Symbol: |
CAV1 |
Name: |
caveolin 1 |
RGD ID: |
12250353 |
Description: |
ENCODES a protein that exhibits kinase binding (ortholog); nitric-oxide synthase binding (ortholog); nitric-oxide synthase inhibitor activity (ortholog); INVOLVED IN caveola assembly; protein localization to basolateral plasma membrane; protein localization to plasma membrane raft; PARTICIPATES IN insulin signaling pathway; platelet-derived growth factor signaling pathway; reverse cholesterol transport pathway; ASSOCIATED WITH abdominal aortic aneurysm (ortholog); acoustic neuroma (ortholog); Acute Lung Injury (ortholog); FOUND IN caveola; exocytic vesicle; apical plasma membrane (ortholog); INTERACTS WITH bisphenol A; mocetinostat |
Type: |
protein-coding
|
RefSeq Status: |
PROVISIONAL |
Previously known as: |
caveolin-1; vesicular integral-membrane protein VIP21 |
RGD Orthologs |
|
Alliance Orthologs |
|
More Info |
more info ...
|
More Info |
Species |
Gene symbol and name |
Data Source |
Assertion derived from |
less info ...
|
Orthologs 1 |
Homo sapiens (human): |
CAV1 (caveolin 1) |
HGNC |
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam |
Mus musculus (house mouse): |
Cav1 (caveolin 1, caveolae protein) |
Transitive Ortholog Pipeline |
Transitive Ortholog Pipeline |
Rattus norvegicus (Norway rat): |
Cav1 (caveolin 1) |
Transitive Ortholog Pipeline |
Transitive Ortholog Pipeline |
Chinchilla lanigera (long-tailed chinchilla): |
Cav1 (caveolin 1) |
Transitive Ortholog Pipeline |
Transitive Ortholog Pipeline |
Pan paniscus (bonobo/pygmy chimpanzee): |
CAV1 (caveolin 1) |
Transitive Ortholog Pipeline |
Transitive Ortholog Pipeline |
Ictidomys tridecemlineatus (thirteen-lined ground squirrel): |
Cav1 (caveolin 1) |
Transitive Ortholog Pipeline |
Transitive Ortholog Pipeline |
Sus scrofa (pig): |
CAV1 (caveolin 1) |
Transitive Ortholog Pipeline |
Transitive Ortholog Pipeline |
Chlorocebus sabaeus (green monkey): |
CAV1 (caveolin 1) |
Transitive Ortholog Pipeline |
Transitive Ortholog Pipeline |
Heterocephalus glaber (naked mole-rat): |
Cav1 (caveolin 1) |
Transitive Ortholog Pipeline |
Transitive Ortholog Pipeline |
|
Latest Assembly: |
CanFam3.1 - Dog CanFam3.1 Assembly |
Position: |
Dog Assembly | Chr | Position (strand) | Source | Genome Browsers |
---|
JBrowse | NCBI | UCSC | Ensembl |
---|
CanFam3.1 | 14 | 55,458,934 - 55,494,563 (+) | NCBI | CanFam3.1 | CanFam3.1 | canFam3 | CanFam3.1 | CanFam3.1 Ensembl | 14 | 55,461,048 - 55,492,935 (+) | Ensembl | CanFam3.1 | | canFam3 | CanFam3.1 | Dog10K_Boxer_Tasha | 14 | 54,856,462 - 54,888,069 (+) | NCBI | | Dog10K_Boxer_Tasha | | | ROS_Cfam_1.0 | 14 | 55,500,946 - 55,536,541 (+) | NCBI | | ROS_Cfam_1.0 | | | ROS_Cfam_1.0 Ensembl | 14 | 55,503,040 - 55,536,538 (+) | Ensembl | | ROS_Cfam_1.0 Ensembl | | | UMICH_Zoey_3.1 | 14 | 55,530,973 - 55,562,566 (+) | NCBI | | UMICH_Zoey_3.1 | | | UNSW_CanFamBas_1.0 | 14 | 55,219,411 - 55,251,015 (+) | NCBI | | UNSW_CanFamBas_1.0 | | | UU_Cfam_GSD_1.0 | 14 | 55,590,528 - 55,622,125 (+) | NCBI | | UU_Cfam_GSD_1.0 | | |
