Advanced Search (OLGA)

Gene: Thbd (thrombomodulin) Rattus norvegicus

Analyze

Symbol:

Thbd

Name:

thrombomodulin

RGD ID:

621299

Description:

Predicted to enable signaling receptor activity. Involved in response to X-ray; response to cAMP; and response to lipopolysaccharide. Located in apicolateral plasma membrane; extracellular space; and vacuolar membrane. Used to study acute kidney failure. Biomarker of adult respiratory distress syndrome; hypertension; ischemia; and type 2 diabetes mellitus. Human ortholog(s) of this gene implicated in several diseases, including acute kidney failure; atypical hemolytic-uremic syndrome; cerebrovascular disease (multiple); rheumatoid arthritis; and thrombophilia (multiple). Orthologous to human THBD (thrombomodulin); PARTICIPATES IN protein C anticoagulant pathway; coagulation cascade pathway; complement system pathway; INTERACTS WITH (S)-colchicine; 1-naphthyl isothiocyanate; 17alpha-ethynylestradiol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

thrombomdulin

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	THBD (thrombomodulin)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Thbd (thrombomodulin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Thbd (thrombomodulin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	THBD (thrombomodulin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	THBD (thrombomodulin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Thbd (thrombomodulin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	THBD (thrombomodulin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	THBD (thrombomodulin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Thbd (thrombomodulin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	MATR3 (matrin 3)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	THBD (thrombomodulin)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Thbd (thrombomodulin)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	thbd (thrombomodulin)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	knk	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Caenorhabditis elegans (roundworm):	W01C8.5	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Drosophila melanogaster (fruit fly):	CG34355	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	thbd	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)

Allele / Splice:

Thbd^m1Mcwi

Genetic Models:

SS-Thbd^m1Mcwi

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	156,316,526 - 156,320,178 (-)	NCBI		GRCr8
mRatBN7.2	3	135,863,366 - 135,867,018 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	135,862,835 - 135,867,193 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	139,806,359 - 139,810,012 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	148,390,492 - 148,394,145 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	146,088,993 - 146,092,645 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	142,748,673 - 142,752,325 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	142,748,674 - 142,752,325 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	149,159,895 - 149,163,547 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	137,158,955 - 137,162,607 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	137,064,528 - 137,068,180 (-)	NCBI
Celera	3	134,707,185 - 134,710,838 (-)	NCBI		Celera
Cytogenetic Map	3	q41	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

acute kidney failure (IDA,ISO)

Acute Liver Failure (IEP)

Acute Lung Injury (IEP,ISO)

acute promyelocytic leukemia (ISO)

adult respiratory distress syndrome (IEP,ISO)

Alzheimer's disease (ISO)

ankylosing spondylitis (ISO)

asthma (ISO)

atypical hemolytic-uremic syndrome (ISO)

B-Cell Chronic Lymphocytic Leukemia (ISO)

Brain Injuries (ISO)

brain small vessel disease (ISO)

carotid artery thrombosis (ISO)

cerebral infarction (ISO)

coronary artery disease (ISO)

Coronary Disease (ISO)

Crohn's disease (ISO)

dermatomyositis (ISO)

disseminated intravascular coagulation (ISO)

end stage renal disease (ISO)

Endotoxemia (IEP,ISO)

Endotoxin-Induced Uveitis (ISO)

Experimental Arthritis (ISO)

Experimental Liver Cirrhosis (IEP,ISO)

familial combined hyperlipidemia (ISO)

familial hyperinsulinemic hypoglycemia 1 (ISO)

familial Mediterranean fever (ISO)

genetic disease (ISO)

granulomatosis with polyangiitis (ISO)

Habitual Abortions (ISO)

Heat Stroke (ISO)

hemolytic-uremic syndrome (ISO)

hemorrhagic disease (ISO)

Hyperalgesia (ISO)

hypertension (IEP,ISO)

hypothyroidism (ISO)

idiopathic pulmonary fibrosis (ISO)

impotence (ISO)

Inflammation (ISO)

Insulin Resistance (ISO)

ischemia (IEP)

juvenile rheumatoid arthritis (ISO)

kidney disease (ISO)

liver disease (ISO)

lung non-small cell carcinoma (ISO)

Metabolic Syndrome (ISO)

Multiple Organ Failure (ISO)

myocardial infarction (ISO)

obesity (ISO)

Painful Neuropathy (ISO)

pulmonary embolism (ISO)

pulmonary hypertension (ISO)

Reperfusion Injury (ISO)

rheumatoid arthritis (ISO)

Sepsis (IEP)

severe acute respiratory syndrome (ISO)

Spinal Cord Injuries (ISO)

Stomach Neoplasms (ISO)

Stroke (ISO)

Systemic Inflammatory Response Syndrome (ISO)

systemic lupus erythematosus (ISO)

thrombocytopenia (ISO)

Thromboembolism (ISO)

thrombophilia (ISO,ISS)

thrombophilia due to thrombomodulin defect (ISO)

thrombosis (ISO)

thrombotic thrombocytopenic purpura (ISO)

type 1 diabetes mellitus (ISO)

type 2 diabetes mellitus (IEP,ISO)

ulcerative colitis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(S)-colchicine (EXP)

1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (ISO)

1,2-dimethylhydrazine (ISO)

1-naphthyl isothiocyanate (EXP)

1-nitropyrene (ISO)

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (EXP,ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-trinitrobenzenesulfonic acid (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2-hydroxypropanoic acid (ISO)

3,3',4,4',5-pentachlorobiphenyl (ISO)

3-methylcholanthrene (ISO)

4,4'-diaminodiphenylmethane (EXP)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

5-aza-2'-deoxycytidine (ISO)

acetamide (EXP)

aconitine (EXP)

acrolein (EXP)

acrylamide (EXP)

aflatoxin B1 (ISO)

