA CTD PMID:21570461 and PMID:24058054 Nrf1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO NRF1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of NRF1 mRNA CTD PMID:21296121 Nrf1 Rat 2,3-bis(4-hydroxyphenyl)propionitrile increases expression ISO NRF1 (Homo sapiens) 6480464 2 and 3-bis(4-hydroxyphenyl)-propionitrile results in increased expression of NRF1 mRNA CTD PMID:22105178 Nrf1 Rat 2,4-dinitrophenol increases expression ISO Nrf1 (Mus musculus) 6480464 2 and 4-Dinitrophenol results in increased expression of NRF1 mRNA CTD PMID:11784294 Nrf1 Rat 3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine affects expression EXP 6480464 Puromycin Aminonucleoside affects the expression of NRF1 mRNA CTD PMID:16609681 Nrf1 Rat 3,4-methylenedioxymethamphetamine increases expression ISO Nrf1 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of NRF1 mRNA CTD PMID:20188158 Nrf1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO Nrf1 (Mus musculus) 6480464 [licarin A affects the susceptibility to [INS protein co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone]] which results in increased expression of NRF1 mRNA more ... CTD PMID:29288687 and PMID:32417366 Nrf1 Rat 3-phenylprop-2-enal decreases expression ISO Nrf1 (Mus musculus) 6480464 cinnamaldehyde results in decreased expression of NRF1 mRNA CTD PMID:28219650 Nrf1 Rat 4,4'-diaminodiphenylmethane affects expression ISO Nrf1 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane affects the expression of NRF1 mRNA CTD PMID:18648102 Nrf1 Rat 4-hydroxyphenyl retinamide increases expression ISO Nrf1 (Mus musculus) 6480464 Fenretinide results in increased expression of NRF1 mRNA CTD PMID:28973697 Nrf1 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of NRF1 mRNA CTD PMID:30047161 Nrf1 Rat 8-bromo-3',5'-cyclic GMP multiple interactions ISO NRF1 (Homo sapiens) 6480464 tin protoporphyrin IX inhibits the reaction [8-bromocyclic GMP results in increased expression of NRF1 mRNA] CTD PMID:24041027 Nrf1 Rat 8-bromo-3',5'-cyclic GMP increases expression ISO NRF1 (Homo sapiens) 6480464 8-bromocyclic GMP results in increased expression of NRF1 mRNA CTD PMID:24041027 Nrf1 Rat acadesine increases expression ISO NRF1 (Homo sapiens) 6480464 acadesine results in increased expression of NRF1 protein CTD PMID:28556920 Nrf1 Rat acadesine multiple interactions ISO NRF1 (Homo sapiens) 6480464 acadesine inhibits the reaction [Isoniazid results in decreased expression of NRF1 protein] CTD PMID:28556920 Nrf1 Rat acetylsalicylic acid multiple interactions ISO Nrf1 (Mus musculus) 6480464 Aspirin inhibits the reaction [Cisplatin results in decreased expression of NRF1 protein] CTD PMID:37179038 Nrf1 Rat acrolein decreases expression EXP 6480464 Acrolein results in decreased expression of NRF1 mRNA CTD PMID:35150775 Nrf1 Rat afimoxifene multiple interactions ISO NRF1 (Homo sapiens) 6480464 fulvestrant inhibits the reaction [afimoxifene results in increased expression of NRF1 mRNA] and Vehicle Emissions inhibits the reaction [afimoxifene results in increased expression of NRF1 mRNA] CTD PMID:22105178 Nrf1 Rat afimoxifene increases expression ISO NRF1 (Homo sapiens) 6480464 afimoxifene results in increased expression of NRF1 mRNA CTD PMID:22105178 Nrf1 Rat aflatoxin B1 increases expression ISO Nrf1 (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of NRF1 mRNA CTD PMID:19770486 Nrf1 Rat aflatoxin B1 increases methylation ISO NRF1 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of NRF1 gene and Aflatoxin B1 results in increased methylation of NRF1 intron CTD PMID:27153756 and PMID:30157460 Nrf1 Rat AICA ribonucleotide multiple interactions EXP 6480464 dorsomorphin inhibits the reaction [AICA ribonucleotide results in increased expression of NRF1 mRNA] CTD PMID:20438809 Nrf1 Rat AICA ribonucleotide increases expression EXP 6480464 AICA ribonucleotide results in increased expression of NRF1 mRNA CTD PMID:20438809 Nrf1 Rat aldehydo-D-glucose multiple interactions EXP 6480464 [Oxygen deficiency co-treated with Glucose deficiency] results in decreased expression of NRF1 protein and qishen yiqi inhibits the reaction [[Oxygen deficiency co-treated with Glucose deficiency] results in decreased expression of NRF1 protein] CTD PMID:36806343 Nrf1 Rat all-trans-retinoic acid multiple interactions EXP 6480464 Tretinoin inhibits the reaction [monascin inhibits the reaction [Pyruvaldehyde results in increased expression of NRF1 mRNA]] CTD PMID:23331247 Nrf1 Rat alloxan multiple interactions EXP 6480464 Alloxan affects the reaction [imisopasem manganese results in increased expression of NRF1 protein] CTD PMID:28483572 Nrf1 Rat AM-251 multiple interactions ISO Nrf1 (Mus musculus) 6480464 AM 251 inhibits the reaction [Dietary Fats results in decreased expression of NRF1 mRNA] CTD PMID:26847930 Nrf1 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of NRF1 mRNA CTD PMID:30047161 Nrf1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of NRF1 mRNA CTD PMID:16483693 Nrf1 Rat antirheumatic drug increases expression ISO NRF1 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of NRF1 mRNA CTD PMID:24449571 Nrf1 Rat arachidonyl-2'-chloroethylamide multiple interactions ISO Nrf1 (Mus musculus) 6480464 FOXO1 protein affects the reaction [arachidonyl-2-chloroethylamide results in decreased expression of NRF1 mRNA] CTD PMID:26847930 Nrf1 Rat arachidonyl-2'-chloroethylamide decreases expression ISO Nrf1 (Mus musculus) 6480464 arachidonyl-2-chloroethylamide results in decreased expression of NRF1 mRNA CTD PMID:26847930 Nrf1 Rat Aroclor 1254 increases expression ISO NRF1 (Homo sapiens) 6480464 Chlorodiphenyl (54% Chlorine) results in increased expression of NRF1 mRNA CTD PMID:16934159 Nrf1 Rat arsane increases expression ISO NRF1 (Homo sapiens) 6480464 Arsenic results in increased expression of NRF1 mRNA CTD PMID:21514422 Nrf1 Rat arsane multiple interactions ISO NRF1 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of NRF1 mRNA CTD PMID:39836092 Nrf1 Rat arsane affects methylation ISO NRF1 (Homo sapiens) 6480464 Arsenic affects the methylation of NRF1 gene CTD PMID:25304211 Nrf1 Rat arsenic atom increases expression ISO NRF1 (Homo sapiens) 6480464 Arsenic results in increased expression of NRF1 mRNA CTD PMID:21514422 Nrf1 Rat arsenic atom multiple interactions ISO NRF1 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of NRF1 mRNA CTD PMID:39836092 Nrf1 Rat arsenic atom affects methylation ISO NRF1 (Homo sapiens) 6480464 Arsenic affects the methylation of NRF1 gene CTD PMID:25304211 Nrf1 Rat arsenous acid affects methylation ISO NRF1 (Homo sapiens) 6480464 Arsenic Trioxide affects the methylation of NRF1 promoter CTD PMID:26046465 Nrf1 Rat atorvastatin calcium multiple interactions EXP 6480464 Acetylcysteine inhibits the reaction [Atorvastatin results in increased expression of NRF1 mRNA] and Quercetin inhibits the reaction [Atorvastatin affects the expression of NRF1 mRNA] CTD PMID:21775390 Nrf1 Rat atorvastatin calcium affects expression EXP 6480464 Atorvastatin affects the expression of NRF1 mRNA CTD PMID:21775390 Nrf1 Rat atorvastatin calcium increases expression EXP 6480464 Atorvastatin results in increased expression of NRF1 mRNA CTD PMID:21775390 Nrf1 Rat atrazine increases expression EXP 6480464 Atrazine results in increased expression of NRF1 mRNA CTD PMID:27114639 Nrf1 Rat atrazine decreases expression ISO NRF1 (Homo sapiens) 6480464 Atrazine results in decreased expression of NRF1 mRNA CTD PMID:27114639 Nrf1 Rat benzo[a]pyrene multiple interactions ISO Nrf1 (Mus musculus) 6480464 Benzo(a)pyrene promotes the reaction [AHR protein binds to NRF1 promoter] and Benzo(a)pyrene promotes the reaction [NRF1 protein binds to GSTA1 gene] CTD PMID:11961136 and PMID:19654925 Nrf1 Rat benzo[a]pyrene affects expression EXP 6480464 Benzo(a)pyrene affects the expression of NRF1 mRNA and Benzo(a)pyrene affects the expression of NRF1 protein CTD PMID:32619457 Nrf1 Rat benzo[a]pyrene multiple interactions EXP 6480464 Resveratrol affects the reaction [Benzo(a)pyrene affects the expression of NRF1 mRNA] and Resveratrol affects the reaction [Benzo(a)pyrene affects the expression of NRF1 protein] CTD PMID:32619457 Nrf1 Rat benzo[a]pyrene decreases methylation ISO Nrf1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased methylation of NRF1 3' UTR and Benzo(a)pyrene results in decreased methylation of NRF1 exon CTD PMID:27901495 Nrf1 Rat benzo[a]pyrene affects methylation ISO NRF1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of NRF1 5' UTR CTD PMID:27901495 Nrf1 Rat benzo[a]pyrene decreases expression ISO NRF1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of