|
JBrowse: |
View Region in Genome Browser (JBrowse)
|
Model |
|
CAV1 | Dog | abdominal aortic aneurysm | | ISO | RGD:1553438 | 9068941 | associated with Hypertension | RGD | PMID:24329494|REF_RGD_ID:8661789 | CAV1 | Dog | acoustic neuroma | | ISO | RGD:619568 | 9068941 | | RGD | PMID:20881564|REF_RGD_ID:8661782 | CAV1 | Dog | Acute Lung Injury | treatment | ISO | RGD:2280 | 9068941 | | RGD | PMID:24919947|REF_RGD_ID:10045573 | CAV1 | Dog | Alcoholic Liver Diseases | treatment | ISO | RGD:2280 | 9068941 | | RGD | PMID:23764359|REF_RGD_ID:8662277 | CAV1 | Dog | atherosclerosis | treatment | ISO | RGD:2280 | 9068941 | | RGD | PMID:23675421|REF_RGD_ID:8662275 | CAV1 | Dog | brain ischemia | | ISO | RGD:2280 | 9068941 | | RGD | PMID:16417587|REF_RGD_ID:1581152 | CAV1 | Dog | breast cancer | disease_progression | ISO | RGD:619568 | 9068941 | | RGD | PMID:21585620|REF_RGD_ID:8661766 | CAV1 | Dog | breast cancer | no_association | ISO | RGD:619568 | 9068941 | DNA:SNPs: :multiple | RGD | PMID:21965771|REF_RGD_ID:8661769 | CAV1 | Dog | breast cancer | | ISO | RGD:619568 | 9068941 | DNA:SNPs: :14713G>A (rs3807987), 29107T>A (rs7804372) (human) | RGD | PMID:21965771|REF_RGD_ID:8661769 | CAV1 | Dog | breast cancer | | ISO | RGD:619568 | 9068941 | DNA, protein:hypermethylation, decreased expression:promoter, breast | RGD | PMID:15375584|REF_RGD_ID:2289105 | CAV1 | Dog | breast carcinoma | | ISO | RGD:619568 | 9068941 | protein:increased expression:breast | RGD | PMID:17915016|REF_RGD_ID:2289101 | CAV1 | Dog | breast carcinoma | | ISO | RGD:619568 | 9068941 | DNA:missense mutation: :p.P132L (human) | RGD | PMID:11289096|REF_RGD_ID:8661775 | CAV1 | Dog | Cardiomegaly | | ISO | RGD:2280 | 9068941 | protein:increased expression:aorta | RGD | PMID:17487232|REF_RGD_ID:2289120 | CAV1 | Dog | Dermal Fibrosis | | ISO | RGD:1553438 | 9068941 | | RGD | PMID:18759267|REF_RGD_ID:8661773 | CAV1 | Dog | Diabetic Nephropathies | | ISO | RGD:619568 | 9068941 | mRNA:increased expression:nephron tubule (human) | RGD | PMID:35592524|REF_RGD_ID:401851916 | CAV1 | Dog | diabetic neuropathy | | ISO | RGD:1553438 | 9068941 | associated with Diabetes Mellitus, Experimental | RGD | PMID:19675140|REF_RGD_ID:8661787 | CAV1 | Dog | diffuse scleroderma | susceptibility | ISO | RGD:619568 | 9068941 | DNA:SNPs:intron, 3' utr: (rs729949, rs3815412, rs9920) (human) | RGD | PMID:22402147|REF_RGD_ID:8661768 | CAV1 | Dog | diffuse scleroderma | no_association | ISO | RGD:619568 | 9068941 | DNA:SNPs:enhancer, intron:multiple | RGD | PMID:22402147|REF_RGD_ID:8661768 | CAV1 | Dog | exfoliation syndrome | no_association | ISO | RGD:619568 | 9068941 | DNA:SNP:promoter:rs4236601 (human) | RGD | PMID:20835238|REF_RGD_ID:8661783 | CAV1 | Dog | Experimental Autoimmune Myocarditis | | ISO | RGD:2280 | 9068941 | | RGD | PMID:17060028|REF_RGD_ID:1625364 | CAV1 | Dog | Experimental Autoimmune Neuritis | | ISO | RGD:2280 | 9068941 | protein:increased phosphorylation:sciatic nerve | RGD | PMID:17234162|REF_RGD_ID:2289125 | CAV1 | Dog | Experimental Diabetes Mellitus | | ISO | RGD:2280 | 9068941 | | RGD | PMID:25086377|REF_RGD_ID:10045572 | CAV1 | Dog | Experimental Mammary Neoplasms | onset | ISO | RGD:1553438 | 9068941 | | RGD | PMID:15355971|REF_RGD_ID:2289106 | CAV1 | Dog | Experimental Mammary Neoplasms | | ISO | RGD:1553438 | 9068941 | protein:decreased expression:mammary gland | RGD | PMID:9685399|REF_RGD_ID:2289100 | CAV1 | Dog | Experimental Mammary Neoplasms | treatment | ISO | RGD:619568 | 9068941 | | RGD | PMID:15334058|REF_RGD_ID:8661780 | CAV1 | Dog | Hemorrhage | | ISO | RGD:2280 | 9068941 | protein:decreased expression:myocardium | RGD | PMID:22954805|REF_RGD_ID:8661809 | CAV1 | Dog | high grade glioma | | ISO | RGD:2280 | 9068941 | | RGD | PMID:22528460|REF_RGD_ID:6784517 | CAV1 | Dog | Hyperplasia | | ISO | RGD:1553438 | 9068941 | | RGD | PMID:12368209|REF_RGD_ID:8661765 | CAV1 | Dog | hypertension | | ISO | RGD:2280 | 9068941 | protein:increased expression:artery smooth muscle, blood vessel endothelial cell | RGD | PMID:17986358|REF_RGD_ID:2289116 | CAV1 | Dog | hypothyroidism | | ISO | RGD:2280 | 9068941 | protein:increased expression:cerebellum | RGD | PMID:21611807|REF_RGD_ID:6784532 | CAV1 | Dog | invasive ductal carcinoma | no_association | ISO | RGD:619568 | 9068941 | DNA:missense mutation: :p.P132L (human) | RGD | PMID:21909981|REF_RGD_ID:8661779 | CAV1 | Dog | leiomyoma | | ISO | RGD:619568 | 9068941 | protein:increased expression:uterus | RGD | PMID:17952758|REF_RGD_ID:2296031 | CAV1 | Dog | limited scleroderma | susceptibility | ISO | RGD:619568 | 9068941 | DNA:SNPs:enhancer, intron:multiple | RGD | PMID:22402147|REF_RGD_ID:8661768 | CAV1 | Dog | limited scleroderma | no_association | ISO | RGD:619568 | 9068941 | DNA:SNPs:3' utr, intron: (rs9920, rs729949, rs3815412) (human) | RGD | PMID:22402147|REF_RGD_ID:8661768 | CAV1 | Dog | low tension glaucoma | no_association | ISO | RGD:619568 | 9068941 | DNA:SNP:promoter:rs4236601 (human) | RGD | PMID:23743525|REF_RGD_ID:8661774 | CAV1 | Dog | Lymphatic Metastasis | disease_progression | ISO | RGD:619568 | 9068941 | associated with Melanoma | RGD | PMID:22134245|REF_RGD_ID:8661767 | CAV1 | Dog | melanoma | disease_progression | ISO | RGD:619568 | 9068941 | | RGD | PMID:22134245|REF_RGD_ID:8661767 | CAV1 | Dog | multiple sclerosis | | ISO | RGD:619568 | 9068941 | DNA:repeats, haplotypes:multiple | RGD | PMID:19828204|REF_RGD_ID:8661778 | CAV1 | Dog | Neoplasm Metastasis | | ISO | RGD:1553438 | 9068941 | associated with Mammary Neoplasms, Experimental | RGD | PMID:15355971|REF_RGD_ID:2289106 | CAV1 | Dog | Neoplasm Metastasis | treatment | ISO | RGD:619568 | 9068941 | associated with Mammary Neoplasms, Experimental | RGD | PMID:15334058|REF_RGD_ID:8661780 | CAV1 | Dog | Nephrogenic Fibrosing Dermopathy | no_association | ISO | RGD:619568 | 9068941 | DNA:SNP:intron: (rs4730751) (human) | RGD | PMID:23051628|REF_RGD_ID:8661777 | CAV1 | Dog | obesity | | ISO | RGD:2280 | 9068941 | | RGD | PMID:22492718|REF_RGD_ID:6784520 | CAV1 | Dog | osteoarthritis | | ISO | RGD:2280 | 9068941 | | RGD | PMID:16508959|REF_RGD_ID:10043354 | CAV1 | Dog | ovarian carcinoma | | ISO | RGD:619568 | 9068941 | | RGD | PMID:11032026|REF_RGD_ID:2289113 | CAV1 | Dog | primary open angle glaucoma | | ISO | RGD:619568 | 9068941 | DNA:SNP:promoter:rs4236601 (human) | RGD | PMID:20835238|REF_RGD_ID:8661783 | CAV1 | Dog | primary open angle glaucoma | no_association | ISO | RGD:619568 | 9068941 | DNA:SNP:promoter:rs4236601 (human) | RGD | PMID:22876122|REF_RGD_ID:8661776 | CAV1 | Dog | primary open angle glaucoma | | ISO | RGD:619568 | 9068941 | DNA:SNPs: :multiple | RGD | PMID:24572674|REF_RGD_ID:8661770 | CAV1 | Dog | prostate cancer | | ISO | RGD:619568 | 9068941 | DNA:hypermethylation:promoter | RGD | PMID:11170154|REF_RGD_ID:2289112 | CAV1 | Dog | prostate cancer | disease_progression | ISO | RGD:619568 | 9068941 | | RGD | PMID:15948133|REF_RGD_ID:2289104 | CAV1 | Dog | prostate cancer | | ISO | RGD:619568 | 9068941 | protein:increased expression:serum | RGD | PMID:14506154|REF_RGD_ID:2289109 | CAV1 | Dog | Prostatic Neoplasms | disease_progression | ISO | RGD:1553438 | 9068941 | | RGD | PMID:17786030|REF_RGD_ID:2289102 | CAV1 | Dog | Prostatic Neoplasms | | ISO | RGD:1553438 | 9068941 | | RGD | PMID:11751529|REF_RGD_ID:2289111 | CAV1 | Dog | psoriasis | | ISO | RGD:619568 | 9068941 | protein:decreased expression:skin | RGD | PMID:12366416|REF_RGD_ID:8661784 | CAV1 | Dog | pulmonary fibrosis | | ISO | RGD:1553438 | 9068941 | | RGD | PMID:18759267|REF_RGD_ID:8661773 | CAV1 | Dog | pulmonary hypertension | | ISO | RGD:619568 | 9068941 | idiopathic pulmonary arterial hypertension (IPAH) | RGD | PMID:17470567|REF_RGD_ID:1625360 | CAV1 | Dog | pulmonary hypertension | | ISO | RGD:2280 | 9068941 | | RGD | PMID:15353500|REF_RGD_ID:1581153 | CAV1 | Dog | pulmonary hypertension | treatment | ISO | RGD:2280 | 9068941 | | RGD | PMID:23538027|REF_RGD_ID:8662276 | CAV1 | Dog | renal cell carcinoma | disease_progression | ISO | RGD:619568 | 9068941 | protein:increased expression:kidney | RGD | PMID:15247769|REF_RGD_ID:2289107 | CAV1 | Dog | Reperfusion Injury | | ISO | RGD:2280 | 9068941 | protein:increased expression:brain | RGD | PMID:17293479|REF_RGD_ID:2289123 | CAV1 | Dog | Sarcopenia | severity | ISO | RGD:619568 | 9068941 | DNA:SNP:intron:14713G>A (rs3807987) (human) | RGD | PMID:24815842|REF_RGD_ID:10045568 | CAV1 | Dog | sciatic