Symbol:
Agtr1b
Name:
angiotensin II receptor, type 1b
RGD ID:
10123
MGI Page
MGI
Description:
Predicted to enable angiotensin receptor activity; bradykinin receptor binding activity; and protein heterodimerization activity. Involved in regulation of blood pressure. Acts upstream of or within several processes, including blood vessel development; drinking behavior; and regulation of systemic arterial blood pressure by circulatory renin-angiotensin. Predicted to be active in plasma membrane. Is expressed in several structures, including adrenal gland; genitourinary system; heart; liver; and lung. Human ortholog(s) of this gene implicated in several diseases, including COVID-19; artery disease (multiple); chronic kidney disease; neurodegenerative disease (multiple); and sarcoidosis. Orthologous to human AGTR1 (angiotensin II receptor type 1).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
Agtr-; Agtr-1b; angiotensin II type-1 receptor B; angiotensin II type-1B receptor; Angtr; Angtr-1b; AT1; AT1 receptor B; AT1B; AT2R1B; AT3; MGC129325; type-1 angiotensin II receptor B; type-1B angiotensin II receptor
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Rattus norvegicus (Norway rat):
Agtr1b (angiotensin II receptor, type 1b) RGD
RGD
Other homologs 2
Homo sapiens (human):
AGTR1 (angiotensin II receptor type 1) HGNC
Ensembl, HGNC, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Agtr1b (angiotensin II receptor, type 1b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
AGTR1 (angiotensin II receptor type 1)
Alliance
DIOPT (Ensembl Compara|HGNC|OMA|OrthoFinder|PANTHER|PhylomeDB)
Danio rerio (zebrafish):
agtr1b (angiotensin II receptor, type 1b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Danio rerio (zebrafish):
agtr1a (angiotensin II receptor, type 1a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Caenorhabditis elegans (roundworm):
npr-33
Alliance
DIOPT (Ensembl Compara|PANTHER)
Caenorhabditis elegans (roundworm):
npr-15
Alliance
DIOPT (Ensembl Compara|PANTHER)
Xenopus tropicalis (tropical clawed frog):
agtr1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 20,368,637 - 20,421,341 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 20,368,637 - 20,421,341 (-) Ensembl GRCm39 Ensembl GRCm38 3 20,314,473 - 20,367,177 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 20,314,473 - 20,367,177 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 20,213,395 - 20,266,099 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 20,505,546 - 20,558,250 (-) NCBI MGSCv36 mm8 Celera 3 20,303,573 - 20,356,081 (-) NCBI Celera Cytogenetic Map 3 A2 NCBI cM Map 3 6.37 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Agtr1b Mouse (S)-nicotine increases expression ISO Agtr1b (Rattus norvegicus) 6480464 Nicotine results in increased expression of AGTR1B mRNA CTD PMID:22728133 Agtr1b Mouse 17beta-estradiol multiple interactions ISO Agtr1b (Rattus norvegicus) 6480464 bisphenol A inhibits the reaction [Estradiol inhibits the reaction [[Oxygen deficiency co-treated with Blood Glucose deficiency] results in increased expression of AGTR1B protein]] and Estradiol inhibits the reaction [[Oxygen deficiency co-treated with Blood Glucose deficiency] results in increased expression of AGTR1B protein] CTD PMID:32319667 Agtr1b Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Agtr1b (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in increased expression of AGTR1B mRNA CTD PMID:19490992 Agtr1b Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of AGTR1B mRNA CTD PMID:21570461 Agtr1b Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of AGTR1B mRNA CTD PMID:21354282 Agtr1b Mouse 4-hydroxy-TEMPO multiple interactions EXP 6480464 tempol inhibits the reaction [[AGT protein modified form co-treated with AGTR1A co-treated with AGTR1B] results in increased expression of SERPINE1 mRNA] CTD PMID:17620961 Agtr1b Mouse 6-propyl-2-thiouracil decreases expression ISO Agtr1b (Rattus norvegicus) 6480464 Propylthiouracil results in decreased expression of AGTR1B mRNA