NRF1 mRNA and Benzo(a)pyrene results in decreased expression of NRF1 protein CTD PMID:21401886 and PMID:22865514 Nrf1 Rat benzo[a]pyrene multiple interactions ISO NRF1 (Homo sapiens) 6480464 NRF1 mutant form inhibits the reaction [Benzo(a)pyrene results in decreased expression of TFAM protein] and NRF1 mutant form promotes the reaction [Benzo(a)pyrene results in increased abundance of Reactive Oxygen Species] CTD PMID:21401886 Nrf1 Rat benzo[a]pyrene increases expression ISO Nrf1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of NRF1 mRNA CTD PMID:22228805 Nrf1 Rat benzo[a]pyrene diol epoxide I decreases expression ISO NRF1 (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 Nrf1 Rat bis(2-ethylhexyl) phthalate decreases expression ISO NRF1 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in decreased expression of NRF1 mRNA and Diethylhexyl Phthalate results in decreased expression of NRF1 protein CTD PMID:34822940 Nrf1 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Nrf1 (Mus musculus) 6480464 Lycopene inhibits the reaction [Diethylhexyl Phthalate results in increased expression of NRF1 mRNA] CTD PMID:33908429 Nrf1 Rat bis(2-ethylhexyl) phthalate increases expression ISO Nrf1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of NRF1 mRNA CTD PMID:33908429 Nrf1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of NRF1 mRNA CTD PMID:25181051 more ... Nrf1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of NRF1 mRNA CTD PMID:24105817 Nrf1 Rat Butylbenzyl phthalate decreases expression ISO NRF1 (Homo sapiens) 6480464 butylbenzyl phthalate results in decreased expression of NRF1 mRNA CTD PMID:26520405 Nrf1 Rat Butylbenzyl phthalate decreases expression ISO Nrf1 (Mus musculus) 6480464 butylbenzyl phthalate results in decreased expression of NRF1 mRNA CTD PMID:27923775 Nrf1 Rat cadmium atom increases expression EXP 6480464 Cadmium results in increased expression of NRF1 mRNA CTD PMID:25388156 Nrf1 Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of NRF1 mRNA CTD PMID:36493885 Nrf1 Rat cadmium dichloride multiple interactions EXP 6480464 Acetylcysteine inhibits the reaction [Cadmium Chloride results in decreased expression of NRF1 mRNA] CTD PMID:36493885 Nrf1 Rat caffeine decreases expression EXP 6480464 Caffeine results in decreased expression of NRF1 mRNA CTD PMID:20864626 Nrf1 Rat calcitriol increases expression EXP 6480464 Calcitriol results in increased expression of NRF1 protein CTD PMID:30194976 Nrf1 Rat calycosin multiple interactions EXP 6480464 7 more ... CTD PMID:36436616 Nrf1 Rat carbon monoxide multiple interactions ISO Nrf1 (Mus musculus) 6480464 AKT1 protein affects the reaction [Carbon Monoxide results in increased localization of NRF1 protein] and Carbon Monoxide promotes the reaction [NFE2L2 protein binds to NRF1 promoter] CTD PMID:18845810 Nrf1 Rat carbon monoxide increases expression EXP 6480464 Carbon Monoxide results in increased expression of NRF1 protein CTD PMID:17179207 Nrf1 Rat carbon monoxide increases localization ISO Nrf1 (Mus musculus) 6480464 Carbon Monoxide results in increased localization of NRF1 protein CTD PMID:18845810 Nrf1 Rat carbon monoxide multiple interactions EXP 6480464 1H-(1 more ... CTD PMID:17179207 Nrf1 Rat carbon monoxide increases expression ISO Nrf1 (Mus musculus) 6480464 Carbon Monoxide results in increased expression of NRF1 mRNA CTD PMID:17179207 Nrf1 Rat CHIR 99021 decreases expression ISO Nrf1 (Mus musculus) 6480464 Chir 99021 results in decreased expression of NRF1 mRNA CTD PMID:29883716 Nrf1 Rat cisplatin decreases expression ISO Nrf1 (Mus musculus) 6480464 Cisplatin results in decreased expression of NRF1 mRNA and Cisplatin results in decreased expression of NRF1 protein CTD PMID:25270620 and PMID:37179038 Nrf1 Rat cisplatin multiple interactions ISO Nrf1 (Mus musculus) 6480464 Aspirin inhibits the reaction [Cisplatin results in decreased expression of NRF1 protein] CTD PMID:37179038 Nrf1 Rat copper atom increases expression EXP 6480464 Copper deficiency results in increased expression of NRF1 protein CTD PMID:11694003 Nrf1 Rat copper atom decreases response to substance ISO Nrf1 (Mus musculus) 6480464 NRF1 gene results in decreased susceptibility to Copper CTD PMID:24462598 Nrf1 Rat copper atom multiple interactions ISO Nrf1 (Mus musculus) 6480464 NRF1 gene promotes the reaction [Copper results in increased expression of MT1 mRNA] CTD PMID:24462598 Nrf1 Rat copper(0) increases expression EXP 6480464 Copper deficiency results in increased expression of NRF1 protein CTD PMID:11694003 Nrf1 Rat copper(0) decreases response to substance ISO Nrf1 (Mus musculus) 6480464 NRF1 gene results in decreased susceptibility to Copper CTD PMID:24462598 Nrf1 Rat copper(0) multiple interactions ISO Nrf1 (Mus musculus) 6480464 NRF1 gene promotes the reaction [Copper results in increased expression of MT1 mRNA] CTD PMID:24462598 Nrf1 Rat copper(II) sulfate decreases expression ISO NRF1 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of NRF1 mRNA CTD PMID:19549813 Nrf1 Rat copper(II) sulfate decreases expression ISO Nrf1 (Mus musculus) 6480464 Copper Sulfate results in decreased expression of NRF1 mRNA and Copper Sulfate results in decreased expression of NRF1 protein CTD PMID:38124272 Nrf1 Rat cyclosporin A increases methylation ISO NRF1 (Homo sapiens) 6480464 Cyclosporine results in increased methylation of NRF1 promoter CTD PMID:27989131 Nrf1 Rat cyprodinil increases expression ISO NRF1 (Homo sapiens) 6480464 cyprodinil results in increased expression of NRF1 mRNA CTD PMID:33352482 Nrf1 Rat D-glucose multiple interactions EXP 6480464 [Oxygen deficiency co-treated with Glucose deficiency] results in decreased expression of NRF1 protein and qishen yiqi inhibits the reaction [[Oxygen deficiency co-treated with Glucose deficiency] results in decreased expression of NRF1 protein] CTD PMID:36806343 Nrf1 Rat dexamethasone multiple interactions ISO Nrf1 (Mus musculus) 6480464 [licarin A affects the susceptibility to [INS protein co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone]] which results in increased expression of NRF1 mRNA more ... CTD PMID:29288687 and PMID:32417366 Nrf1 Rat Di-n-octyl phthalate decreases expression ISO NRF1 (Homo sapiens) 6480464 di-n-octyl phthalate results in decreased expression of NRF1 mRNA and di-n-octyl phthalate results in decreased expression of NRF1 protein CTD PMID:34822940 Nrf1 Rat diarsenic trioxide affects methylation ISO NRF1 (Homo sapiens) 6480464 Arsenic Trioxide affects the methylation of NRF1 promoter CTD PMID:26046465 Nrf1 Rat Dibutyl phosphate affects expression ISO NRF1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of NRF1 mRNA CTD PMID:37042841 Nrf1 Rat dioxygen multiple interactions ISO Nrf1 (Mus musculus) 6480464 [Blood Glucose deficiency co-treated with Oxygen deficiency] results in decreased expression of NRF1 protein and genipin inhibits the reaction [[Blood Glucose deficiency co-treated with Oxygen deficiency] results in decreased expression of NRF1 protein] CTD PMID:28477916 Nrf1 Rat dioxygen multiple interactions EXP 6480464 [Oxygen deficiency co-treated with Glucose deficiency] results in decreased expression of NRF1 protein and qishen yiqi inhibits the reaction [[Oxygen deficiency co-treated with Glucose deficiency] results in decreased expression of NRF1 protein] CTD PMID:36806343 Nrf1 Rat dorsomorphin multiple interactions EXP 6480464 dorsomorphin inhibits the reaction [AICA ribonucleotide results in increased expression of NRF1 mRNA] and dorsomorphin inhibits the reaction [Resveratrol results in increased expression of NRF1 mRNA] CTD PMID:20438809 Nrf1 Rat doxorubicin multiple interactions ISO NRF1 (Homo sapiens) 6480464 3-(2 more ... CTD PMID:28456571 and PMID:29729358 Nrf1 Rat doxorubicin decreases expression ISO NRF1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of NRF1 protein CTD PMID:28456571 and PMID:29729358 Nrf1 Rat elemental selenium multiple interactions EXP 6480464 NRF1 protein promotes the reaction [Selenium results in increased expression of TFAM mRNA] CTD PMID:17936198 Nrf1 Rat elemental selenium increases expression EXP 6480464 Selenium results in increased expression of NRF1 mRNA CTD PMID:17936198 Nrf1 Rat enalapril increases expression EXP 6480464 Enalapril results in increased expression of NRF1 mRNA CTD PMID:18765277 Nrf1 Rat enniatin decreases expression EXP 6480464 enniatins results in decreased expression of NRF1 mRNA CTD PMID:27163883 Nrf1 Rat enzyme inhibitor multiple interactions ISO NRF1 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of NRF1 protein CTD PMID:23301498 Nrf1 Rat Erythropoietin multiple