Aflatoxin B2 alpha (ISO)

aldehydo-D-glucose (ISO)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

ammonium chloride (EXP)

amphetamine (EXP)

amphibole asbestos (EXP)

antirheumatic drug (ISO)

aripiprazole (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

Azoxymethane (ISO)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

butan-1-ol (ISO)

cadmium atom (ISO)

cadmium dichloride (EXP,ISO)

calcitriol (ISO)

candesartan (EXP)

carbon nanotube (ISO)

carbonyl sulfide (EXP)

carmustine (ISO)

choline (ISO)

ciguatoxin CTX1B (ISO)

cisplatin (ISO)

cobalt atom (ISO)

cobalt dichloride (ISO)

copper(II) chloride (ISO)

crotonaldehyde (ISO)

cycloheximide (ISO)

cyclosporin A (ISO)

D-glucose (ISO)

DDE (ISO)

dexamethasone (ISO)

dextran sulfate (ISO)

diarsenic trioxide (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP)

dimethylarsinic acid (ISO)

dimethylarsinous acid (ISO)

dioxygen (ISO)

diquat (EXP)

diuron (EXP)

dorsomorphin (ISO)

doxorubicin (ISO)

elemental selenium (ISO)

endosulfan (EXP)

ethanol (EXP)

ethylparaben (ISO)

fenvalerate (EXP)

fluoranthene (ISO)

folic acid (ISO)

folpet (ISO)

formaldehyde (ISO)

furan (EXP)

gestodene (ISO)

glucose (ISO)

hydralazine (EXP)

indometacin (ISO)

isobutanol (ISO)

L-methionine (ISO)

lead diacetate (ISO)

lipopolysaccharide (ISO)

LY294002 (ISO)

methotrexate (ISO)

methyl methacrylate (ISO)

methylarsonic acid (ISO)

methylisothiazolinone (ISO)

mevalonic acid (ISO)

N-nitrosodimethylamine (EXP)

N-Nitrosopyrrolidine (ISO)

nickel atom (ISO)

nitric oxide (EXP)

oxaliplatin (EXP)

ozone (EXP,ISO)

paclitaxel (ISO)

paracetamol (ISO)

paraquat (EXP,ISO)

paricalcitol (ISO)

pentachlorophenol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP)

phenobarbital (ISO)

phenylmercury acetate (ISO)

phorbol 13-acetate 12-myristate (ISO)

phosphorus atom (ISO)

phosphorus(.) (ISO)

pirinixic acid (ISO)

potassium chromate (ISO)

pravastatin (EXP,ISO)

pregnenolone 16alpha-carbonitrile (ISO)

progesterone (EXP,ISO)

propanal (ISO)

rac-lactic acid (ISO)

resveratrol (EXP,ISO)

SB 431542 (ISO)

selenium atom (ISO)

serpentine asbestos (ISO)

silicon dioxide (ISO)

simvastatin (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

streptozocin (EXP)

tamibarotene (ISO)

tamoxifen (ISO)

temozolomide (ISO)

tert-butyl hydroperoxide (ISO)

tetrachloromethane (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

topotecan (EXP)

tremolite asbestos (ISO)

triclosan (ISO)

triphenyl phosphate (ISO)

troglitazone (ISO)

tungsten (ISO)

Tungsten carbide (ISO)

valproic acid (ISO)

venlafaxine hydrochloride (EXP)

vincaleukoblastine (EXP)

vinclozolin (EXP)

vincristine (ISO)

vitamin E (ISO)

zaragozic acid A (EXP,ISO)

zinc atom (EXP)

zinc sulfate (EXP)

zinc(0) (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

blood coagulation (IEA)

female pregnancy (ISO)

negative regulation of blood coagulation (ISO)

response to cAMP (IEP)

response to lipopolysaccharide (IEP)

response to X-ray (IEP)

Cellular Component

apicolateral plasma membrane (IDA)

cell surface (ISO)

external side of plasma membrane (ISO)

extracellular space (IDA)

plasma membrane (ISO)

serine-type endopeptidase complex (ISO)

vacuolar membrane (IDA)

Molecular Function

calcium ion binding (IEA)

protein binding (ISO)

signaling receptor activity (ISO)

transmembrane signaling receptor activity (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

coagulation cascade pathway (IEA)

complement system pathway (IEA)