CTD PMID:24780913 Agtr1b Mouse ammonium chloride affects expression ISO Agtr1b (Rattus norvegicus) 6480464 Ammonium Chloride affects the expression of AGTR1B mRNA CTD PMID:16483693 Agtr1b Mouse bisphenol A decreases expression ISO Agtr1b (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of AGTR1B mRNA CTD PMID:25181051 Agtr1b Mouse bisphenol A multiple interactions ISO Agtr1b (Rattus norvegicus) 6480464 bisphenol A inhibits the reaction [Estradiol inhibits the reaction [[Oxygen deficiency co-treated with Blood Glucose deficiency] results in increased expression of AGTR1B protein]] CTD PMID:32319667 Agtr1b Mouse calcitriol multiple interactions ISO Agtr1b (Rattus norvegicus) 6480464 [Calcium co-treated with Calcitriol] affects the expression of AGTR1B mRNA CTD PMID:15913539 Agtr1b Mouse calcium atom multiple interactions ISO Agtr1b (Rattus norvegicus) 6480464 [Calcium co-treated with Calcitriol] affects the expression of AGTR1B mRNA CTD PMID:15913539 Agtr1b Mouse calcium(0) multiple interactions ISO Agtr1b (Rattus norvegicus) 6480464 [Calcium co-treated with Calcitriol] affects the expression of AGTR1B mRNA CTD PMID:15913539 Agtr1b Mouse Cuprizon decreases expression ISO Agtr1b (Rattus norvegicus) 6480464 Cuprizone results in decreased expression of AGTR1B mRNA CTD PMID:26577399 Agtr1b Mouse Cuprizon affects expression ISO Agtr1b (Rattus norvegicus) 6480464 Cuprizone affects the expression of AGTR1B mRNA CTD PMID:27523638 Agtr1b Mouse DDE multiple interactions ISO Agtr1b (Rattus norvegicus) 6480464 [Dichlorodiphenyl Dichloroethylene co-treated with Dietary Fats] affects the expression of AGTR1B mRNA CTD PMID:30415545 Agtr1b Mouse diethylstilbestrol decreases expression ISO Agtr1b (Rattus norvegicus) 6480464 Diethylstilbestrol results in decreased expression of AGTR1B mRNA CTD PMID:14722030 Agtr1b Mouse dioxygen multiple interactions ISO Agtr1b (Rattus norvegicus) 6480464 [Oxygen deficiency co-treated with Blood Glucose deficiency] results in increased expression of AGTR1B protein more ... CTD PMID:32319667 Agtr1b Mouse flavonoids increases expression ISO Agtr1b (Rattus norvegicus) 6480464 Flavonoids results in increased expression of AGTR1B mRNA CTD PMID:18035473 Agtr1b Mouse fructose increases expression ISO Agtr1b (Rattus norvegicus) 6480464 Fructose results in increased expression of AGTR1B mRNA CTD PMID:14568997 Agtr1b Mouse fructose multiple interactions ISO Agtr1b (Rattus norvegicus) 6480464 KLK1 protein inhibits the reaction [Fructose results in increased expression of AGTR1B mRNA] CTD PMID:14568997 Agtr1b Mouse GW 3965 affects expression ISO Agtr1b (Rattus norvegicus) 6480464 GW 3965 affects the expression of AGTR1B mRNA CTD PMID:17420776 Agtr1b Mouse hydroxyurea increases expression EXP 6480464 Hydroxyurea results in increased expression of AGTR1B mRNA CTD PMID:27208086 Agtr1b Mouse mono(2-ethylhexyl) phthalate decreases expression EXP 6480464 mono-(2-ethylhexyl)phthalate results in decreased expression of AGTR1B mRNA CTD PMID:22401849 Agtr1b Mouse N(gamma)-nitro-L-arginine methyl ester increases expression ISO Agtr1b (Rattus norvegicus) 6480464 NG-Nitroarginine Methyl Ester results in increased expression of AGTR1B protein CTD PMID:32479886 Agtr1b Mouse N(gamma)-nitro-L-arginine methyl ester multiple interactions ISO Agtr1b (Rattus norvegicus) 6480464 Sildenafil Citrate inhibits the reaction [NG-Nitroarginine Methyl Ester results in increased expression of AGTR1B protein] and tangeretin inhibits the reaction [NG-Nitroarginine Methyl Ester results in increased expression of AGTR1B protein] CTD PMID:32479886 Agtr1b Mouse N,N-diethyl-m-toluamide multiple interactions ISO Agtr1b (Rattus norvegicus) 6480464 [Permethrin co-treated with DEET] results in decreased methylation of AGTR1B gene CTD PMID:33148267 Agtr1b Mouse N-methyl-N-nitrosourea increases expression ISO Agtr1b (Rattus norvegicus) 6480464 Methylnitrosourea results in increased expression of AGTR1B mRNA CTD PMID:16525678 Agtr1b Mouse nicotine increases expression ISO Agtr1b (Rattus norvegicus) 