interactions ISO NRF1 (Homo sapiens) 6480464 Erythropoietin inhibits the reaction [Doxorubicin results in decreased expression of NRF1 protein] and SIRT1 protein affects the reaction [Erythropoietin inhibits the reaction [Doxorubicin results in decreased expression of NRF1 protein]] CTD PMID:28456571 Nrf1 Rat Erythropoietin increases expression ISO NRF1 (Homo sapiens) 6480464 Erythropoietin results in increased expression of NRF1 protein CTD PMID:28456571 Nrf1 Rat ethidium increases expression ISO NRF1 (Homo sapiens) 6480464 Ethidium results in increased expression of NRF1 mRNA CTD PMID:22712077 Nrf1 Rat fenthion decreases expression ISO Nrf1 (Mus musculus) 6480464 Fenthion results in decreased expression of NRF1 mRNA CTD PMID:34813904 Nrf1 Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of NRF1 mRNA CTD PMID:30307764 Nrf1 Rat fludioxonil increases expression ISO NRF1 (Homo sapiens) 6480464 fludioxonil results in increased expression of NRF1 mRNA CTD PMID:23436777 Nrf1 Rat Flumetralin increases expression ISO NRF1 (Homo sapiens) 6480464 flumetralin results in increased expression of NRF1 mRNA CTD PMID:33352482 Nrf1 Rat formaldehyde decreases expression ISO NRF1 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of NRF1 mRNA CTD PMID:20655997 and PMID:23649840 Nrf1 Rat FR900359 decreases phosphorylation ISO NRF1 (Homo sapiens) 6480464 FR900359 results in decreased phosphorylation of NRF1 protein CTD PMID:37730182 Nrf1 Rat fulvestrant multiple interactions ISO NRF1 (Homo sapiens) 6480464 fulvestrant inhibits the reaction [afimoxifene results in increased expression of NRF1 mRNA] more ... CTD PMID:22105178 Nrf1 Rat gamma-hexachlorocyclohexane increases expression ISO NRF1 (Homo sapiens) 6480464 Hexachlorocyclohexane results in increased expression of NRF1 mRNA CTD PMID:23777605 Nrf1 Rat Genipin multiple interactions ISO Nrf1 (Mus musculus) 6480464 genipin inhibits the reaction [[Blood Glucose deficiency co-treated with Oxygen deficiency] results in decreased expression of NRF1 protein] CTD PMID:28477916 Nrf1 Rat Gingerenone A increases expression ISO Nrf1 (Mus musculus) 6480464 gingerenone A results in increased expression of NRF1 mRNA CTD PMID:28556482 Nrf1 Rat glucose multiple interactions EXP 6480464 [Oxygen deficiency co-treated with Glucose deficiency] results in decreased expression of NRF1 protein and qishen yiqi inhibits the reaction [[Oxygen deficiency co-treated with Glucose deficiency] results in decreased expression of NRF1 protein] CTD PMID:36806343 Nrf1 Rat hemin multiple interactions EXP 6480464 Hemin inhibits the reaction [manganese chloride affects the expression of NRF1 protein] CTD PMID:30040983 Nrf1 Rat hexadecanoic acid multiple interactions ISO Nrf1 (Mus musculus) 6480464 [Oleic Acid co-treated with Palmitic Acid] results in decreased expression of NRF1 mRNA and FOXO1 protein affects the reaction [[Oleic Acid co-treated with Palmitic Acid] results in decreased expression of NRF1 mRNA] CTD PMID:26847930 Nrf1 Rat hydrogen peroxide multiple interactions ISO NRF1 (Homo sapiens) 6480464 resveratrol inhibits the reaction [Hydrogen Peroxide results in decreased expression of NRF1 mRNA] CTD PMID:23859249 Nrf1 Rat hydrogen peroxide affects response to substance ISO NRF1 (Homo sapiens) 6480464 NRF1 protein affects the susceptibility to Hydrogen Peroxide CTD PMID:21051700 Nrf1 Rat hydrogen peroxide affects expression ISO NRF1 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of NRF1 mRNA CTD PMID:20044591 Nrf1 Rat hydrogen peroxide decreases expression ISO NRF1 (Homo sapiens) 6480464 Hydrogen Peroxide results in decreased expression of NRF1 mRNA CTD PMID:23859249 Nrf1 Rat imisopasem manganese multiple interactions EXP 6480464 Alloxan affects the reaction [imisopasem manganese results in increased expression of NRF1 protein] CTD PMID:28483572 Nrf1 Rat imisopasem manganese increases expression EXP 6480464 imisopasem manganese results in increased expression of NRF1 protein CTD PMID:28483572 Nrf1 Rat indinavir increases expression ISO Nrf1 (Mus musculus) 6480464 Indinavir results in increased expression of NRF1 mRNA CTD PMID:17926646 Nrf1 Rat isoniazide multiple interactions ISO NRF1 (Homo sapiens) 6480464 acadesine inhibits the reaction [Isoniazid results in decreased expression of NRF1 protein] CTD PMID:28556920 Nrf1 Rat isoniazide decreases expression ISO NRF1 (Homo sapiens) 6480464 Isoniazid results in decreased expression of NRF1 protein CTD PMID:28556920 Nrf1 Rat lenvatinib affects expression EXP 6480464 lenvatinib affects the expression of NRF1 mRNA CTD PMID:34019861 Nrf1 Rat Licarin A multiple interactions ISO Nrf1 (Mus musculus) 6480464 [licarin A affects the susceptibility to [INS protein co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone]] which results in increased expression of NRF1 mRNA CTD PMID:29288687 Nrf1 Rat losartan increases expression EXP 6480464 Losartan results in increased expression of NRF1 mRNA CTD PMID:18765277 Nrf1 Rat LY294002 multiple interactions ISO NRF1 (Homo sapiens) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [cobaltiprotoporphyrin results in increased expression of NRF1 mRNA] and 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [tricarbonylchloro(glycinato)ruthenium(II) results in increased expression of NRF1 mRNA] CTD PMID:24041027 Nrf1 Rat LY294002 multiple interactions EXP 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [Carbon Monoxide promotes the reaction [NRF1 protein binds to PPARGC1A protein]] and 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [Carbon Monoxide results in increased expression of NRF1 protein] CTD PMID:17179207 Nrf1 Rat lycopene multiple interactions ISO Nrf1 (Mus musculus) 6480464 Lycopene inhibits the reaction [Diethylhexyl Phthalate results in increased expression of NRF1 mRNA] CTD PMID:33908429 Nrf1 Rat manganese(II) chloride multiple interactions EXP 6480464 Hemin inhibits the reaction [manganese chloride affects the expression of NRF1 protein] CTD PMID:30040983 Nrf1 Rat manganese(II) chloride affects expression EXP 6480464 manganese chloride affects the expression of NRF1 protein CTD PMID:30040983 Nrf1 Rat melatonin multiple interactions EXP 6480464 Melatonin inhibits the reaction [Carbon Tetrachloride results in decreased expression of NRF1 protein] CTD PMID:26882442 Nrf1 Rat mepanipyrim increases expression ISO NRF1 (Homo sapiens) 6480464 mepanipyrim results in increased expression of NRF1 mRNA CTD PMID:33352482 Nrf1 Rat metformin increases expression ISO Nrf1 (Mus musculus) 6480464 Metformin results in increased expression of NRF1 mRNA CTD PMID:24428821 Nrf1 Rat metformin increases expression ISO NRF1 (Homo sapiens) 6480464 Metformin results in increased expression of NRF1 mRNA CTD PMID:16380484 Nrf1 Rat methamphetamine increases expression ISO Nrf1 (Mus musculus) 6480464 Methamphetamine results in increased expression of NRF1 mRNA CTD PMID:26307267 Nrf1 Rat methidathion decreases expression ISO Nrf1 (Mus musculus) 6480464 methidathion results in decreased expression of NRF1 mRNA CTD PMID:34813904 Nrf1 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of NRF1 mRNA CTD PMID:30047161 Nrf1 Rat methoxyacetic acid decreases expression EXP 6480464 methoxyacetic acid results in decreased expression of NRF1 mRNA CTD PMID:20864626 Nrf1 Rat methylglyoxal increases expression EXP 6480464 Pyruvaldehyde results in increased expression of NRF1 mRNA CTD PMID:23331247 Nrf1 Rat methylglyoxal multiple interactions EXP 6480464 monascin inhibits the reaction [Pyruvaldehyde results in increased expression of NRF1 mRNA] more ... CTD PMID:23331247 Nrf1 Rat methylmercury chloride decreases expression EXP 6480464 methylmercuric chloride results in decreased expression of NRF1 mRNA CTD PMID:20864626 Nrf1 Rat mitomycin C decreases expression ISO Nrf1 (Mus musculus) 6480464 Mitomycin results in decreased expression of NRF1 mRNA CTD PMID:25270620 Nrf1 Rat MitoTEMPO multiple interactions ISO NRF1 (Homo sapiens) 6480464 MitoTEMPO inhibits the reaction [Doxorubicin results in decreased expression of NRF1 protein] CTD PMID:29729358 Nrf1 Rat monascin multiple interactions EXP 6480464 monascin inhibits the reaction [Pyruvaldehyde results in increased expression of NRF1 mRNA] and Tretinoin inhibits the reaction [monascin inhibits the reaction [Pyruvaldehyde results in increased expression of NRF1 mRNA]] CTD PMID:23331247 Nrf1 Rat mono(2-ethylhexyl) phthalate affects expression ISO Nrf1 (Mus musculus) 6480464 mono-(2-ethylhexyl)phthalate affects the expression of NRF1 mRNA CTD PMID:32522588 Nrf1 Rat Monobutylphthalate decreases expression EXP 6480464 monobutyl phthalate results in decreased