protein C anticoagulant pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Increased thrombin-activatable fibrinolysis inhibitor and decreased tissue factor pathway inhibitor and thrombomodulin levels in children with hypothyroidism.	Alioglu B, etal., J Clin Res Pediatr Endocrinol. 2012 Sep;4(3):146-50. doi: 10.4274/Jcrpe.652.
2.	Relationship between plasma soluble thrombomodulin levels and insulin resistance syndrome in type 2 diabetes: a comparison with von Willebrand factor.	Aso Y, etal., Exp Clin Endocrinol Diabetes. 2001;109(4):210-6.
3.	Inflammation, TNFalpha and endothelial dysfunction link lenalidomide to venous thrombosis in chronic lymphocytic leukemia.	Aue G, etal., Am J Hematol. 2011 Oct;86(10):835-40. doi: 10.1002/ajh.22114. Epub 2011 Aug 2.
4.	Decrease in circulating endothelial cell adhesion molecule and thrombomodulin levels during oral iloprost treatment in rheumatoid arthritis patients: preliminary results.	Boehme MW, etal., Rheumatol Int. 2006 Feb;26(4):340-7. Epub 2005 Feb 8.
5.	Cholinesterase inhibitors exert a protective effect on endothelial damage in Alzheimer disease patients.	Borroni B, etal., J Neurol Sci. 2005 Mar 15;229-230:211-3. Epub 2004 Dec 8.
6.	Increased immunohistochemical expression of thrombomodulin at placental perivascular myofibroblast in severe preeclampsia (PE).	Bosco C, etal., Histol Histopathol. 2005 Oct;20(4):1045-55.
7.	Mechanisms of anticoagulant and cytoprotective actions of the protein C pathway.	Bouwens EA, etal., J Thromb Haemost. 2013 Jun;11 Suppl 1:242-53. doi: 10.1111/jth.12247.
8.	The association of idiopathic recurrent pregnancy loss with polymorphisms in hemostasis-related genes.	Cao Y, etal., Gene. 2013 Nov 10;530(2):248-52. doi: 10.1016/j.gene.2013.07.080. Epub 2013 Aug 14.
9.	Thrombomodulin Ala455Val Polymorphism and the risk of cerebral infarction in a biracial population: the Stroke Prevention in Young Women Study.	Cole JW, etal., BMC Neurol. 2004 Dec 1;4(1):21.
10.	Plasma biomarker profiles in acute exacerbation of idiopathic pulmonary fibrosis.	Collard HR, etal., Am J Physiol Lung Cell Mol Physiol. 2010 Jul;299(1):L3-7. Epub 2010 Apr 23.
11.	Alterations in endothelial thrombomodulin expression in zymosan-induced lung injury.	Cone JB, etal., J Trauma. 2003 Apr;54(4):731-6; discussion 736.
12.	The anticoagulant protein C pathway.	Dahlback B and Villoutreix BO, FEBS Lett. 2005 Jun 13;579(15):3310-6. Epub 2005 Mar 13.
13.	Localization of thrombomodulin in pericryptal fibroblasts of the rat duodenum.	Daimon T and Okuma Y, Histochem Cell Biol. 2004 Apr;121(4):311-7. Epub 2004 Mar 18.
14.	Immunocytochemical localization of thrombomodulin in the aqueous humor passage of the rat eye.	Daimon T, etal., Histochem Cell Biol. 1997 Aug;108(2):121-31.
15.	Upregulation of Inflammatory Mediators in End-Stage Renal Disease as Measured Using Biochip Array Technology.	Davis R, etal., Clin Appl Thromb Hemost. 2011 Aug 25.
16.	Erectile and endothelial dysfunction in Type II diabetes: a possible link.	De Angelis L, etal., Diabetologia. 2001 Sep;44(9):1155-60.
17.	Thrombomodulin mutations in atypical hemolytic-uremic syndrome.	Delvaeye M, etal., N Engl J Med. 2009 Jul 23;361(4):345-57. doi: 10.1056/NEJMoa0810739.
18.	Anchoring fusion thrombomodulin to the endothelial lumen protects against injury-induced lung thrombosis and inflammation.	Ding BS, etal., Am J Respir Crit Care Med. 2009 Aug 1;180(3):247-56. Epub 2009 Apr 2.
19.	Serum thrombomodulin in systemic lupus erythematosus and juvenile idiopathic arthritis.	el-Gamal YM, etal., Pediatr Allergy Immunol. 2004 Jun;15(3):270-7.
20.	The protein C pathway.	Esmon CT, Chest. 2003 Sep;124(3 Suppl):26S-32S.
21.	Neuroprotective effects of recombinant thrombomodulin in controlled contusion spinal cord injury implicates thrombin signaling.	Festoff BW, etal., J Neurotrauma. 2004 Jul;21(7):907-22.
22.	Prothrombotic markers in familial combined hyperlipidemia: evidence of endothelial cell activation and relation to metabolic syndrome.	Georgieva AM, etal., Atherosclerosis. 2004 Aug;175(2):345-51.
23.	Neuropathologic evidence of endothelial changes in cerebral small vessel disease.	Giwa MO, etal., Neurology. 2011 Dec 14.
24.	Endothelial expression of transcription factor Kruppel-like factor 2 and its vasoprotective target genes in the normal and cirrhotic rat liver.	Gracia-Sancho J, etal., Gut. 2011 Apr;60(4):517-24. Epub 2010 Nov 26.
25.	In vivo and in vitro effects of the anticoagulant, thrombomodulin, on the inflammatory response in rodent models.	Hagiwara S, etal., Shock. 2010 Mar;33(3):282-8.
26.	Recombinant thrombomodulin prevents heatstroke by inhibition of high-mobility group box 1 protein in sera of rats.	Hagiwara S, etal., Shock. 2010 Oct;34(4):402-6.
27.	Impact of alpha-tocopherol and vitamin C on endothelial markers in rats with streptozotocin-induced diabetes.	Haidara MA, etal., Med Sci Monit. 2004 Feb;10(2):BR41-6.
28.	The effects of recombinant human thrombomodulin on endotoxin-induced multiple-system organ failure in rats.	Hasegawa N, etal., Am J Respir Crit Care Med. 1996 Jun;153(6 Pt 1):1831-7.
29.	Markers of endothelial cell activation in elderly men at high risk for coronary heart disease.	Hjerkinn EM, etal., Scand J Clin Lab Invest. 2005;65(3):201-9.
30.	Effect of recombinant human soluble thrombomodulin on clinical outcomes of patients with coagulopathy after hematopoietic stem cell transplantation.	Ikezoe T, etal., Eur J Haematol. 2013 Nov;91(5):442-7. doi: 10.1111/ejh.12188. Epub 2013 Oct 1.
31.	Effects of a novel peptide derived from human thrombomodulin on endotoxin-induced uveitis in vitro and in vivo.	Jin H, etal., FEBS Lett. 2011 Nov 4;585(21):3457-64. doi: 10.1016/j.febslet.2011.10.002. Epub 2011 Oct 10.
32.	Low soluble thrombomodulin activity and antigen is associated with a family history of heart disease while a high level is associated with a personal history of heart disease in type 2 diabetes.	Konstantoulas CJ, etal., Thromb Haemost. 2007 Jan;97(1):161-4.
33.	Bacterial lipopolysaccharide decreases thrombomodulin expression in the sinusoidal endothelial cells of rats -- a possible mechanism of intrasinusoidal microthrombus formation and liver dysfunction.	Kume M, etal., J Hepatol. 2003 Jan;38(1):9-17.
34.	Clinical significance of selected endothelial activation markers in patients with systemic lupus erythematosus.	Kuryliszyn-Moskal A, etal., J Rheumatol. 2008 Jul;35(7):1307-13. Epub 2008 May 15.
35.	Zhongguo wei zhong bing ji jiu yi xue = Chinese critical care medicine = Zhongguo weizhongbing jijiuyixue	Li YP, etal., Zhongguo Wei Zhong Bing Ji Jiu Yi Xue. 2007 Jun;19(6):365-8.
36.	Decreased expression of thrombomodulin is correlated with tumor cell invasiveness and poor prognosis in nonsmall cell lung cancer.	Liu PL, etal., Mol Carcinog. 2010 Oct;49(10):874-81.
37.	Elevated plasma tissue-type plasminogen activator (t-PA) and soluble thrombomodulin in patients suffering from severe acute respiratory syndrome (SARS) as a possible index for prognosis and treatment strategy.	Liu ZH, etal., Biomed Environ Sci. 2005 Aug;18(4):260-4.
38.	[Expression of thrombomodulin, endothelial protein C receptor in lung tissue of acute paraquat poisoned rats and intervention of sodium dimercaptopropane sulfonate].	Lu ZQ, etal., Zhonghua Lao Dong Wei Sheng Zhi Ye Bing Za Zhi. 2009 Aug;27(8):453-6.
39.	Impaired flow-mediated vasodilation, carotid artery intima-media thickening, and elevated endothelial plasma markers in obese children: the impact of cardiovascular risk factors.	Meyer AA, etal., Pediatrics. 2006 May;117(5):1560-7.
