Symbol:
THBD
Name:
thrombomodulin
RGD ID:
12004478
Description:
ENCODES a protein that exhibits calcium ion binding (inferred); signaling receptor activity (inferred); transmembrane signaling receptor activity (inferred); INVOLVED IN response to cAMP (ortholog); response to lipopolysaccharide (ortholog); response to X-ray (ortholog); PARTICIPATES IN protein C anticoagulant pathway; ASSOCIATED WITH acute kidney failure (ortholog); Acute Liver Failure (ortholog); Acute Lung Injury (ortholog); FOUND IN apicolateral plasma membrane (ortholog); extracellular space (ortholog); vacuolar membrane (ortholog)
Type:
protein-coding
RefSeq Status:
MODEL
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
THBD (thrombomodulin) NCBI
Ortholog
Mus musculus (house mouse):
Thbd (thrombomodulin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Rattus norvegicus (Norway rat):
Thbd (thrombomodulin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Thbd (thrombomodulin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
THBD (thrombomodulin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Thbd (thrombomodulin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
THBD (thrombomodulin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
THBD (thrombomodulin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Thbd (thrombomodulin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Latest Assembly:
Mhudiblu_PPA_v0 - Bonobo Mhudiblu_PPA_v0 Assembly
Position:
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 21 23,923,797 - 23,935,661 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 20 23,920,631 - 23,932,503 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 20 22,992,341 - 22,996,415 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 20 23,343,758 - 23,347,966 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 20 23,345,917 - 23,347,812 (-) Ensembl panpan1.1 panPan2
JBrowse:
View Region in Genome Browser (JBrowse)
Model
THBD Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 21 23,923,797 - 23,935,661 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 20 23,920,631 - 23,932,503 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 20 22,992,341 - 22,996,415 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 20 23,343,758 - 23,347,966 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 20 23,345,917 - 23,347,812 (-) Ensembl panpan1.1 panPan2
THBD Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 20 23,045,633 - 23,049,672 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 20 23,045,633 - 23,049,672 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 20 23,026,270 - 23,030,309 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 20 22,974,270 - 22,978,301 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 20 22,974,270 - 22,978,301 NCBI Celera 20 23,099,650 - 23,103,681 (-) NCBI Celera Cytogenetic Map 20 p11.21 NCBI HuRef 20 22,987,792 - 22,991,823 (-) NCBI HuRef CHM1_1 20 23,026,970 - 23,031,001 (-) NCBI CHM1_1 T2T-CHM13v2.0 20 23,105,114 - 23,109,153 (-) NCBI T2T-CHM13v2.0
Thbd Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 148,246,391 - 148,250,108 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 148,246,386 - 148,250,108 (-) Ensembl GRCm39 Ensembl GRCm38 2 148,404,471 - 148,408,188 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 148,404,466 - 148,408,188 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 148,230,207 - 148,233,924 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 148,095,912 - 148,099,544 (-) NCBI MGSCv36 mm8 Celera 2 149,679,568 - 149,683,285 (-) NCBI Celera Cytogenetic Map 2 G3 NCBI cM Map 2 73.45 NCBI
Thbd Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 156,316,526 - 156,320,178 (-) NCBI GRCr8 mRatBN7.2 3 135,863,366 - 135,867,018 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 135,862,835 - 135,867,193 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 139,806,359 - 139,810,012 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 148,390,492 - 148,394,145 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 146,088,993 - 146,092,645 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 142,748,673 - 142,752,325 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 142,748,674 - 142,752,325 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 149,159,895 - 149,163,547 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 137,158,955 - 137,162,607 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 137,064,528 - 137,068,180 (-) NCBI Celera 3 134,707,185 - 134,710,838 (-) NCBI Celera Cytogenetic Map 3 q41 NCBI
Thbd Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955415 30,222,830 - 30,226,406 (-) NCBI ChiLan1.0 ChiLan1.0
THBD Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 24 599,773 - 601,649 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 24 599,773 - 601,649 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 24 624,590 - 626,466 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 24 996,254 - 998,130 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 24 996,254 - 998,130 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 24 595,131 - 597,007 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 24 697,184 - 699,060 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 24 978,557 - 980,433 (+) NCBI UU_Cfam_GSD_1.0
Thbd
THBD Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 17 30,217,303 - 30,224,099 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 17 30,219,870 - 30,223,499 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 17 34,274,132 - 34,277,761 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
THBD Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 2 52,041,950 - 52,045,946 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 2 52,043,746 - 52,045,626 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666078 6,853,490 - 6,857,509 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Thbd
.
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSPPAT00000019911 ⟹ ENSPPAP00000004311
Type:
CODING
Position:
Bonobo Assembly Chr Position (strand) Source PanPan1.1 Ensembl 20 23,345,917 - 23,347,812 (-) Ensembl
RefSeq Acc Id:
XM_003829379 ⟹ XP_003829427
Type:
CODING
Position:
Bonobo Assembly Chr Position (strand) Source NHGRI_mPanPan1-v2 21 23,923,797 - 23,935,661 (-) NCBI NHGRI_mPanPan1 20 23,920,631 - 23,932,503 (-) NCBI Mhudiblu_PPA_v0 20 22,992,341 - 22,996,415 (-) NCBI PanPan1.1 20 23,343,758 - 23,347,966 (-) NCBI
Sequence:
ATCCCATGCGCGAGGGCGGGCGCAAGGGCGGCCAGAGAACCCAGCAATCCGAGTATGCGGCATCAGCCCTTCCCACCAGGCACTTCCTTCCTTTTCCCGAACGTCCAGGGAGGGAGGGCCGGGCACTT
hide sequence
RefSeq Acc Id:
XP_003829427 ⟸ XM_003829379
- UniProtKB:
A0A2R8ZHT7 (UniProtKB/TrEMBL)
- Sequence:
MSEAASQGLRAAARSVWAGTDRRGCRHRRPVPLCSGTAPSQCPRFPRRLHAARLGNMLGVLVLGALALAGLGFPAPAEPQPGGSQCVEHDCFALYPGPATFLNASQICDGLRGHLMTVRSSVAADVIS
hide sequence
Ensembl Acc Id:
ENSPPAP00000004311 ⟸ ENSPPAT00000019911