expression of NRF1 mRNA CTD PMID:20864626 Nrf1 Rat monocrotophos multiple interactions EXP 6480464 Acetylcysteine inhibits the reaction [Monocrotophos results in decreased expression of NRF1 mRNA] CTD PMID:35403558 Nrf1 Rat monocrotophos decreases expression EXP 6480464 Monocrotophos results in decreased expression of NRF1 mRNA CTD PMID:35403558 Nrf1 Rat N-acetyl-L-cysteine multiple interactions EXP 6480464 Acetylcysteine inhibits the reaction [Atorvastatin results in increased expression of NRF1 mRNA] more ... CTD PMID:21775390 more ... Nrf1 Rat N-methyl-4-phenylpyridinium multiple interactions ISO Nrf1 (Mus musculus) 6480464 salvianolic acid B inhibits the reaction [1-Methyl-4-phenylpyridinium results in decreased expression of NRF1 mRNA] and salvianolic acid B inhibits the reaction [1-Methyl-4-phenylpyridinium results in decreased expression of NRF1 protein] CTD PMID:33994527 Nrf1 Rat N-methyl-4-phenylpyridinium decreases expression ISO Nrf1 (Mus musculus) 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of NRF1 mRNA and 1-Methyl-4-phenylpyridinium results in decreased expression of NRF1 protein CTD PMID:33994527 Nrf1 Rat N-methyl-4-phenylpyridinium decreases expression ISO NRF1 (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of NRF1 mRNA and 1-Methyl-4-phenylpyridinium results in decreased expression of NRF1 protein CTD PMID:26141122 Nrf1 Rat N-methyl-4-phenylpyridinium multiple interactions ISO NRF1 (Homo sapiens) 6480464 PPARGC1A protein inhibits the reaction [1-Methyl-4-phenylpyridinium results in decreased expression of NRF1 mRNA] and PPARGC1A protein inhibits the reaction [1-Methyl-4-phenylpyridinium results in decreased expression of NRF1 protein] CTD PMID:26141122 Nrf1 Rat nickel atom multiple interactions ISO Nrf1 (Mus musculus) 6480464 [nickel chloride results in increased abundance of Nickel] which results in decreased expression of NRF1 mRNA CTD PMID:36794572 Nrf1 Rat nickel dichloride multiple interactions ISO Nrf1 (Mus musculus) 6480464 [nickel chloride results in increased abundance of Nickel] which results in decreased expression of NRF1 mRNA CTD PMID:36794572 Nrf1 Rat nickel dichloride decreases expression ISO Nrf1 (Mus musculus) 6480464 nickel chloride results in decreased expression of NRF1 mRNA and nickel chloride results in decreased expression of NRF1 protein CTD PMID:38552765 Nrf1 Rat nitrates multiple interactions ISO Nrf1 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of NRF1 mRNA CTD PMID:35964746 Nrf1 Rat oleic acid multiple interactions ISO Nrf1 (Mus musculus) 6480464 [Oleic Acid co-treated with Palmitic Acid] results in decreased expression of NRF1 mRNA and FOXO1 protein affects the reaction [[Oleic Acid co-treated with Palmitic Acid] results in decreased expression of NRF1 mRNA] CTD PMID:26847930 Nrf1 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of NRF1 mRNA CTD PMID:25729387 Nrf1 Rat oxybenzone increases expression EXP 6480464 oxybenzone results in increased expression of NRF1 mRNA CTD PMID:30316929 Nrf1 Rat ozone increases expression ISO Nrf1 (Mus musculus) 6480464 Ozone results in increased expression of NRF1 mRNA CTD PMID:27240593 Nrf1 Rat p-toluidine decreases expression EXP 6480464 4-toluidine results in decreased expression of NRF1 mRNA CTD PMID:27638505 Nrf1 Rat paracetamol increases expression ISO NRF1 (Homo sapiens) 6480464 Acetaminophen results in increased expression of NRF1 mRNA CTD PMID:29067470 Nrf1 Rat paracetamol increases expression ISO Nrf1 (Mus musculus) 6480464 Acetaminophen results in increased expression of NRF1 protein CTD PMID:28827156 and PMID:33271250 Nrf1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Nrf1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of NRF1 mRNA CTD PMID:36331819 Nrf1 Rat perfluorooctanoic acid increases expression EXP 6480464 perfluorooctanoic acid results in increased expression of NRF1 mRNA CTD PMID:19616056 Nrf1 Rat potassium chloride increases expression EXP 6480464 Potassium Chloride results in increased expression of NRF1 mRNA and Potassium Chloride results in increased expression of NRF1 protein CTD PMID:20438809 Nrf1 Rat pregnenolone 16alpha-carbonitrile decreases expression EXP 6480464 Pregnenolone Carbonitrile results in decreased expression of NRF1 mRNA CTD PMID:30047161 Nrf1 Rat propham increases expression ISO NRF1 (Homo sapiens) 6480464 propham results in increased expression of NRF1 mRNA CTD PMID:33352482 Nrf1 Rat pyrimethanil increases expression ISO NRF1 (Homo sapiens) 6480464 pyrimethanil results in increased expression of NRF1 mRNA CTD PMID:33352482 Nrf1 Rat pyrroloquinoline quinone increases expression ISO NRF1 (Homo sapiens) 6480464 PQQ Cofactor results in increased expression of NRF1 mRNA CTD PMID:28578007 Nrf1 Rat quercetin multiple interactions EXP 6480464 Quercetin inhibits the reaction [aluminum lactate results in decreased expression of NRF1 mRNA] more ... CTD PMID:21775390 and PMID:26493151 Nrf1 Rat raloxifene multiple interactions ISO NRF1 (Homo sapiens) 6480464 fulvestrant inhibits the reaction [Raloxifene Hydrochloride results in increased expression of NRF1 mRNA] and Vehicle Emissions inhibits the reaction [Raloxifene Hydrochloride results in increased expression of NRF1 mRNA] CTD PMID:22105178 Nrf1 Rat raloxifene increases expression ISO NRF1 (Homo sapiens) 6480464 Raloxifene Hydrochloride results in increased expression of NRF1 mRNA CTD PMID:22105178 Nrf1 Rat reactive oxygen species multiple interactions ISO NRF1 (Homo sapiens) 6480464 NRF1 mutant form promotes the reaction [Benzo(a)pyrene results in increased abundance of Reactive Oxygen Species] CTD PMID:21401886 Nrf1 Rat resveratrol multiple interactions ISO NRF1 (Homo sapiens) 6480464 1H-(1 more ... CTD PMID:22105178 more ... Nrf1 Rat resveratrol multiple interactions ISO Nrf1 (Mus musculus) 6480464 [Dietary Fats co-treated with Resveratrol] results in increased expression of NRF1 mRNA more ... CTD PMID:24041027 more ... Nrf1 Rat resveratrol increases expression ISO NRF1 (Homo sapiens) 6480464 resveratrol results in increased expression of NRF1 mRNA CTD PMID:22105178 and PMID:24041027 Nrf1 Rat resveratrol multiple interactions EXP 6480464 dorsomorphin inhibits the reaction [Resveratrol results in increased expression of NRF1 mRNA] more ... CTD PMID:20438809 more ... Nrf1 Rat resveratrol increases expression ISO Nrf1 (Mus musculus) 6480464 Resveratrol results in increased expression of NRF1 mRNA and Resveratrol results in increased expression of NRF1 protein CTD PMID:20561979 more ... Nrf1 Rat resveratrol increases expression EXP 6480464 Resveratrol results in increased expression of NRF1 mRNA and Resveratrol results in increased expression of NRF1 protein CTD PMID:20429690 more ... Nrf1 Rat resveratrol decreases expression ISO Nrf1 (Mus musculus) 6480464 resveratrol results in decreased expression of NRF1 mRNA CTD PMID:21270273 Nrf1 Rat rotenone increases expression ISO Nrf1 (Mus musculus) 6480464 Rotenone results in increased expression of NRF1 mRNA CTD PMID:21536665 Nrf1 Rat rotenone multiple interactions ISO Nrf1 (Mus musculus) 6480464 PPARGC1A protein affects the reaction [Rotenone results in increased expression of NRF1 mRNA] CTD PMID:21536665 Nrf1 Rat salvianolic acid B multiple interactions ISO Nrf1 (Mus musculus) 6480464 salvianolic acid B inhibits the reaction [1-Methyl-4-phenylpyridinium results in decreased expression of NRF1 mRNA] and salvianolic acid B inhibits the reaction [1-Methyl-4-phenylpyridinium results in decreased expression of NRF1 protein] CTD PMID:33994527 Nrf1 Rat selenium atom multiple interactions EXP 6480464 NRF1 protein promotes the reaction [Selenium results in increased expression of TFAM mRNA] CTD PMID:17936198 Nrf1 Rat selenium atom increases expression EXP 6480464 Selenium results in increased expression of NRF1 mRNA CTD PMID:17936198 Nrf1 Rat sodium arsenite multiple interactions EXP 6480464 sodium arsenite results in decreased expression of and affects the localization of NRF1 protein CTD PMID:27425645 Nrf1 Rat sodium arsenite multiple interactions ISO NRF1 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of NRF1 mRNA CTD PMID:39836092 Nrf1 Rat sodium arsenite increases expression ISO NRF1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of NRF1 mRNA CTD PMID:29301061 and PMID:34032870 Nrf1 Rat sodium arsenite affects expression ISO NRF1 (Homo sapiens) 6480464 sodium arsenite affects the expression of NRF1 mRNA CTD PMID:29319823 Nrf1 Rat sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of NRF1 mRNA and sodium arsenite results in decreased expression of NRF1 protein CTD PMID:26767369 and PMID:27425645 Nrf1 Rat sodium hydrogensulfite