40.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
41.	Hepatic expression and serum levels of thrombomodulin reflect the extent of liver injury in rats with fulminant hepatic failure and extensive hepatectomy.	Miyamoto S, etal., Hepatol Res. 2002 Mar;22(3):206-213.
42.	Recombinant human soluble thrombomodulin decreases the plasma high-mobility group box-1 protein levels, whereas improving the acute liver injury and survival rates in experimental endotoxemia.	Nagato M, etal., Crit Care Med. 2009 Jul;37(7):2181-6.
43.	Recombinant thrombomodulin protects mice against histone-induced lethal thromboembolism.	Nakahara M, etal., PLoS One. 2013 Sep 30;8(9):e75961. doi: 10.1371/journal.pone.0075961. eCollection 2013.
44.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
45.	Relative role of genetic complement abnormalities in sporadic and familial aHUS and their impact on clinical phenotype.	Noris M, etal., Clin J Am Soc Nephrol. 2010 Oct;5(10):1844-59. doi: 10.2215/CJN.02210310. Epub 2010 Jul 1.
46.	Enhanced production of endothelial microparticles with increased binding to leukocytes in patients with severe systemic inflammatory response syndrome.	Ogura H, etal., J Trauma. 2004 Apr;56(4):823-30; discussion 830-1.
47.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
48.	Intrarenal administration of recombinant human soluble thrombomodulin ameliorates ischaemic acute renal failure.	Ozaki T, etal., Nephrol Dial Transplant. 2008 Jan;23(1):110-9. Epub 2007 Sep 5.
49.	Circulating thrombomodulin levels in familial Mediterranean fever.	Ozbalkan Z, etal., Clin Exp Rheumatol. 2006 Sep-Oct;24(5 Suppl 42):S95-8.
50.	Thrombomodulin and antibeta2-glycoprotein I in stroke in children.	Pilarska E, etal., Med Sci Monit. 2010 Jul;16(7):CR348-51.
51.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
52.	Human thrombomodulin knock-in mice reveal differential effects of human thrombomodulin on thrombosis and atherosclerosis.	Raife TJ, etal., Arterioscler Thromb Vasc Biol. 2011 Nov;31(11):2509-17.
53.	Soluble Thrombomodulin Reduces Inflammation and Prevents Microalbuminuria Induced by Chronic Endothelial Activation in Transgenic Mice.	Rajashekhar G, etal., Am J Physiol Renal Physiol. 2011 Nov 30.
54.	GOA pipeline	RGD automated data pipeline
55.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
56.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
57.	Comprehensive gene review and curation	RGD comprehensive gene curation
58.	Markers for endothelial dysfunction, but not markers for oxidative stress correlate with classical risk factors and the severity of coronary artery disease. (A subgroup analysis from the Ludwigshafen Risk and Cardiovascular Health Study).	Ruef J, etal., Scand Cardiovasc J. 2006 Oct;40(5):274-9.
59.	Hypertension associated with reduced plasma thrombomodulin levels and a hypercoagulable state in rats.	Sawada K, etal., Clin Exp Hypertens. 2003 Feb;25(2):73-84.
60.	Crucial role of the protein C pathway in governing microvascular inflammation in inflammatory bowel disease.	Scaldaferri F, etal., J Clin Invest. 2007 Jul;117(7):1951-60.
61.	Soluble thrombomodulin protects ischemic kidneys.	Sharfuddin AA, etal., J Am Soc Nephrol. 2009 Mar;20(3):524-34. Epub 2009 Jan 28.
62.	Reduction expression of thrombomodulin and endothelial cell nitric oxide synthase in dermatomyositis.	Shen GL, etal., Neuropathology. 2007 Aug;27(4):309-13.
63.	Age-dependent vulnerability to endotoxemia is associated with reduction of anticoagulant factors activated protein C and thrombomodulin.	Starr ME, etal., Blood. 2010 Jun 10;115(23):4886-93. Epub 2010 Mar 26.
64.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
65.	The thrombomodulin analog Solulin promotes reperfusion and reduces infarct volume in a thrombotic stroke model.	Su EJ, etal., J Thromb Haemost. 2011 Jun;9(6):1174-82. doi: 10.1111/j.1538-7836.2011.04269.x.
66.	Elevation of intracellular cAMP up-regulated thrombomodulin mRNA in cultured vascular endothelial cells derived from spontaneous type-II diabetes mellitus model rat.	Sunagawa M, etal., Endothelium. 2006 Sep-Oct;13(5):325-33.
67.	Non-viral in vivo thrombomodulin gene transfer prevents early loss of thromboresistance of grafted veins.	Tabuchi N, etal., Eur J Cardiothorac Surg. 2004 Nov;26(5):995-1001.
68.	Inhibition of allergic bronchial asthma by thrombomodulin is mediated by dendritic cells.	Takagi T, etal., Am J Respir Crit Care Med. 2011 Jan 1;183(1):31-42. Epub 2010 Aug 13.
69.	Recombinant human soluble thrombomodulin prevents peripheral HMGB1-dependent hyperalgesia in rats.	Tanaka J, etal., Br J Pharmacol. 2013 Nov;170(6):1233-41. doi: 10.1111/bph.12396.
70.	Evaluation of various endothelial biomarkers in ankylosing spondylitis.	Taylan A, etal., Clin Rheumatol. 2012 Jan;31(1):23-8. Epub 2011 May 10.
71.	Soluble thrombomodulin as a predictor of type 2 diabetes: results from the MONICA/KORA Augsburg case-cohort study, 1984-1998.	Thorand B, etal., Diabetologia. 2007 Mar;50(3):545-8. Epub 2006 Dec 29.
72.	Separation and characterization of the molecular species of thrombomodulin in the plasma of diabetic patients.	Uehara S, etal., Thromb Res. 2001 Dec 1;104(5):325-32.
73.	Expression of the endothelial thrombomodulin (TM) on the ischemic rat flap model: preliminary study.	Uygur F, etal., Ann Plast Surg. 2009 Jun;62(6):693-8.
74.	The lectin-like domain of thrombomodulin interferes with complement activation and protects against arthritis.	Van de Wouwer M, etal., J Thromb Haemost. 2006 Aug;4(8):1813-24.
75.	Clinical and immunoserological characteristics of mixed connective tissue disease associated with pulmonary arterial hypertension.	Vegh J, etal., Scand J Immunol. 2006 Jul;64(1):69-76.
76.	Deficiency of microvascular thrombomodulin and up-regulation of protease-activated receptor-1 in irradiated rat intestine: possible link between endothelial dysfunction and chronic radiation fibrosis.	Wang J, etal., Am J Pathol 2002 Jun;160(6):2063-72.
77.	cDNA cloning and sequencing, gene expression, and immunolocalization of thrombomodulin in the Sprague-Dawley rat.	Wang J, etal., DNA Res 1999 Feb 26;6(1):57-62.
78.	[Is soluble thrombomodulin a molecular marker of endothelial cell injury in children and adolescents with arterial hypertension?]	Wojtkielewicz K, etal., Med Wieku Rozwoj. 2006 Jul-Sep;10(3 Pt 2):893-902.
79.	Treatment effects of recombinant human soluble thrombomodulin in patients with severe sepsis: a historical control study.	Yamakawa K, etal., Crit Care. 2011;15(3):R123. Epub 2011 May 11.
80.	Synergistic association of metabolic syndrome and overt nephropathy with elevated asymmetric dimethylarginine in serum and impaired cutaneous microvasodilation in patients with type 2 diabetes.	Yamamoto R and Aso Y, Diabetes Care. 2006 Apr;29(4):928-30.
81.	Thrombomodulin and tissue factor pathway inhibitor in endocardium of rapidly paced rat atria.	Yamashita T, etal., Circulation 2003 Nov 18;108(20):2450-2. Epub 2003 Nov 10.
82.	Cerebral endothelial injury in elderly patients with severe head injury measured by serum thrombomodulin and von Willebrand factor.	Yokota H, etal., Neurol Med Chir (Tokyo). 2007 Sep;47(9):383-8; discussion 388.
83.	Lack of the lectin-like domain of thrombomodulin worsens Shiga toxin-associated hemolytic uremic syndrome in mice.	Zoja C, etal., J Immunol. 2012 Oct 1;189(7):3661-8. Epub 2012 Aug 31.
84.	Clinical implications of serum thrombomodulin in PR3-ANCA-associated vasculitis.	Zycinska K, etal., Eur J Med Res. 2009 Dec 7;14 Suppl 4:268-70.