neuropathy | | ISO | RGD:2280 | 9068941 | protein:decreased expression:spinal cord, blood vessel | RGD | PMID:21795534|REF_RGD_ID:6784526 | CAV1 | Dog | Spinal Cord Injuries | | ISO | RGD:2280 | 9068941 | protein:increased phosphorylation:spinal cord | RGD | PMID:17275798|REF_RGD_ID:2289124 | CAV1 | Dog | squamous cell carcinoma | | ISO | RGD:1553438 | 9068941 | | RGD | PMID:23267770|REF_RGD_ID:8661786 | CAV1 | Dog | systemic scleroderma | susceptibility | ISO | RGD:619568 | 9068941 | DNA:SNPs:enhancer, intron: (rs7795356, rs926198, rs959173) (human) | RGD | PMID:22402147|REF_RGD_ID:8661768 | CAV1 | Dog | systemic scleroderma | | ISO | RGD:619568 | 9068941 | protein:decreased expression:lung, skin | RGD | PMID:18759267|REF_RGD_ID:8661773 | CAV1 | Dog | transient cerebral ischemia | treatment | ISO | RGD:2280 | 9068941 | | RGD | PMID:22007835|REF_RGD_ID:8661794 | CAV1 | Dog | transient cerebral ischemia | | ISO | RGD:1553438 | 9068941 | | RGD | PMID:22007835|REF_RGD_ID:8661794 | CAV1 | Dog | transitional cell carcinoma | disease_progression | ISO | RGD:619568 | 9068941 | protein:increased expression:urinary bladder | RGD | PMID:16328005|REF_RGD_ID:2289103 | CAV1 | Dog | urinary bladder cancer | severity | ISO | RGD:619568 | 9068941 | protein:increased expression:urinary bladder | RGD | PMID:12866378|REF_RGD_ID:2289110 |
Imported Annotations - PID (archival)
CAV1 (Canis lupus familiaris - dog) |
Dog Assembly | Chr | Position (strand) | Source | Genome Browsers |
---|
JBrowse | NCBI | UCSC | Ensembl |
---|
CanFam3.1 | 14 | 55,458,934 - 55,494,563 (+) | NCBI | CanFam3.1 | CanFam3.1 | canFam3 | CanFam3.1 | CanFam3.1 Ensembl | 14 | 55,461,048 - 55,492,935 (+) | Ensembl | CanFam3.1 | | canFam3 | CanFam3.1 | Dog10K_Boxer_Tasha | 14 | 54,856,462 - 54,888,069 (+) | NCBI | | Dog10K_Boxer_Tasha | | | ROS_Cfam_1.0 | 14 | 55,500,946 - 55,536,541 (+) | NCBI | | ROS_Cfam_1.0 | | | ROS_Cfam_1.0 Ensembl | 14 | 55,503,040 - 55,536,538 (+) | Ensembl | | ROS_Cfam_1.0 Ensembl | | | UMICH_Zoey_3.1 | 14 | 55,530,973 - 55,562,566 (+) | NCBI | | UMICH_Zoey_3.1 | | | UNSW_CanFamBas_1.0 | 14 | 55,219,411 - 55,251,015 (+) | NCBI | | UNSW_CanFamBas_1.0 | | | UU_Cfam_GSD_1.0 | 14 | 55,590,528 - 55,622,125 (+) | NCBI | | UU_Cfam_GSD_1.0 | | |
|
CAV1 (Homo sapiens - human) |
Human Assembly | Chr | Position (strand) | Source | Genome Browsers |
---|
JBrowse | NCBI | UCSC | Ensembl |
---|
GRCh38 | 7 | 116,525,009 - 116,561,185 (+) | NCBI | GRCh38 | GRCh38 | hg38 | GRCh38 | GRCh38.p14 Ensembl | 7 | 116,524,994 - 116,561,179 (+) | Ensembl | GRCh38 | | hg38 | GRCh38 | GRCh37 | 7 | 116,165,063 - 116,201,239 (+) | NCBI | GRCh37 | GRCh37 | hg19 | GRCh37 | Build 36 | 7 | 115,952,075 - 115,988,466 (+) | NCBI | NCBI36 | Build 36 | hg18 | NCBI36 | Build 34 | 7 | 115,758,789 - 115,795,181 | NCBI | | | | | Celera | 7 | 110,972,249 - 111,008,654 (+) | NCBI | | Celera | | | Cytogenetic Map | 7 | q31.2 | NCBI | | | | | HuRef | 7 | 110,530,835 - 110,566,784 (+) | NCBI | | HuRef | | | CHM1_1 | 7 | 116,098,482 - 116,134,827 (+) | NCBI | | CHM1_1 | | | T2T-CHM13v2.0 | 7 | 117,840,041 - 117,876,175 (+) | NCBI | | T2T-CHM13v2.0 | | | CRA_TCAGchr7v2 | 7 | 115,560,275 - 115,596,679 (+) | NCBI | | | | |