multiple interactions EXP 6480464 Acetylcysteine inhibits the reaction [sodium bisulfite results in decreased expression of NRF1 mRNA] CTD PMID:26980303 Nrf1 Rat sodium hydrogensulfite decreases expression EXP 6480464 sodium bisulfite results in decreased expression of NRF1 mRNA and sodium bisulfite results in decreased expression of NRF1 protein CTD PMID:26980303 Nrf1 Rat Soman decreases expression EXP 6480464 Soman results in decreased expression of NRF1 mRNA CTD PMID:19281266 Nrf1 Rat stavudine increases expression ISO Nrf1 (Mus musculus) 6480464 Stavudine results in increased expression of NRF1 mRNA CTD PMID:17926646 Nrf1 Rat sulforaphane increases expression ISO NRF1 (Homo sapiens) 6480464 sulforaphane results in increased expression of NRF1 protein CTD PMID:27993529 Nrf1 Rat sulfur dioxide increases expression EXP 6480464 Sulfur Dioxide results in increased expression of NRF1 protein CTD PMID:22677886 Nrf1 Rat sulfur dioxide decreases expression EXP 6480464 Sulfur Dioxide results in decreased expression of NRF1 mRNA and Sulfur Dioxide results in decreased expression of NRF1 protein CTD PMID:26980303 Nrf1 Rat T-2 toxin multiple interactions ISO NRF1 (Homo sapiens) 6480464 NFE2L2 protein affects the reaction [T-2 Toxin results in decreased expression of NRF1 mRNA] more ... CTD PMID:31470059 and PMID:35842139 Nrf1 Rat T-2 toxin decreases expression ISO NRF1 (Homo sapiens) 6480464 T-2 Toxin results in decreased expression of NRF1 mRNA and T-2 Toxin results in decreased expression of NRF1 protein CTD PMID:35842139 Nrf1 Rat T-2 toxin affects expression EXP 6480464 T-2 Toxin affects the expression of NRF1 mRNA CTD PMID:29870751 Nrf1 Rat T-2 toxin decreases expression ISO Nrf1 (Mus musculus) 6480464 T-2 Toxin results in decreased expression of NRF1 protein CTD PMID:27363784 Nrf1 Rat T-2 toxin multiple interactions ISO Nrf1 (Mus musculus) 6480464 6-hydroxy-2 more ... CTD PMID:27363784 Nrf1 Rat tetrachloromethane multiple interactions EXP 6480464 Melatonin inhibits the reaction [Carbon Tetrachloride results in decreased expression of NRF1 protein] and schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of NRF1 mRNA] CTD PMID:26882442 and PMID:31150632 Nrf1 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of NRF1 mRNA CTD PMID:31150632 Nrf1 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of NRF1 protein CTD PMID:26882442 Nrf1 Rat thapsigargin multiple interactions ISO NRF1 (Homo sapiens) 6480464 NRF1 protein inhibits the reaction [Thapsigargin results in decreased phosphorylation of AKT1 protein] CTD PMID:22378314 Nrf1 Rat thapsigargin decreases expression ISO NRF1 (Homo sapiens) 6480464 Thapsigargin results in decreased expression of NRF1 mRNA CTD PMID:22378314 Nrf1 Rat titanium dioxide increases methylation ISO Nrf1 (Mus musculus) 6480464 titanium dioxide results in increased methylation of NRF1 gene CTD PMID:35295148 Nrf1 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of NRF1 mRNA CTD PMID:25729387 Nrf1 Rat topotecan decreases expression EXP 6480464 Topotecan results in decreased expression of NRF1 mRNA CTD PMID:25729387 Nrf1 Rat trimellitic anhydride increases expression ISO Nrf1 (Mus musculus) 6480464 trimellitic anhydride results in increased expression of NRF1 mRNA CTD PMID:19042947 Nrf1 Rat Triptolide decreases expression ISO Nrf1 (Mus musculus) 6480464 triptolide results in decreased expression of NRF1 mRNA CTD PMID:29723566 Nrf1 Rat Triptolide decreases expression EXP 6480464 triptolide results in decreased expression of NRF1 mRNA CTD PMID:36436616 Nrf1 Rat Triptolide multiple interactions EXP 6480464 7 more ... CTD PMID:36436616 Nrf1 Rat triptonide affects expression ISO Nrf1 (Mus musculus) 6480464 triptonide affects the expression of NRF1 mRNA CTD PMID:33045310 Nrf1 Rat troglitazone increases expression EXP 6480464 troglitazone results in increased expression of NRF1 mRNA CTD PMID:14563825 Nrf1 Rat tunicamycin decreases expression ISO NRF1 (Homo sapiens) 6480464 Tunicamycin results in decreased expression of NRF1 mRNA CTD PMID:22378314 Nrf1 Rat uranium atom affects expression ISO NRF1 (Homo sapiens) 6480464 Uranium affects the expression of NRF1 mRNA CTD PMID:15672453 Nrf1 Rat urethane increases expression ISO NRF1 (Homo sapiens) 6480464 Urethane results in increased expression of NRF1 mRNA CTD PMID:28818685 Nrf1 Rat valproic acid decreases expression ISO Nrf1 (Mus musculus) 6480464 Valproic Acid results in decreased expression of NRF1 mRNA CTD PMID:21427059 Nrf1 Rat valproic acid decreases expression ISO NRF1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of NRF1 mRNA CTD PMID:28001369 Nrf1 Rat valproic acid affects expression ISO NRF1 (Homo sapiens) 6480464 Valproic Acid affects the expression of NRF1 mRNA CTD PMID:25979313 Nrf1 Rat zidovudine increases expression ISO Nrf1 (Mus musculus) 6480464 Zidovudine results in increased expression of NRF1 mRNA CTD PMID:17926646 Nrf1 Rat zinc atom multiple interactions ISO NRF1 (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of NRF1 mRNA CTD PMID:18593933 Nrf1 Rat zinc(0) multiple interactions ISO NRF1 (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of NRF1 mRNA CTD PMID:18593933
Imported Annotations - KEGG (archival)
(+)-schisandrin B (EXP) (R)-noradrenaline (EXP) 1-chloro-2,4-dinitrobenzene (ISO) 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO) 17beta-estradiol (EXP,ISO) 1H-[1,2,4]oxadiazolo[4,3-a]quinoxalin-1-one (EXP,ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,3-bis(4-hydroxyphenyl)propionitrile (ISO) 2,4-dinitrophenol (ISO) 3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine (EXP) 3,4-methylenedioxymethamphetamine (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 3-phenylprop-2-enal (ISO) 4,4'-diaminodiphenylmethane (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) 8-bromo-3',5'-cyclic GMP (ISO) acadesine (ISO) acetylsalicylic acid (ISO) acrolein (EXP) afimoxifene (ISO) aflatoxin B1 (ISO) AICA ribonucleotide (EXP) aldehydo-D-glucose (EXP) all-trans-retinoic acid (EXP) alloxan (EXP) AM-251 (ISO) amitrole (EXP) ammonium chloride (EXP) antirheumatic drug (ISO) arachidonyl-2'-chloroethylamide (ISO) Aroclor 1254 (ISO) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) atorvastatin calcium (EXP) atrazine (EXP,ISO) benzo[a]pyrene (EXP,ISO) benzo[a]pyrene diol epoxide I (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP) Butylbenzyl phthalate (ISO) cadmium atom (EXP) cadmium dichloride (EXP) caffeine (EXP) calcitriol (EXP) calycosin (EXP) carbon monoxide (EXP,ISO) CHIR 99021 (ISO) cisplatin (ISO) copper atom (EXP,ISO) copper(0) (EXP,ISO) copper(II) sulfate (ISO) cyclosporin A (ISO) cyprodinil (ISO) D-glucose (EXP) dexamethasone (ISO) Di-n-octyl phthalate (ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dioxygen (EXP,ISO) dorsomorphin (EXP) doxorubicin (ISO) elemental selenium (EXP) enalapril (EXP) enniatin (EXP) enzyme inhibitor (ISO) Erythropoietin (ISO) ethidium (ISO) fenthion (ISO) fenvalerate (EXP) fludioxonil (ISO) Flumetralin (ISO) formaldehyde (ISO) FR900359 (ISO) fulvestrant (ISO) gamma-hexachlorocyclohexane (ISO) Genipin (ISO) Gingerenone A (ISO) glucose (EXP) hemin (EXP) hexadecanoic acid (ISO) hydrogen peroxide (ISO) imisopasem manganese (EXP) indinavir (ISO) isoniazide (ISO) lenvatinib (EXP) Licarin A (ISO) losartan (EXP) LY294002 (EXP,ISO) lycopene (ISO) manganese(II) chloride (EXP) melatonin (EXP) mepanipyrim (ISO) metformin (ISO) methamphetamine (ISO) methidathion (ISO) methimazole (EXP) methoxyacetic acid (EXP) methylglyoxal (EXP) methylmercury chloride (EXP) mitomycin C (ISO) MitoTEMPO (ISO) monascin (EXP) mono(2-ethylhexyl) phthalate (ISO) Monobutylphthalate (EXP) monocrotophos (EXP) N-acetyl-L-cysteine (EXP) N-methyl-4-phenylpyridinium (ISO) nickel atom (ISO) nickel dichloride (ISO) nitrates (ISO) oleic acid (ISO) oxaliplatin (EXP) oxybenzone (EXP) ozone (ISO) p-toluidine (EXP) paracetamol (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP) potassium chloride (EXP) pregnenolone 16alpha-carbonitrile (EXP) propham (ISO) pyrimethanil (ISO) pyrroloquinoline quinone (ISO) quercetin (EXP) raloxifene (ISO) reactive oxygen species (ISO) resveratrol (EXP,ISO) rotenone (ISO) salvianolic acid B (ISO) selenium atom (EXP) sodium arsenite (EXP,ISO) sodium hydrogensulfite (EXP) Soman (EXP) stavudine (ISO) sulforaphane (ISO) sulfur dioxide (EXP) T-2 toxin (EXP,ISO) tetrachloromethane (EXP) thapsigargin (ISO) titanium dioxide (ISO) topotecan (EXP) trimellitic anhydride (ISO) Triptolide (EXP,ISO) triptonide (ISO) troglitazone (EXP) tunicamycin (ISO) uranium atom (ISO) urethane (ISO) valproic acid (ISO) zidovudine (ISO) zinc atom (ISO) zinc(0) (ISO)
1.