Additional References at PubMed

PMID:7846065	PMID:10565546	PMID:17379830	PMID:19299737	PMID:19680809	PMID:20472895	PMID:25109347	PMID:26923576

Genomics

Comparative Map Data

Thbd
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	156,316,526 - 156,320,178 (-)	NCBI		GRCr8
mRatBN7.2	3	135,863,366 - 135,867,018 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	135,862,835 - 135,867,193 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	139,806,359 - 139,810,012 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	148,390,492 - 148,394,145 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	146,088,993 - 146,092,645 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	142,748,673 - 142,752,325 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	142,748,674 - 142,752,325 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	149,159,895 - 149,163,547 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	137,158,955 - 137,162,607 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	137,064,528 - 137,068,180 (-)	NCBI
Celera	3	134,707,185 - 134,710,838 (-)	NCBI		Celera
Cytogenetic Map	3	q41	NCBI

THBD
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	20	23,045,633 - 23,049,672 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	20	23,045,633 - 23,049,672 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	20	23,026,270 - 23,030,309 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	20	22,974,270 - 22,978,301 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	20	22,974,270 - 22,978,301	NCBI
Celera	20	23,099,650 - 23,103,681 (-)	NCBI		Celera
Cytogenetic Map	20	p11.21	NCBI
HuRef	20	22,987,792 - 22,991,823 (-)	NCBI		HuRef
CHM1_1	20	23,026,970 - 23,031,001 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	20	23,105,114 - 23,109,153 (-)	NCBI		T2T-CHM13v2.0

Thbd
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	148,246,391 - 148,250,108 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	148,246,386 - 148,250,108 (-)	Ensembl		GRCm39 Ensembl
GRCm38	2	148,404,471 - 148,408,188 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	148,404,466 - 148,408,188 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	148,230,207 - 148,233,924 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	148,095,912 - 148,099,544 (-)	NCBI		MGSCv36	mm8
Celera	2	149,679,568 - 149,683,285 (-)	NCBI		Celera
Cytogenetic Map	2	G3	NCBI
cM Map	2	73.45	NCBI

Thbd
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955415	30,222,830 - 30,226,406 (-)	NCBI	ChiLan1.0	ChiLan1.0

THBD
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	21	23,923,797 - 23,935,661 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	20	23,920,631 - 23,932,503 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	20	22,992,341 - 22,996,415 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	20	23,343,758 - 23,347,966 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	20	23,345,917 - 23,347,812 (-)	Ensembl	panpan1.1		panPan2

THBD
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	24	599,773 - 601,649 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	24	599,773 - 601,649 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	24	624,590 - 626,466 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	24	996,254 - 998,130 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	24	996,254 - 998,130 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	24	595,131 - 597,007 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	24	697,184 - 699,060 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	24	978,557 - 980,433 (+)	NCBI		UU_Cfam_GSD_1.0

Thbd
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	149,143,805 - 149,147,659 (+)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936620	2,563,900 - 2,568,117 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

THBD
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	17	30,217,303 - 30,224,099 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	17	30,219,870 - 30,223,499 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	17	34,274,132 - 34,277,761 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