|
Cav1 (Mus musculus - house mouse) |
Mouse Assembly | Chr | Position (strand) | Source | Genome Browsers |
---|
JBrowse | NCBI | UCSC | Ensembl |
---|
GRCm39 | 6 | 17,306,387 - 17,341,323 (+) | NCBI | GRCm39 | GRCm39 | mm39 | | GRCm39 Ensembl | 6 | 17,306,334 - 17,341,451 (+) | Ensembl | | GRCm39 Ensembl | | | GRCm38 | 6 | 17,306,335 - 17,341,328 (+) | NCBI | GRCm38 | GRCm38 | mm10 | GRCm38 | GRCm38.p6 Ensembl | 6 | 17,306,335 - 17,341,452 (+) | Ensembl | GRCm38 | | mm10 | GRCm38 | MGSCv37 | 6 | 17,256,370 - 17,291,324 (+) | NCBI | GRCm37 | MGSCv37 | mm9 | NCBIm37 | MGSCv36 | 6 | 17,256,370 - 17,291,324 (+) | NCBI | | MGSCv36 | mm8 | | Celera | 6 | 17,378,835 - 17,414,670 (+) | NCBI | | Celera | | | Cytogenetic Map | 6 | A2 | NCBI | | | | | cM Map | 6 | 7.73 | NCBI | | | | |
|
Cav1 (Rattus norvegicus - Norway rat) |
Rat Assembly | Chr | Position (strand) | Source | Genome Browsers |
---|
JBrowse | NCBI | UCSC | Ensembl |
---|
GRCr8 | 4 | 46,606,538 - 46,639,616 (+) | NCBI | | GRCr8 | | | mRatBN7.2 | 4 | 45,640,624 - 45,673,708 (+) | NCBI | mRatBN7.2 | mRatBN7.2 | | | mRatBN7.2 Ensembl | 4 | 45,634,918 - 45,673,705 (+) | Ensembl | | mRatBN7.2 Ensembl | | | UTH_Rnor_SHR_Utx | 4 | 50,634,317 - 50,667,383 (+) | NCBI | Rnor_SHR | UTH_Rnor_SHR_Utx | | | UTH_Rnor_SHRSP_BbbUtx_1.0 | 4 | 46,555,310 - 46,588,376 (+) | NCBI | Rnor_SHRSP | UTH_Rnor_SHRSP_BbbUtx_1.0 | | | UTH_Rnor_WKY_Bbb_1.0 | 4 | 44,969,814 - 45,002,892 (+) | NCBI | Rnor_WKY | UTH_Rnor_WKY_Bbb_1.0 | | | Rnor_6.0 | 4 | 44,597,123 - 44,630,206 (+) | NCBI | Rnor6.0 | Rnor_6.0 | rn6 | Rnor6.0 | Rnor_6.0 Ensembl | 4 | 44,597,123 - 44,630,200 (+) | Ensembl | Rnor6.0 | | rn6 | Rnor6.0 | Rnor_5.0 | 4 | 45,203,494 - 45,236,461 (+) | NCBI | Rnor5.0 | Rnor_5.0 | rn5 | Rnor5.0 | RGSC_v3.4 | 4 | 42,956,102 - 42,989,057 (+) | NCBI | RGSC3.4 | RGSC_v3.4 | rn4 | RGSC3.4 | RGSC_v3.1 | 4 | 43,098,177 - 43,130,873 (+) | NCBI | | | | | Celera | 4 | 40,918,628 - 40,949,677 (+) | NCBI | | Celera | | | Cytogenetic Map | 4 | q22 | NCBI | | | | |
|
Cav1 (Chinchilla lanigera - long-tailed chinchilla) |
Chinchilla Assembly | Chr | Position (strand) | Source | Genome Browsers |
---|
JBrowse | NCBI | UCSC | Ensembl |
---|
ChiLan1.0 Ensembl | NW_004955432 | 22,258,250 - 22,292,403 (+) | Ensembl | ChiLan1.0 | | | | ChiLan1.0 | NW_004955432 | 22,258,262 - 22,292,403 (+) | NCBI | ChiLan1.0 | ChiLan1.0 | | |
|
CAV1 (Pan paniscus - bonobo/pygmy chimpanzee) |
Bonobo Assembly | Chr | Position (strand) | Source | Genome Browsers |
---|
JBrowse | NCBI | UCSC | Ensembl |
---|