Impairment of PGC-1alpha expression, neuropathology and hepatic steatosis in a transgenic mouse model of Huntington's disease following chronic energy deprivation.
Chaturvedi RK, etal., Hum Mol Genet. 2010 Aug 15;19(16):3190-205. Epub 2010 Jun 7.
2.
Changes in mitochondrial DNA deletion, content, and biogenesis in folate-deficient tissues of young rats depend on mitochondrial folate and oxidative DNA injuries.
Chou YF, etal., J Nutr. 2007 Sep;137(9):2036-42.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
5.
Stimulation of mitochondrial biogenesis and autophagy by lipopolysaccharide in the neonatal rat cardiomyocyte protects against programmed cell death.
Hickson-Bick DL, etal., J Mol Cell Cardiol. 2008 Feb;44(2):411-8. Epub 2007 Dec 11.
6.
Nrf2 signaling in coordinated activation of antioxidant gene expression.
Jaiswal AK Free Radic Biol Med 2004 May 15;36(10):1199-207.
7.
Increases in the mitochondrial DNA replication and transcription in the remnant liver of rats.
Koyama H, etal., Biochem Biophys Res Commun. 1998 Feb 24;243(3):858-61.
8.
Sustained hypoxia modulates mitochondrial DNA content in the neonatal rat brain.
Lee HM, etal., Free Radic Biol Med. 2008 Mar 1;44(5):807-14. Epub 2007 Nov 21.
9.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
10.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
11.
GOA pipeline
RGD automated data pipeline
12.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
13.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
14.
Comprehensive gene review and curation
RGD comprehensive gene curation
15.
Estrogen increases mitochondrial efficiency and reduces oxidative stress in cerebral blood vessels.
Stirone C, etal., Mol Pharmacol. 2005 Oct;68(4):959-65. Epub 2005 Jun 30.
16.
Lipopolysaccharide stimulates mitochondrial biogenesis via activation of nuclear respiratory factor-1.
Suliman HB, etal., J Biol Chem 2003 Oct 17;278(42):41510-8. Epub 2003 Aug 05.
17.
PGC-1alpha downstream transcription factors NRF-1 and TFAM are genetic modifiers of Huntington disease.
Taherzadeh-Fard E, etal., Mol Neurodegener. 2011 May 19;6(1):32.
18.
Activation of the cytochrome c gene by electrical stimulation in neonatal rat cardiac myocytes. Role of NRF-1 and c-Jun.
Xia Y, etal., J Biol Chem. 1998 May 15;273(20):12593-8.
19.
WY14643 improves left ventricular myocardial mitochondrial and systolic functions in obese rats under chronic persistent hypoxia via the PPARα pathway.
Yan J, etal., Life Sci. 2021 Feb 1;266:118888. doi: 10.1016/j.lfs.2020.118888. Epub 2020 Dec 10.
20.
Activity-dependent transcriptional regulation of nuclear respiratory factor-1 in cultured rat visual cortical neurons.
Yang SJ, etal., Neuroscience. 2006 Sep 1;141(3):1181-92. Epub 2006 Jun 6.
21.
Rapidly increased neuronal mitochondrial biogenesis after hypoxic-ischemic brain injury.
Yin W, etal., Stroke. 2008 Nov;39(11):3057-63. Epub 2008 Aug 21.
22.
Genomic modulation of mitochondrial respiratory genes in the hypertrophied heart reflects adaptive changes in mitochondrial and contractile function.
Zungu M, etal., Am J Physiol Heart Circ Physiol. 2007 Nov;293(5):H2819-25. Epub 2007 Aug 17.
Nrf1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 59,632,366 - 59,738,166 (+) NCBI GRCr8 mRatBN7.2 4 58,664,932 - 58,772,328 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 58,664,957 - 58,825,328 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 63,642,477 - 63,739,391 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 59,558,637 - 59,655,557 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 57,960,536 - 58,057,462 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 57,335,732 - 57,445,317 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 57,378,069 - 57,445,341 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 57,097,471 - 57,207,118 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 56,949,553 - 57,048,149 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 57,267,163 - 57,331,137 (+) NCBI Celera 4 53,766,265 - 53,861,921 (+) NCBI Celera Cytogenetic Map 4 q22 NCBI
NRF1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 7 129,611,720 - 129,757,076 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 7 129,611,720 - 129,757,082 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 7 129,251,561 - 129,396,916 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 7 129,038,791 - 129,184,158 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 7 128,845,547 - 128,989,805 NCBI Celera 7 124,047,294 - 124,192,656 (+) NCBI Celera Cytogenetic Map 7 q32.2 NCBI HuRef 7 123,613,242 - 123,758,239 (+) NCBI HuRef CHM1_1 7 129,185,036 - 129,330,325 (+) NCBI CHM1_1 T2T-CHM13v2.0 7 130,924,847 - 131,070,183 (+) NCBI T2T-CHM13v2.0 CRA_TCAGchr7v2 7 128,635,837 - 128,781,204 (+) NCBI
Nrf1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 30,047,984 - 30,153,462 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 30,047,987 - 30,153,457 (+) Ensembl GRCm39 Ensembl GRCm38 6 30,047,985 - 30,153,458 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 30,047,988 - 30,153,458 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 29,997,988 - 30,103,458 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 29,997,998 - 30,103,468 (+) NCBI MGSCv36 mm8 Celera 6 30,053,407 - 30,160,369 (+) NCBI Celera Cytogenetic Map 6 A3.3 NCBI cM Map 6 12.47 NCBI
Nrf1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955479 10,324,443 - 10,472,875 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955479 10,325,214 - 10,471,421 (+) NCBI ChiLan1.0 ChiLan1.0
NRF1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 6 166,429,088 - 166,574,279 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 7 18,439,333 - 18,584,524 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 7 121,574,061 - 121,719,604 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 7 134,095,925 - 134,240,158 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 7 134,113,482 - 134,240,158 (+) Ensembl panpan1.1 panPan2
NRF1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 14 7,085,018 - 7,218,802 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 14 7,085,791 - 7,193,034 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 14 6,770,310 - 6,906,180 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 14 6,848,014 - 6,983,992 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 14 6,848,018 - 6,983,930 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 14 7,053,598 - 7,189,532 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 14 6,795,757 - 6,931,636 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 14 6,940,039 - 7,075,975 (-) NCBI UU_Cfam_GSD_1.0
Nrf1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 25,291,442 - 25,427,802 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936579 5,423,773 - 5,561,003 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936579 5,424,049 - 5,560,355 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
NRF1
NRF1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 21 98,227,088 - 98,377,095 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 21 98,268,395 - 98,377,096 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666042 5,026,792 - 5,175,767 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Nrf1
.