THBD
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	2	52,041,950 - 52,045,946 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	2	52,043,746 - 52,045,626 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666078	6,853,490 - 6,857,509 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Thbd
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624741	22,880,481 - 22,883,962 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Thbd
4 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	108
Count of miRNA genes:	85
Interacting mature miRNAs:	93
Transcripts:	ENSRNOT00000006200
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2312673	Scl63	Serum cholesterol level QTL 63		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	98535255	168026850	Rat
1598877	Bp285	Blood pressure QTL 285	1.5	0.03	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	120538241	165538241	Rat
1578653	Vnigr3	Vascular neointimal growth QTL 3	3.1		artery morphology trait (VT:0002191)	artery neointimal hyperplastic lesion area (CMO:0001414)	3	130656562	169034231	Rat
2302373	Gluco39	Glucose level QTL 39	5.01		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	3	98535386	161695835	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	47233211	147415807	Rat
1581568	Rf53	Renal function QTL 53			urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	3	56395968	161299569	Rat
1578754	Stresp16	Stress response QTL 16	4	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	3	112681431	157681431	Rat
1300173	Rf11	Renal function QTL 11	3.38		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	121056165	145956249	Rat
9589106	Insul23	Insulin level QTL 23	13.86	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	3	131635904	169034231	Rat
8694437	Bw167	Body weight QTL 167	22.46	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	3	91797474	136797474	Rat
10755461	Coatc16	Coat color QTL 16			coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	3	122438700	167438700	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	59242096	157323038	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
1354611	Despr2	Despair related QTL 2	3.03	0.0028	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	3	97084464	142084464	Rat
2303620	Vencon4	Ventilatory control QTL 4	3.9		respiration trait (VT:0001943)	tidal volume (CMO:0000222)	3	127162703	168026850	Rat
631841	Niddm39	Non-insulin dependent diabetes mellitus QTL 39	3.36		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	94856903	159898684	Rat
1576306	Schws3	Schwannoma susceptibility QTL 3		0.001	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	3	118839124	163839124	Rat
619618	Rf3	Renal disease susceptibility QTL 3	6.5	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate to body weight ratio (CMO:0001270)	3	107693393	152693393	Rat
1300159	Kidm4	Kidney mass QTL 4	3.83		kidney mass (VT:0002707)	right kidney wet weight to body weight ratio (CMO:0001953)	3	121056165	157309487	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	41874578	155617519	Rat
2312659	Slep7	Serum leptin concentration QTL 7		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	3	98535255	168026850	Rat
631673	Iddm13	Insulin dependent diabetes mellitus QTL 13	1.3	0.663	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	3	130193298	161695983	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	41874578	155617519	Rat
1581546	Pur13	Proteinuria QTL 13	2.93	0.0335	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	3	78196190	146592722	Rat
1578656	Vnigr2	Vascular neointimal growth QTL 2	4.2		artery morphology trait (VT:0002191)	lesioned artery residual lumen area (CMO:0001417)	3	130656562	169034231	Rat
631541	Bp81	Blood pressure QTL 81	4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	124122556	169034231	Rat
2293087	Iddm27	Insulin dependent diabetes mellitus QTL 27	2.68		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	97551417	147415807	Rat
2312670	Bw94	Body weight QTL 94		0.01	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	3	98535255	168026850	Rat
724532	Cm17	Cardiac mass QTL 17	2		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	3	95735366	140735366	Rat

Markers in Region

RH128562

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	135,864,510 - 135,864,704 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	142,749,818 - 142,750,011	NCBI	Rnor6.0
Rnor_5.0	3	149,161,040 - 149,161,233	UniSTS	Rnor5.0
RGSC_v3.4	3	137,160,100 - 137,160,293	UniSTS	RGSC3.4
Celera	3	134,708,330 - 134,708,523	UniSTS
RH 3.4 Map	3	1094.6	UniSTS
Cytogenetic Map	3	q41	UniSTS

Genetic Models

This gene Thbd is modified in the following models/strains:

SS-Thbd^m1Mcwi

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_031771	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF022742	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF022743	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC070903	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474026	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000006200 ⟹ ENSRNOP00000006200

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	135,862,835 - 135,867,193 (-)	Ensembl
Rnor_6.0 Ensembl	3	142,748,674 - 142,752,325 (-)	Ensembl

RefSeq Acc Id:

NM_031771 ⟹ NP_113959

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	156,316,526 - 156,320,178 (-)	NCBI
mRatBN7.2	3	135,863,366 - 135,867,018 (-)	NCBI
Rnor_6.0	3	142,748,673 - 142,752,325 (-)	NCBI
Rnor_5.0	3	149,159,895 - 149,163,547 (-)	NCBI
RGSC_v3.4	3	137,158,955 - 137,162,607 (-)	RGD
Celera	3	134,707,185 - 134,710,838 (-)	RGD

Sequence:

show sequence

AGGGACTACGAACCTGGGCTAGAAAAGTCTAGGCTGAGACAGAGGCTAACTGCTGTCGCCGCAG
ACGTACGAAACCCTCTGCCGGGACTGGGTGCCTGCACCATCGCAGTGCTAGCGTTTTCTCGTAG
CTTGCACGGTGTTCTCCTGAACAGCATGCTTGGGGTTTTCCTTCTGGGTGTGCTGGCTCCAGCT
GGCCTGGGGATCTCTGCACTAGCCAAGCTGCAGCCCAAAGGCAGTCAATGCGTGGGGAATGAGT
GCTTCGCGCTTTTCCAGGACCCCGTGACCTTCCTCGATGCCAGCCAGGCCTGCCAGCGCCTGCA
GGGACATTTGATGACAGTGCGCTCCTCGGTGGCTGCGGATGTCATCTCCCTTCTGGTGAGCGAC
AGTAGTATGGACTCACGGCCCTGGATCGGTTTACAGCTCCCTCAGGGCTGTGGTGACCCGGTGC
ATCTCGGGCCCCTGCGCGGCTTCCAGTGGGTTACTGGGGATAACCACACCAGTTACAGCAGGTG
GGCGCGGCCCAACGACCAGTCGCCTCCACTTTGCGGTCCGCTGTGCGTCACGGTCTCAACAGCA
ACAGAAGCTGCACCAGGCGAGCCGGCCTGGGAAGAGAAGCCGTGCGAGAACGAGACCAAGGGTT
TTCTCTGCGAGTTTTACTTCGCAGCTTTCTGCAGGCCTTTACGGGTGAATACCCGAGATCCTGA
GGGTGCCCACATCTCTAGCACCTACAATACCCCATTGGGGGTCAGCGGCGCGGATTTTCAGACG
CTGCCGATAGGCAGTTCTGCTACCGTGGCGCCCTTTGGCTTGGAGCTGGTGTGCAGGGCCCTGC
CCGGAACTTCAGAGGGACACTGGACTCGGGAAGTGACAGGAGCTTGGAACTGCAGCGTGGAGAA
TGGTGGCTGCGAGTACATGTGCAACAGGAGCGCTAACGGACCCAGATGCGTCTGCCCCAGCGGC
GGGGACCTGCAGGCTGATGGCCGTTCGTGCGCAAAACCTGTGGCTCAATTGTGCAACGAACTCT
GCCAGCATTTTTGCGTCAACAACTCTGATGTGCCAGGCTCTTATTCCTGTATGTGCGAAACAGG
CTACCAGTTGGCGGCAGACGGACATCGGTGTGAGGACGTGGATGACTGTAAGCAGGGGCCCAAT
CCATGCCCTCAGCTCTGTTCTAACACCGAGGGCGGCTTCGAATGCCGCTGCTATGATGGCTATG
AGTTGGTGGACGGAGAGTGCGTGGAGCAACTGGATCCGTGCTTCAGATCTAAATGCGAGTATCA
GTGCCAGCCAGTAAACTCCACGCACTACAATTGCATCTGTGCTGAGGGCTTCGCACCTAAGCTG
GATGATCCCGACAGGTGCGAAATGTTCTGCAATGAAACTTCGTGCCCAGCAGACTGTGACCCCA
ACTCCCCAAGCTTTTGTCAATGCCCTGAGGGCTTCATCCTGGACGAGGGTTCCATATGCACAGA
CATTGATGAGTGCAGTCAAGGCGAATGCCTCACCAATGAATGTCGAAACCTTCCTGGCTCCTAT
GAGTGCATCTGCGGACCTGACACAGCCCTTGCTGGTCAGATTAGCAAGGACTGTGACCCCATCC
CTGTTCTGGAGGACTCAGAGGATGGTGGCTCTGGGGAGCACCCATCAAGCAATCCGACGGTAGT
CTCTTCGACAGTTCCCCCTTCTGCAAGACCAATGCACTCTGGTGTGCTCATTGGGATCTCCATT
GCCAGCCTGTCCCTGGTGGTGGCGCTTTTGGCGCTTCTTTGTCACCTGCGCAAGAAGCAGGGCA
CTGCTCGCGCAGAGCTGGAGTACAAGTGTACCTCTTCAGCCAAGGAGGTAGTACTGCAGCACGT
GAGGACTGATCGGACGCTGCAGAAGTTCTGAGGGATTTACTCCAGAGACCAAGGTGGCCTTTGT
CTTTCCGGGCTCTGTACCTCTCCTTTCTCTCTCTTCAGCCTCCCAGCTGTGCTCTCTGGCAATG
TAAAAGCATTCTGGCTGGTATAATAACCAGAGAAGAGCTCATCCTCTTATGACAAGCGAGGGTA
GGGAGGACTTGAAGCCGGAGAGCCCAGTTTCTTCCAAGTAGAGACTGGACAACTGGGCGGAGGT
GACAAATACAGTGAAGATCCCAGAGTGTCCCAGTCCCTCACCTCGGGGTGCAGGATGTGTGGGT
GCTGCTGATCTGTAGGCTTGGAGGCAAACCTTGACCCTATGGACTGGAGATGACCCAGATATTT
ATTTTTTTAAAAGTATTTAGTATTTTCTTCCCTTCAGCTTTATTCTGCTTGTAAGTCTCCAGTC
CCTCACCCTTTTCTGTGTCCCTCCATTCCTTTCCCTCCCCTCCCCCTCTCCATCATTCTCCTCC
CCGAACCTGATCATAGTTTGCCTTTACCCTTGTCTCCAAACTCTTATGTGAAACAGAAAAAAAA
AAAACACTAAACGCAGAAAAATATTTTTTTTCGCTAGCTTTGGCAATTTAATCGGGGATTTCAG
GTAACCAGAGCAAAAGAATTTAAACAAAAGTTAAAATGTTTCAACTGAACACTAACTAGTTAAT
AGTGCTGGAATATCACAGAATTTAAACTCAAGGAAGTAGGGTTTTGATTTTTTTTAATCTTTGT
TTTTGAAAGGGTGAGCCTGGGTTTTATGATTGTTGCTGTTGTTTTTTTTTTATTTAGAATGACA
AAAGAGGTAATAATTATTAAACTTTTTATGCCGGCTTCTACAGTGTTATTAATTTTTGACAGTG
TTTCAAATGTGCAGAGGATCCTTTGTCCAACCCTTTGACATTCCAATAGGACATTGCCATCTTC
AGACATATTGGGCCACATTCATAGCTATCCAAGAATGTATGTGGTCCTTAGCCTGGACATATCT
GAGACGGATGGATGGAAGCATCTTCCAGTAAAGCTTGAGCTGTATGCTTCGTGCCTGGCTGACT
CTCCACTGTGTTTGCCATTTGTAGTCCCAAAATAAAAGCAATGTGCTGCTTAGGGAGATATGGC
AACTTGGGAAAGGAGTCTGGGGGGTGACTAGATGGGACTTTGCTTTAATGAAACTCTGGAACGA
TATCTTGTACTTCAGAGAGATCTACTAGCCCTGGCCTATACACAAGAATTGGGACCTCCCTTGG
GATCTGGCTAGAATTGCAAAATCCTAACCCCCACCCTACCCCACTCCCACCCCAGTGAGCCAGT
TCATAAGAAGCTGCATTTTGACAACATCCACAGGGCATTGTCCAGTCATTTCAGGACAACTGGT
CTAAAGAGTTTCCAACTTCTTGAGAACATTTAAATGTCACTTAATAATAAGTAGCAGGCCATAT
GCAGGCCATTTTTTAATAAAGAAACTGAGGAATTTTCTCTGCATAGCTTTGCTTTCTGGATAAA
ATAAAAGGACCAGGTACATGCCTCTAGATATTGGCATACAGAGTCCAGAAGGGTTTTGTTTTAA
GTAAGCTAGGAATGAGTTCATATGTCAGTGTAAGGAACAAATGTATCATATGTGTATCTTTTGT
GAAGAAAAGGTTTTCTTTACTGTTTTGTAGGCTCAGCATATCTGTACATATTTATTTATTGGAG
TTTAGCTAGAACACAAGCAAAGCCTTTGCTTATGACGTCACGTGTATAAAATAAATAGATTACA
ATGTAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_113959	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB80760	(Get FASTA)	NCBI Sequence Viewer
	AAB80923	(Get FASTA)	NCBI Sequence Viewer
	AAH70903	(Get FASTA)	NCBI Sequence Viewer
	EDL95102	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000006200.1