6480464 Nicotine results in increased expression of AGTR1B mRNA CTD PMID:22728133 Agtr1b Mouse nitric oxide affects abundance ISO Agtr1b (Rattus norvegicus) 6480464 AGTR1B protein affects the abundance of Nitric Oxide CTD PMID:19151255 Agtr1b Mouse nitrofen decreases expression ISO Agtr1b (Rattus norvegicus) 6480464 nitrofen results in decreased expression of AGTR1B mRNA CTD PMID:16292651 Agtr1b Mouse permethrin multiple interactions ISO Agtr1b (Rattus norvegicus) 6480464 [Permethrin co-treated with DEET] results in decreased methylation of AGTR1B gene CTD PMID:33148267 Agtr1b Mouse potassium dichromate decreases expression EXP 6480464 Potassium Dichromate results in decreased expression of AGTR1B mRNA CTD PMID:23608068 Agtr1b Mouse reactive oxygen species multiple interactions EXP 6480464 [AGT protein modified form co-treated with AGTR1A co-treated with AGTR1B] results in increased abundance of Reactive Oxygen Species CTD PMID:17620961 Agtr1b Mouse rotenone increases expression EXP 6480464 Rotenone results in increased expression of AGTR1B protein CTD PMID:29665408 Agtr1b Mouse sildenafil citrate multiple interactions ISO Agtr1b (Rattus norvegicus) 6480464 Sildenafil Citrate inhibits the reaction [NG-Nitroarginine Methyl Ester results in increased expression of AGTR1B protein] CTD PMID:32479886 Agtr1b Mouse tangeretin multiple interactions ISO Agtr1b (Rattus norvegicus) 6480464 tangeretin inhibits the reaction [NG-Nitroarginine Methyl Ester results in increased expression of AGTR1B protein] CTD PMID:32479886 Agtr1b Mouse telmisartan multiple interactions EXP 6480464 telmisartan inhibits the reaction [[AGT protein modified form co-treated with AGTR1A co-treated with AGTR1B] results in increased expression of SERPINE1 mRNA] CTD PMID:17620961 Agtr1b Mouse Tesaglitazar increases expression ISO Agtr1b (Rattus norvegicus) 6480464 tesaglitazar results in increased expression of AGTR1B mRNA CTD PMID:21515302 Agtr1b Mouse troglitazone decreases expression ISO Agtr1b (Rattus norvegicus) 6480464 troglitazone results in decreased expression of AGTR1B mRNA CTD PMID:21515302 Agtr1b Mouse vinclozolin decreases expression ISO Agtr1b (Rattus norvegicus) 6480464 vinclozolin results in decreased expression of AGTR1B mRNA CTD PMID:22615374
Imported Annotations - KEGG (archival)
Biological Process
angiotensin-activated signaling pathway (ISO) blood vessel development (IGI) brain renin-angiotensin system (IMP) calcium-mediated signaling (ISO) cell chemotaxis (ISO) cellular response to dexamethasone stimulus (IEA,ISO) drinking behavior (IGI,IMP) G protein-coupled receptor signaling pathway (IBA,ISO) inflammatory response (IBA,IGI) kidney development (IGI,ISO) maintenance of blood vessel diameter homeostasis by renin-angiotensin (ISO,ISS) negative regulation of neuron apoptotic process (IMP) neuron apoptotic process (IMP) phospholipase C-activating angiotensin-activated signaling pathway (IEA,ISO) phospholipase C-activating G protein-coupled receptor signaling pathway (ISO) positive regulation of blood pressure (IEA,ISO) positive regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis (ISO) positive regulation of branching involved in ureteric bud morphogenesis (IEA,ISO) positive regulation of CoA-transferase activity (ISO) positive regulation of cytosolic calcium ion concentration (IBA,ISO) positive regulation of macrophage derived foam cell differentiation (ISO) positive regulation of phospholipase A2 activity (ISO) positive regulation of protein metabolic process (ISO) regulation of blood pressure (IMP) regulation of systemic arterial blood pressure by circulatory renin-angiotensin (IGI) regulation of vasoconstriction (IEA,ISO) response to angiotensin (ISO) response to estrogen (IEA,ISO) response to hypoxia (IEA,ISO) response to immobilization stress (IEA,ISO) response to nicotine (IEA,ISO) response to nutrient (IEA,ISO) response to salt stress (IEA,ISO) response to xenobiotic stimulus (IEA,ISO) Rho protein signal transduction (ISO) symbiont entry into host cell (ISO)
1.