Predicted Target Of
Count of predictions: 13 Count of miRNA genes: 12 Interacting mature miRNAs: 13 Transcripts: ENSRNOT00000011851 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2303585 Bw86 Body weight QTL 86 4 body mass (VT:0001259) body weight (CMO:0000012) 4 14678065 59678065 Rat 5685012 Bmd87 Bone mineral density QTL 87 5.1 tibia mineral mass (VT:1000283) bone mineral content (CMO:0001554) 4 56647776 78882945 Rat 1358352 Srcrt3 Stress Responsive Cort QTL 3 2.29 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 38465774 146803430 Rat 61445 Strs3 Sensitivity to stroke QTL 3 3 cerebrum integrity trait (VT:0010549) post-insult time to onset of cerebrovascular lesion (CMO:0002343) 4 40433388 85433388 Rat 6893678 Bw108 Body weight QTL 108 2.6 0.006 body mass (VT:0001259) body weight (CMO:0000012) 4 43457976 88457976 Rat 5685009 Bmd86 Bone mineral density QTL 86 3.7 tibia mineral mass (VT:1000283) bone mineral density (CMO:0001226) 4 56647776 78882945 Rat 10755501 Bp390 Blood pressure QTL 390 2.5 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 4 26775591 168368347 Rat 1331807 Rf31 Renal function QTL 31 2.988 urine potassium amount (VT:0010539) urine potassium level (CMO:0000128) 4 39524264 74726312 Rat 8552782 Vie1 Viral induced encephalitis QTL 1 26.4 brain integrity trait (VT:0010579) encephalitis incidence/prevalence measurement (CMO:0002361) 4 34430484 82490359 Rat 634311 Sach7 Saccharin preference QTL 7 taste sensitivity trait (VT:0001986) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 4 57114432 81266970 Rat 1358363 Sradr3 Stress Responsive Adrenal Weight QTL 3 6.19 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 4 57486946 102486946 Rat 631261 Tcas3 Tongue tumor susceptibility QTL 3 6.88 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 4 10814170 91360527 Rat 2312567 Glom19 Glomerulus QTL 19 1.9 0.006 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 4 45456990 146803430 Rat 61336 Bp21 Blood pressure QTL 21 4.6 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 57114705 78881294 Rat 2313401 Anxrr27 Anxiety related response QTL 27 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 4 17933508 62933508 Rat 8655961 Kidm43 Kidney mass QTL 43 18 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 4 36303261 103194984 Rat 1354612 Foco1 Food consumption QTL 1 8.87 eating behavior trait (VT:0001431) food intake rate (CMO:0000427) 4 44463908 148090542 Rat 6909128 Pancm4 Pancreatic morphology QTL 4 11.35 pancreas mass (VT:0010144) pancreas wet weight (CMO:0000626) 4 26907285 75585128 Rat 2303168 Bp330 Blood pressure QTL 330 4.25 0.017 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 5214602 146446691 Rat 8552801 Bw143 Body weight QTL 143 7.3 body mass (VT:0001259) change in body weight to body weight ratio (CMO:0002216) 4 34430484 82490359 Rat 61475 Aia2 Adjuvant induced arthritis QTL 2 5.8 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 39505275 73892441 Rat 8694439 Bw168 Body weight QTL 168 9.57 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 4 40433414 85433414 Rat 61412 Pia2 Pristane induced arthritis QTL 2 3.9 joint integrity trait (VT:0010548) post-insult time to onset of experimental arthritis (CMO:0001450) 4 21333343 62278020 Rat 8655906 Rf60 Renal function QTL 60 3.8 blood creatinine amount (VT:0005328) creatinine clearance (CMO:0000765) 4 29494195 81006281 Rat 619616 Bp79 Blood pressure QTL 79 0.0292 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 5214602 78882945 Rat 1576305 Emca6 Estrogen-induced mammary cancer QTL 6 5.8 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 4 44463720 155883716 Rat 7387227 Uae40 Urinary albumin excretion QTL 40 2.9 0.0052 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 4 17946999 62946999 Rat 6909122 Insul22 Insulin level QTL 22 4.63 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 4 26907285 75585128 Rat 8552809 Vie5 Viral induced encephalitis QTL 5 25.3 brain integrity trait (VT:0010579) encephalitis incidence/prevalence measurement (CMO:0002361) 4 34430484 82490359 Rat 1558651 Swd3 Spike wave discharge measurement QTL 3 4.62 0.000024 brain electrophysiology trait (VT:0010557) brain spike-and-wave discharge frequency (CMO:0001742) 4 58432133 92991462 Rat 1358203 Stl19 Serum triglyceride level QTL 19 2.8 0.002 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 4 5218294 65958103 Rat 1354660 Salc1 Saline consumption QTL 1 11.26 drinking behavior trait (VT:0001422) saline drink intake rate (CMO:0001627) 4 44463908 148090542 Rat 1641833 Alc21 Alcohol consumption QTL 21 8.6 0.0001 drinking behavior trait (VT:0001422) ethanol drink intake rate (CMO:0001407) 4 56698790 126192555 Rat 1298082 Stresp4 Stress response QTL 4 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 50119848 146803430 Rat 631546 Bp86 Blood pressure QTL 86 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 57114432 91360801 Rat 1300139 Hrtrt6 Heart rate QTL 6 2.85 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 4 39524264 116179656 Rat 70200 Alc18 Alcohol consumption QTL 18 9.2 drinking behavior trait (VT:0001422) ethanol intake volume to total fluid intake volume ratio (CMO:0001591) 4 56647873 149491524 Rat 12798520 Anxrr55 Anxiety related response QTL 55 4.45 0.01 locomotor behavior trait (VT:0001392) number of rearing movements with lid-pushing in an experimental apparatus (CMO:0002715) 4 32583980 114627242 Rat 4889969 Bss96 Bone structure and strength QTL 96 4.9 tibia size trait (VT:0100001) tibia cortical bone volume (CMO:0001725) 4 56647776 78882945 Rat 2316958 Gluco58 Glucose level QTL 58 10 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 11320076 180699135 Rat 4889972 Bss97 Bone structure and strength QTL 97 5.6 tibia size trait (VT:0100001) tibia total bone volume (CMO:0001724) 4 56647776 78882945 Rat 631671 Iddm11 Insulin dependent diabetes mellitus QTL 11 3.6 0.0012 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 4 58635877 78886137 Rat
PMC97559P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 58,738,247 - 58,738,366 (+) MAPPER mRatBN7.2 Rnor_6.0 4 57,412,609 - 57,412,727 NCBI Rnor6.0 Rnor_5.0 4 57,174,410 - 57,174,528 UniSTS Rnor5.0 RGSC_v3.4 4 57,024,097 - 57,024,215 UniSTS RGSC3.4 Celera 4 53,837,869 - 53,837,987 UniSTS Cytogenetic Map 4 q22 UniSTS
RH130830
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 58,770,406 - 58,770,609 (+) MAPPER mRatBN7.2 Rnor_6.0 4 57,444,990 - 57,445,192 NCBI Rnor6.0 Rnor_5.0 4 57,206,791 - 57,206,993 UniSTS Rnor5.0 RGSC_v3.4 4 57,056,254 - 57,056,456 UniSTS RGSC3.4 Celera 4 53,870,026 - 53,870,228 UniSTS RH 3.4 Map 4 308.6 UniSTS Cytogenetic Map 4 q22 UniSTS
BF387640
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 58,693,032 - 58,693,202 (+) MAPPER mRatBN7.2 Rnor_6.0 4 57,365,413 - 57,365,582 NCBI Rnor6.0 Rnor_5.0 4 57,127,146 - 57,127,315 UniSTS Rnor5.0 RGSC_v3.4 4 56,978,292 - 56,978,461 UniSTS RGSC3.4 Celera 4 53,794,310 - 53,794,479 UniSTS RH 3.4 Map 4 320.4 UniSTS Cytogenetic Map 4 q22 UniSTS
RH127210
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 58,747,930 - 58,748,168 (+) MAPPER mRatBN7.2 Rnor_6.0 4 57,422,291 - 57,422,528 NCBI Rnor6.0 Rnor_5.0 4 57,184,092 - 57,184,329 UniSTS Rnor5.0 RGSC_v3.4 4 57,033,780 - 57,034,017 UniSTS RGSC3.4 Celera 4 53,847,552 - 53,847,789 UniSTS Cytogenetic Map 4 q22 UniSTS
RH136651
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 58,687,752 - 58,687,946 (+) MAPPER mRatBN7.2 Rnor_6.0 4 57,360,134 - 57,360,327 NCBI Rnor6.0 Rnor_5.0 4 57,121,867 - 57,122,060 UniSTS Rnor5.0 RGSC_v3.4 4 56,972,319 - 56,972,512 UniSTS RGSC3.4 Celera 4 53,789,031 - 53,789,224 UniSTS RH 3.4 Map 4 318.6 UniSTS Cytogenetic Map 4 q22 UniSTS
BE096654
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 58,758,309 - 58,758,508 (+) MAPPER mRatBN7.2 Rnor_6.0 4 57,432,894 - 57,433,092 NCBI Rnor6.0 Rnor_5.0 4 57,194,695 - 57,194,893 UniSTS Rnor5.0 RGSC_v3.4 4 57,044,158 - 57,044,356 UniSTS RGSC3.4 Celera 4 53,857,930 - 53,858,128 UniSTS RH 3.4 Map 4 310.1 UniSTS Cytogenetic Map 4 q22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000011851 ⟹ ENSRNOP00000011851