NHGRI_mPanPan1-v2 | 6 | 153,356,633 - 153,393,045 (+) | NCBI | | NHGRI_mPanPan1-v2 | | | NHGRI_mPanPan1 | 7 | 5,367,106 - 5,403,301 (+) | NCBI | | NHGRI_mPanPan1 | | | Mhudiblu_PPA_v0 | 7 | 108,497,125 - 108,533,090 (+) | NCBI | Mhudiblu_PPA_v0 | Mhudiblu_PPA_v0 | panPan3 | | PanPan1.1 | 7 | 121,193,678 - 121,229,655 (+) | NCBI | panpan1.1 | PanPan1.1 | panPan2 | | PanPan1.1 Ensembl | 7 | 121,193,424 - 121,229,655 (+) | Ensembl | panpan1.1 | | panPan2 | |
|
Cav1 (Ictidomys tridecemlineatus - thirteen-lined ground squirrel) |
Squirrel Assembly | Chr | Position (strand) | Source | Genome Browsers |
---|
JBrowse | NCBI | UCSC | Ensembl |
---|
HiC_Itri_2 | NW_024405118 | 44,152,891 - 44,185,619 (+) | NCBI | | HiC_Itri_2 | | | SpeTri2.0 Ensembl | NW_004936589 | 2,504,224 - 2,537,170 (-) | Ensembl | SpeTri2.0 | SpeTri2.0 Ensembl | | | SpeTri2.0 | NW_004936589 | 2,504,235 - 2,536,778 (-) | NCBI | SpeTri2.0 | SpeTri2.0 | | SpeTri2.0 |
|
CAV1 (Sus scrofa - pig) |
Pig Assembly | Chr | Position (strand) | Source | Genome Browsers |
---|
JBrowse | NCBI | UCSC | Ensembl |
---|
Sscrofa11.1 Ensembl | 18 | 29,649,992 - 29,682,465 (-) | Ensembl | Sscrofa11.1 | | susScr11 | Sscrofa11.1 | Sscrofa11.1 | 18 | 29,648,120 - 29,682,451 (-) | NCBI | Sscrofa11.1 | Sscrofa11.1 | susScr11 | Sscrofa11.1 | Sscrofa10.2 | 18 | 31,745,664 - 31,778,987 (-) | NCBI | Sscrofa10.2 | Sscrofa10.2 | susScr3 | |
|
CAV1 (Chlorocebus sabaeus - green monkey) |
Green Monkey Assembly | Chr | Position (strand) | Source | Genome Browsers |
---|
JBrowse | NCBI | UCSC | Ensembl |
---|
ChlSab1.1 | 21 | 85,222,724 - 85,258,562 (+) | NCBI | ChlSab1.1 | ChlSab1.1 | chlSab2 | | ChlSab1.1 Ensembl | 21 | 85,222,879 - 85,258,627 (+) | Ensembl | ChlSab1.1 | ChlSab1.1 Ensembl | chlSab2 | | Vero_WHO_p1.0 | NW_023666042 | 18,474,866 - 18,510,943 (-) | NCBI | Vero_WHO_p1.0 | Vero_WHO_p1.0 | | |
|
Cav1 (Heterocephalus glaber - naked mole-rat) |
|
.
|
alimentary part of gastrointestinal system
| | | | | | | | | | | | | |
6
|
5
|
5
|
23
|
22
|
16
|
6
|
6
|
6
|
6
|
33
|
22
|
12
|
14
|
10
|
Ensembl Acc Id: |
ENSCAFT00000005462 ⟹ ENSCAFP00000005060 |
Type: |
CODING |
Position: |
Dog Assembly | Chr | Position (strand) | Source |
---|
CanFam3.1 Ensembl | 14 | 55,461,048 - 55,492,935 (+) | Ensembl |
|
Ensembl Acc Id: |
ENSCAFT00000062220 ⟹ ENSCAFP00000060860 |
Type: |
CODING |
Position: |
Dog Assembly | Chr | Position (strand) | Source |
---|
CanFam3.1 Ensembl | 14 | 55,462,057 - 55,492,935 (+) | Ensembl |
|
Ensembl Acc Id: |
ENSCAFT00845012174 ⟹ ENSCAFP00845009515 |
Type: |
CODING |
Position: |
Dog Assembly | Chr | Position (strand) | Source |
---|
ROS_Cfam_1.0 Ensembl | 14 | 55,503,040 - 55,536,538 (+) | Ensembl |
|
Ensembl Acc Id: |
ENSCAFT00845012201 ⟹ ENSCAFP00845009538 |
Type: |
CODING |
Position: |
Dog Assembly | Chr | Position (strand) | Source |
---|
ROS_Cfam_1.0 Ensembl | 14 | 55,504,072 - 55,536,538 (+) | Ensembl |