International union of pharmacology. XXIII. The angiotensin II receptors.
de Gasparo M, etal., Pharmacol Rev. 2000 Sep;52(3):415-72.
2.
Angiotensin II type 1 receptor A1166C gene polymorphism. Absence of an association with the risk of coronary artery disease and myocardial infarction and of a synergistic effect with angiotensin-converting enzyme gene polymorphism on the risk of these diseases.
Gardemann A, etal., Eur Heart J. 1998 Nov;19(11):1657-65.
3.
Mutations in genes in the renin-angiotensin system are associated with autosomal recessive renal tubular dysgenesis.
Gribouval O, etal., Nat Genet. 2005 Sep;37(9):964-8. Epub 2005 Aug 14.
4.
Pleiotropic AT1 receptor signaling pathways mediating physiological and pathogenic actions of angiotensin II.
Hunyady L and Catt KJ, Mol Endocrinol. 2006 May;20(5):953-70. Epub 2005 Sep 1.
5.
A gammaGT-AT1A receptor transgene protects renal cortical structure in AT1 receptor-deficient mice.
Le TH, etal., Physiol Genomics. 2004 Aug 11;18(3):290-8.
6.
[Dynamic changes of angiotensin II type-1 receptor mRNA expression in volume-overloaded ventricular hypertrophy].
Li YQ, etal., Sheng Li Xue Bao. 1998 Jun;50(3):303-8.
7.
Prophylactic angiotensin type 1 receptor antagonism confers neuroprotection in an aged rat model of postoperative cognitive dysfunction.
Li Z, etal., Biochem Biophys Res Commun. 2014 Jun 20;449(1):74-80. doi: 10.1016/j.bbrc.2014.04.153. Epub 2014 May 9.
8.
Electronic Transfer of Homolog Data
MGD and Homologene mouse data transfer
9.
MGDs mouse GO annotations
MGD data from the GO Consortium
10.
MGD IEA
MGD IEA
11.
TM2-TM7 interaction in coupling movement of transmembrane helices to activation of the angiotensin II type-1 receptor.
Miura S, etal., J Biol Chem 2003 Feb 7;278(6):3720-5.
12.
Increased gene expression of components of the renin-angiotensin system in glomeruli of genetically hypertensive rats.
Obata J, etal., J Hypertens. 2000 Sep;18(9):1247-55.
13.
Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.
Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
14.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
15.
Overexpression of angiotensin II type I receptor in cardiomyocytes induces cardiac hypertrophy and remodeling.
Paradis P, etal., Proc Natl Acad Sci U S A 2000 Jan 18;97(2):931-6.
16.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
17.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
18.
Angiotensin III: a central regulator of vasopressin release and blood pressure.
Reaux A, etal., Trends Endocrinol Metab. 2001 May-Jun;12(4):157-62.
19.
Mouse MP Annotation Import Pipeline
RGD automated import pipeline
20.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
21.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
22.
AT-1 receptor and phospholipase C are involved in angiotensin III modulation of hypothalamic noradrenergic transmission.