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 58,664,963 - 58,762,301 (+) Ensembl Rnor_6.0 Ensembl 4 57,378,166 - 57,436,884 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000080173 ⟹ ENSRNOP00000075252
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 58,704,418 - 58,770,665 (+) Ensembl Rnor_6.0 Ensembl 4 57,378,069 - 57,445,341 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000103272 ⟹ ENSRNOP00000082521
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 58,711,626 - 58,741,228 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000104816 ⟹ ENSRNOP00000079043
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 58,664,957 - 58,769,017 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000105926 ⟹ ENSRNOP00000096374
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 58,664,957 - 58,741,228 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000115640 ⟹ ENSRNOP00000083755
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 58,664,979 - 58,748,363 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000117472 ⟹ ENSRNOP00000094397
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 58,664,957 - 58,762,153 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000118984 ⟹ ENSRNOP00000091041
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 58,711,626 - 58,825,328 (+) Ensembl
RefSeq Acc Id:
NM_001100708 ⟹ NP_001094178
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 59,632,426 - 59,729,734 (+) NCBI mRatBN7.2 4 58,664,990 - 58,762,302 (+) NCBI Rnor_6.0 4 57,336,665 - 57,436,885 (+) NCBI Rnor_5.0 4 57,097,471 - 57,207,118 (+) NCBI RGSC_v3.4 4 56,949,553 - 57,048,149 (+) RGD Celera 4 53,766,265 - 53,861,921 (+) RGD
Sequence:
TGGCAGGAGGCTGCGAGGAGCCGGCGCGGTCGCAGTCTCCACGGCGCAGGCCCACGGTAGCGCAGCCGCTCTGAGGTCGAATGATCTGTGGTTCATATAGACCACATTTTGTTTCCCACTCACCCATT
hide sequence
RefSeq Acc Id:
XM_006236198 ⟹ XP_006236260
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 59,632,366 - 59,738,166 (+) NCBI mRatBN7.2 4 58,664,932 - 58,772,328 (+) NCBI Rnor_6.0 4 57,335,735 - 57,445,317 (+) NCBI Rnor_5.0 4 57,097,471 - 57,207,118 (+) NCBI
Sequence:
TTTGCTAAGCTGTTTTCTGACACCATGTGCGGCATTTTAAAATTATCTAGTGTGCATTAAATCTCCAGGAAGTGTTAAAAATGCAGGTTCTCGGAGTAAGTTAACACGTTAAGATTCTAGGTTTCAGT
hide sequence
RefSeq Acc Id:
XM_006236200 ⟹ XP_006236262
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 59,632,366 - 59,738,166 (+) NCBI mRatBN7.2 4 58,664,932 - 58,772,328 (+) NCBI Rnor_6.0 4 57,335,734 - 57,445,317 (+) NCBI Rnor_5.0 4 57,097,471 - 57,207,118 (+) NCBI
Sequence:
ATTTGCTAAGCTGTTTTCTGACACCATGTGCGGCATTTTAAAATTATCTAGTGTGCATTAAATC
hide sequence
RefSeq Acc Id:
XM_017592611 ⟹ XP_017448100
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 59,632,366 - 59,729,740 (+) NCBI mRatBN7.2 4 58,664,932 - 58,762,302 (+) NCBI Rnor_6.0 4 57,335,733 - 57,436,888 (+) NCBI
Sequence:
TATTTGCTAAGCTGTTTTCTGACACCATGTGCGGCATTTTAAAATTATCTAGTGTGCATTAAAT
hide sequence
RefSeq Acc Id:
XM_017592612 ⟹ XP_017448101
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 59,632,366 - 59,729,740 (+) NCBI mRatBN7.2 4 58,664,932 - 58,762,302 (+) NCBI Rnor_6.0 4 57,335,732 - 57,436,888 (+) NCBI
Sequence:
TTATTTGCTAAGCTGTTTTCTGACACCATGTGCGGCATTTTAAAATTATCTAGTGTGCATTAAATCTCCAGGAAGTGTTAAAAATGCAGGTTCTCGGAGTAAGTTAACACGTTAAGATTCTAGGTTTC
hide sequence
RefSeq Acc Id:
XM_039107511 ⟹ XP_038963439
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 59,632,366 - 59,738,166 (+) NCBI mRatBN7.2 4 58,664,932 - 58,772,328 (+) NCBI
RefSeq Acc Id:
XM_039107512 ⟹ XP_038963440
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 59,632,366 - 59,722,681 (+) NCBI mRatBN7.2 4 58,664,932 - 58,749,461 (+) NCBI
RefSeq Acc Id:
XM_039107513 ⟹ XP_038963441
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 59,632,366 - 59,729,541 (+) NCBI mRatBN7.2 4 58,664,932 - 58,762,015 (+) NCBI
RefSeq Acc Id:
XM_039107514 ⟹ XP_038963442
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 59,632,366 - 59,722,681 (+) NCBI mRatBN7.2 4 58,664,932 - 58,749,461 (+) NCBI
RefSeq Acc Id:
XM_063285982 ⟹ XP_063142052
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 59,632,366 - 59,729,740 (+) NCBI
RefSeq Acc Id:
XM_063285983 ⟹ XP_063142053
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 59,632,366 - 59,738,166 (+) NCBI
RefSeq Acc Id:
XM_063285984 ⟹ XP_063142054
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 59,632,366 - 59,738,166 (+) NCBI
RefSeq Acc Id:
XM_063285985 ⟹ XP_063142055
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 59,632,366 - 59,722,681 (+) NCBI
RefSeq Acc Id:
NP_001094178 ⟸ NM_001100708
- UniProtKB:
B1WC04 (UniProtKB/TrEMBL), A6IEF3 (UniProtKB/TrEMBL), F7FCI9 (UniProtKB/TrEMBL)
- Sequence:
MEEHGVTQTEHMATIEAHAVAQQVQQVHVATYTEHSMLSADEDSPSSPEDTSYDDSDILNSTAADEVTAHLAAAGPVGMAAAAAVATGKKRKRPHVFESNPSIRKRQQTRLLRKLRATLDEYTTRVGQ
hide sequence
RefSeq Acc Id:
XP_006236262 ⟸ XM_006236200
- Peptide Label:
isoform X8
- Sequence:
MEEHGVTQTEHMATIEAHAVAQQVQQVHVATYTEHSMLSADEDSPSSPEDTSYDDSDILNSTAA
hide sequence
RefSeq Acc Id:
XP_006236260 ⟸ XM_006236198
- Peptide Label:
isoform X4
- UniProtKB:
A6IEF2 (UniProtKB/TrEMBL), A0A8I6ALN8 (UniProtKB/TrEMBL)
- Sequence:
MEEHGVTQTEHMATIEAHAVAQQVQQVHVATYTEHSMLSADEDSPSSPEDTSYDDSDILNSTAADEVTAHLAAAGPVGMAAAAAVATGKKRKRPHVFESNPSIRKRQQTRLLRKLRATLDEYTTRVGQ
hide sequence
RefSeq Acc Id:
XP_017448101 ⟸ XM_017592612
- Peptide Label:
isoform X1
- Sequence:
MEEHGVTQTEHMATIEAHAVAQQVQQVHVATYTEHSMLSADEDSPSSPEDTSYDDSDILNSTAADEVTAHLAAAVLGIKPRASHILGPVGMAAAAAVATGKKRKRPHVFESNPSIRKRQQTRLLRKLR
hide sequence
RefSeq Acc Id:
XP_017448100 ⟸ XM_017592611
- Peptide Label:
isoform X1
- Sequence:
MEEHGVTQTEHMATIEAHAVAQQVQQVHVATYTEHSMLSADEDSPSSPEDTSYDDSDILNSTAA
hide sequence
Ensembl Acc Id:
ENSRNOP00000075252 ⟸ ENSRNOT00000080173
Ensembl Acc Id:
ENSRNOP00000011851 ⟸ ENSRNOT00000011851
RefSeq Acc Id:
XP_038963439 ⟸ XM_039107511
- Peptide Label:
isoform X3
- UniProtKB:
A0A0G2KA43 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038963441 ⟸ XM_039107513
- Peptide Label:
isoform X6
- UniProtKB:
A0A8I6ALN8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038963440 ⟸ XM_039107512
- Peptide Label:
isoform X5
- UniProtKB:
A0A8I6ALN8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038963442 ⟸ XM_039107514
- Peptide Label:
isoform X7
- UniProtKB:
A0A8I5ZWF5 (UniProtKB/TrEMBL), A0A8I6ALN8 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000096374 ⟸ ENSRNOT00000105926
Ensembl Acc Id:
ENSRNOP00000091041 ⟸ ENSRNOT00000118984
Ensembl Acc Id:
ENSRNOP00000082521 ⟸ ENSRNOT00000103272
Ensembl Acc Id:
ENSRNOP00000079043 ⟸ ENSRNOT00000104816
Ensembl Acc Id:
ENSRNOP00000094397 ⟸ ENSRNOT00000117472
Ensembl Acc Id:
ENSRNOP00000083755 ⟸ ENSRNOT00000115640
RefSeq Acc Id:
XP_063142053 ⟸ XM_063285983
- Peptide Label:
isoform X3
- UniProtKB:
A0A0G2KA43 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063142054 ⟸ XM_063285984
- Peptide Label:
isoform X4
- UniProtKB:
A6IEF2 (UniProtKB/TrEMBL), A0A8I6ALN8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063142052 ⟸ XM_063285982
- Peptide Label:
isoform X2
- UniProtKB:
A6IEF3 (UniProtKB/TrEMBL), B1WC04 (UniProtKB/TrEMBL), F7FCI9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063142055 ⟸ XM_063285985
- Peptide Label:
isoform X7
- UniProtKB:
A0A8I5ZWF5 (UniProtKB/TrEMBL), A0A8I6ALN8 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-04-30
Nrf1
nuclear respiratory factor 1
Nrf1_predicted
nuclear respiratory factor 1 (predicted)
'predicted' is removed
2292626 APPROVED
2007-01-31
Nrf1_predicted
nuclear respiratory factor 1 (predicted)
Nfe2l1_retired
nuclear factor (erythroid-derived 2)-like 1
Data merged from RGD:1303265
737654 APPROVED
2007-01-31
Nfe2l1_retired
Nfe2l1
nuclear factor (erythroid-derived 2)-like 1
Symbol updated
1299863 PROVISIONAL
2005-10-12
Nfe2l1
Symbol and Name status set to provisional
70820 PROVISIONAL
2005-01-12
Nrf1_predicted
nuclear respiratory factor 1 (predicted)
Symbol and Name status set to approved
70820 APPROVED