|
RefSeq Acc Id: |
NM_001003296 ⟹ NP_001003296 |
RefSeq Status: |
PROVISIONAL |
Type: |
CODING |
Position: |
Dog Assembly | Chr | Position (strand) | Source |
---|
CanFam3.1 | 14 | 55,461,084 - 55,492,691 (+) | NCBI | Dog10K_Boxer_Tasha | 14 | 54,856,462 - 54,888,069 (+) | NCBI | ROS_Cfam_1.0 | 14 | 55,503,099 - 55,534,670 (+) | NCBI | UMICH_Zoey_3.1 | 14 | 55,530,973 - 55,562,566 (+) | NCBI | UNSW_CanFamBas_1.0 | 14 | 55,219,411 - 55,251,015 (+) | NCBI | UU_Cfam_GSD_1.0 | 14 | 55,590,528 - 55,622,125 (+) | NCBI |
|
Sequence: |
ATGTCTGGGGGCAAATACGTAGACTCCGAGGGGCACCTCTACACCGTTCCCATCCGGGAGCAGGGCAACATCTACAAGCCCAACAACAAGGCCATGGCGGAGGAGATGAGCGAGAAGCAGGTGTACGA CGCGCACACCAAGGAAATCGACCTGGTCAACCGCGACCCCAAGCATCTCAACGACGACGTGGTCAAGATTGATTTTGAAGATGTGATTGCAGAACCAGAAGGAACACACAGTTTTGATGGCATCTGGA AGGCCAGCTTCACCACCTTCACTGTGACAAAATACTGGTTTTACCGCTTGCTGTCTGCCCTCTTTGGCATCCCAATGGCACTCATATGGGGCATTTACTTTGCCATTCTTTCTTTCCTGCACATCTGG GCAGTTGTGCCGTGCATTAAGAGTTTCCTGATTGAGATTCAGTGCATCAGCCGTGTCTATTCCATCTACGTCCACACCTTCTGTGACCCGTTCTTTGAGGCTGTTGGCAAAATATTCAGCAATATCCG CATCAACATGCAGAAAGAAACATAA
hide sequence
|
RefSeq Acc Id: |
XM_038685936 ⟹ XP_038541864 |
Type: |
CODING |
Position: |
Dog Assembly | Chr | Position (strand) | Source |
---|
ROS_Cfam_1.0 | 14 | 55,503,677 - 55,536,541 (+) | NCBI |
|
RefSeq Acc Id: |
XM_038685937 ⟹ XP_038541865 |
Type: |
CODING |
Position: |
Dog Assembly | Chr | Position (strand) | Source |
---|
ROS_Cfam_1.0 | 14 | 55,500,946 - 55,536,541 (+) | NCBI |
|
RefSeq Acc Id: |
NP_001003296 ⟸ NM_001003296 |
- UniProtKB: |
A0M8U8 (UniProtKB/Swiss-Prot), P33724 (UniProtKB/Swiss-Prot), A0A8C0K0N3 (UniProtKB/TrEMBL), A0A8C0MMY6 (UniProtKB/TrEMBL), A0A8I3N6T8 (UniProtKB/TrEMBL) |
- Sequence: |
MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMAEEMSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIW AVVPCIKSFLIEIQCISRVYSIYVHTFCDPFFEAVGKIFSNIRINMQKET
hide sequence
|
|
Ensembl Acc Id: |
ENSCAFP00000005060 ⟸ ENSCAFT00000005462 |
|
Ensembl Acc Id: |
ENSCAFP00000060860 ⟸ ENSCAFT00000062220 |
|
RefSeq Acc Id: |
XP_038541865 ⟸ XM_038685937 |
- Peptide Label: |
isoform X1 |
- UniProtKB: |
A0A8C0MMY6 (UniProtKB/TrEMBL), A0A8I3N6T8 (UniProtKB/TrEMBL) |
|
RefSeq Acc Id: |
XP_038541864 ⟸ XM_038685936 |
- Peptide Label: |
isoform X1 |
- UniProtKB: |
A0A8C0MMY6 (UniProtKB/TrEMBL), A0A8I3N6T8 (UniProtKB/TrEMBL) |
|
Ensembl Acc Id: |
ENSCAFP00845009515 ⟸ ENSCAFT00845012174 |
|
Ensembl Acc Id: |
ENSCAFP00845009538 ⟸ ENSCAFT00845012201 |
|
RGD ID: | 13685822 |
Promoter ID: | EPDNEW_C3890 |
Type: | initiation region |
Name: | CAV1_1 |
Description: | caveolin 1 |
SO ACC ID: | SO:0000170 |
Source: | EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/) |
Experiment Methods: | Single-end sequencing. |
Position: | Dog Assembly | Chr | Position (strand) | Source |
---|
CanFam3.1 | 14 | 55,461,034 - 55,461,094 | EPDNEW |
|
|
|