Rodriguez-Campos M, etal., Cell Mol Neurobiol. 2000 Dec;20(6):747-62.
23.
Murine double nullizygotes of the angiotensin type 1A and 1B receptor genes duplicate severe abnormal phenotypes of angiotensinogen nullizygotes.
Tsuchida S, etal., J Clin Invest 1998 Feb 15;101(4):755-60.
24.
Positive feedback regulation of angiotensin II-AT1B receptor gene expression in rat adrenal glands.
Wagner C and Kurtz A, Pflugers Arch. 1998 Aug;436(3):323-8.
25.
Epistatic interaction between variations in the angiotensin I converting enzyme and angiotensin II type 1 receptor genes in relation to extent of coronary atherosclerosis.
Ye S, etal., Heart. 2003 Oct;89(10):1195-9.
Agtr1b Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 20,368,637 - 20,421,341 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 20,368,637 - 20,421,341 (-) Ensembl GRCm39 Ensembl GRCm38 3 20,314,473 - 20,367,177 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 20,314,473 - 20,367,177 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 20,213,395 - 20,266,099 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 20,505,546 - 20,558,250 (-) NCBI MGSCv36 mm8 Celera 3 20,303,573 - 20,356,081 (-) NCBI Celera Cytogenetic Map 3 A2 NCBI cM Map 3 6.37 NCBI
Agtr1b Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 104,774,005 - 104,849,262 (-) NCBI GRCr8 mRatBN7.2 2 102,844,969 - 102,920,232 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 102,844,969 - 102,920,232 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 109,389,316 - 109,463,548 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 107,510,501 - 107,584,761 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 102,444,366 - 102,513,153 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 105,149,020 - 105,224,335 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 105,149,020 - 105,224,295 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 124,879,262 - 124,954,378 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 105,503,269 - 105,602,591 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 105,448,230 - 105,547,520 (-) NCBI Celera 2 98,214,526 - 98,286,355 (-) NCBI Celera Cytogenetic Map 2 q24 NCBI
.
Predicted Target Of
Count of predictions: 366 Count of miRNA genes: 225 Interacting mature miRNAs: 236 Transcripts: ENSMUST00000068316, ENSMUST00000163776 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
4142399 Aec1_m autoimmune exocrinopathy 1 (mouse) Not determined 7586174 102690034 Mouse 4141116 Lgaq4_m late growth adjusted QTL 4 (mouse) Not determined 10249221 83184946 Mouse 4141563 Lgq3_m late growth QTL 3 (mouse) Not determined 10249221 83184946 Mouse 1357584 Splq6_m spleen weight QTL 6 (mouse) Not determined 3 10249221 83184946 Mouse 12738410 Lfibq2_m liver fibrosis QTL 2 (mouse) 3 12065060 20755242 Mouse 1301114 Ssial2_m susceptibility to sialadenitis 2 (mouse) Not determined 3 20174862 54180103 Mouse 26884436 Zlq3_m zygomatic length QTL 3, 10 week (mouse) 3 3265060 142405761 Mouse 12798540 Scvg2_m subcutaneous vessel growth QTL 2 (mouse) 3 7449815 26249645 Mouse 25671383 Hrsq1_m host response to SARS QTL 1, vascular cuffing (mouse) 3 18440954 26823641 Mouse 26884427 Cvht4_m cranial vault height 4, 10 week (mouse) 3 16054164 109707316 Mouse 4142092 Tgq13_m triglyceride QTL 13 (mouse) Not determined 18288168 52288168 