RefSeq Acc Id:	NP_113959 ⟸ NM_031771
- Peptide Label:	precursor
- UniProtKB:	O35370 (UniProtKB/TrEMBL), A6K7B7 (UniProtKB/TrEMBL), F7EK87 (UniProtKB/TrEMBL)
- Sequence:	show sequence MLGVFLLGVLAPAGLGISALAKLQPKGSQCVGNECFALFQDPVTFLDASQACQRLQGHLMTVRS SVAADVISLLVSDSSMDSRPWIGLQLPQGCGDPVHLGPLRGFQWVTGDNHTSYSRWARPNDQSP PLCGPLCVTVSTATEAAPGEPAWEEKPCENETKGFLCEFYFAAFCRPLRVNTRDPEGAHISSTY NTPLGVSGADFQTLPIGSSATVAPFGLELVCRALPGTSEGHWTREVTGAWNCSVENGGCEYMCN RSANGPRCVCPSGGDLQADGRSCAKPVAQLCNELCQHFCVNNSDVPGSYSCMCETGYQLAADGH RCEDVDDCKQGPNPCPQLCSNTEGGFECRCYDGYELVDGECVEQLDPCFRSKCEYQCQPVNSTH YNCICAEGFAPKLDDPDRCEMFCNETSCPADCDPNSPSFCQCPEGFILDEGSICTDIDECSQGE CLTNECRNLPGSYECICGPDTALAGQISKDCDPIPVLEDSEDGGSGEHPSSNPTVVSSTVPPSA RPMHSGVLIGISIASLSLVVALLALLCHLRKKQGTARAELEYKCTSSAKEVVLQHVRTDRTLQK F hide sequence

Ensembl Acc Id:

ENSRNOP00000006200 ⟸ ENSRNOT00000006200

Protein Domains

C-type lectin EGF-like

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-O35370-F1-model_v2	AlphaFold	O35370	1-577	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692495

Promoter ID:

EPDNEW_R3020

Type:

single initiation site

Name:

Thbd_1

Description:

thrombomodulin

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	142,752,344 - 142,752,404	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621299	AgrOrtholog
BioCyc Gene	G2FUF-47509	BioCyc
Ensembl Genes	ENSRNOG00000004687	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000006200.4	UniProtKB/TrEMBL
Gene3D-CATH	3.10.100.10	UniProtKB/TrEMBL
	Laminin	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7100705	IMAGE-MGC_LOAD
InterPro	C-type_lectin	UniProtKB/TrEMBL
	C-type_lectin-like	UniProtKB/TrEMBL
	C-type_lectin_fold	UniProtKB/TrEMBL
	cEGF	UniProtKB/TrEMBL
	EG-like_dom	UniProtKB/TrEMBL
	EGF-like_Ca-bd	UniProtKB/TrEMBL
	EGF-type_Asp/Asn_hydroxyl_site	UniProtKB/TrEMBL
	EGF_Ca-bd_CS	UniProtKB/TrEMBL
	Growth_fac_rcpt_N_dom	UniProtKB/TrEMBL
	NOTCH1_EGF-like	UniProtKB/TrEMBL
	Spindle_Org/Thrombomodulin	UniProtKB/TrEMBL
	Tme5_EGF-like	UniProtKB/TrEMBL
KEGG Report	rno:83580	UniProtKB/TrEMBL
MGC_CLONE	MGC:91620	IMAGE-MGC_LOAD
NCBI Gene	83580	ENTREZGENE
PANTHER	PTHR24036:SF5	UniProtKB/TrEMBL
	SKELETOR-RELATED	UniProtKB/TrEMBL
Pfam	cEGF	UniProtKB/TrEMBL
	EGF_CA	UniProtKB/TrEMBL
	Lectin_C	UniProtKB/TrEMBL
	Tme5_EGF_like	UniProtKB/TrEMBL
PhenoGen	Thbd	PhenoGen
PIRSF	CD93/CD141	UniProtKB/TrEMBL
PRINTS	THRMBOMODULN	UniProtKB/TrEMBL
PROSITE	ASX_HYDROXYL	UniProtKB/TrEMBL
	C_TYPE_LECTIN_2	UniProtKB/TrEMBL
	EGF_2	UniProtKB/TrEMBL
	EGF_3	UniProtKB/TrEMBL
	EGF_CA	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000004687	RatGTEx
SMART	CLECT	UniProtKB/TrEMBL
	EGF	UniProtKB/TrEMBL
	EGF_CA	UniProtKB/TrEMBL
Superfamily-SCOP	C-type_lectin_fold	UniProtKB/TrEMBL
	EGF/Laminin	UniProtKB/TrEMBL
	SSF57184	UniProtKB/TrEMBL
UniProt	A6K7B7	ENTREZGENE
	F7EK87	ENTREZGENE, UniProtKB/TrEMBL
	O35370	ENTREZGENE, UniProtKB/TrEMBL
UniProt Secondary	A6K7B7	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-09-10	Thbd	thrombomodulin			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Thbd	thrombomodulin			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_process	may be involved in embryonic development, several inflammatory conditions and in tumor biology	634506
gene_regulation	activity deficiency results from intestinal irradiation	634507

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)