Mouse 1357440 Hrtpq1_m heart weight percentage QTL 1 (mouse) Not determined 3 10249221 83184946 Mouse 4141255 W10q3_m weight 10 weeks QTL 3 (mouse) Not determined 10249221 83184946 Mouse 1558925 Hivan1_m HIV-associated nephropathy 1 (mouse) Not determined 3 7586174 68716946 Mouse 1301256 Skmw1_m skeletal muscle weight 1 (mouse) Not determined 3 1 25786432 Mouse 39128206 Lwq18_m liver weight QTL 18 (mouse) 3 10249221 83184946 Mouse 13207570 Tcq12_m total cholesterol QTL 12 (mouse) 3 16504164 130163649 Mouse 1300559 Thypr3_m thymocyte proliferative response 3 (mouse) Not determined 3 4525419 38525519 Mouse 1301358 Eae20_m experimental allergic encephalomyelitis 20 (mouse) Not determined 3 11630453 45630591 Mouse
Agtr1a
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 13 30,381,326 - 30,381,395 UniSTS GRCm38 GRCm38 3 20,315,999 - 20,316,068 UniSTS GRCm38 MGSCv37 3 20,214,921 - 20,214,990 UniSTS GRCm37 MGSCv37 13 30,473,195 - 30,473,264 UniSTS GRCm37 Celera 13 30,595,740 - 30,595,809 UniSTS Celera 3 20,305,099 - 20,305,168 UniSTS Cytogenetic Map 13 A3.2 UniSTS Cytogenetic Map 3 A2 UniSTS cM Map 13 16.0 UniSTS cM Map 13 16.0 UniSTS cM Map 3 7.6 UniSTS
Agtr1b
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 17 43,900,483 - 43,901,549 UniSTS GRCm38 GRCm38 3 20,315,644 - 20,316,334 UniSTS GRCm38 MGSCv37 3 20,214,566 - 20,215,256 UniSTS GRCm37 MGSCv37 17 44,037,432 - 44,038,498 UniSTS GRCm37 Celera 3 20,304,744 - 20,305,434 UniSTS Celera 17 47,325,512 - 47,326,578 UniSTS Cytogenetic Map 3 A2 UniSTS Cytogenetic Map 17 C UniSTS cM Map 3 7.6 UniSTS
PMC28071P1
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 3 20,315,447 - 20,316,181 UniSTS GRCm38 MGSCv37 3 20,214,369 - 20,215,103 UniSTS GRCm37 Celera 3 20,304,547 - 20,305,281 UniSTS Cytogenetic Map 3 A2 UniSTS cM Map 3 7.6 UniSTS
Agtr1a
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 3 20,315,694 - 20,316,334 UniSTS GRCm38 GRCm38 13 30,381,060 - 30,381,700 UniSTS GRCm38 MGSCv37 13 30,472,929 - 30,473,569 UniSTS GRCm37 MGSCv37 3 20,214,616 - 20,215,256 UniSTS GRCm37 Celera 13 30,595,474 - 30,596,114 UniSTS Celera 3 20,304,794 - 20,305,434 UniSTS Cytogenetic Map 3 A2 UniSTS Cytogenetic Map 13 A3.2 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000068316 ⟹ ENSMUSP00000068298
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 20,368,637 - 20,421,341 (-) Ensembl GRCm38.p6 Ensembl 3 20,314,473 - 20,367,177 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000163776 ⟹ ENSMUSP00000128724
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 20,369,061 - 20,421,288 (-) Ensembl GRCm38.p6 Ensembl 3 20,314,897 - 20,367,124 (-) Ensembl
RefSeq Acc Id:
NM_175086 ⟹ NP_780295
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 3 20,368,637 - 20,421,341 (-) NCBI GRCm38 3 20,314,473 - 20,367,177 (-) ENTREZGENE MGSCv37 3 20,213,395 - 20,266,099 (-) RGD Celera 3 20,303,573 - 20,356,081 (-) RGD cM Map 3 ENTREZGENE
Sequence:
AGCTGCAGGCAGCCTGGATCCCAGGCAGCAGGGAGTAACAGAGACCAGACAAGACACGCACAGCCTCTCCAGCGCCAGCAGCACTGTAGATGGGGAGCAGCCAAGAGGCGTGAAAGAAGCCCGGAGCT
hide sequence
RefSeq Acc Id:
NP_780295 ⟸ NM_175086
- UniProtKB:
P29755 (UniProtKB/Swiss-Prot), Q32MF7 (UniProtKB/TrEMBL), Q8BU69 (UniProtKB/TrEMBL)
- Sequence:
MILNSSIEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLKTVASVFLLNLALADLCFLLTLPLWAVYTAMEYQWPFGNHLCKIASASVSFNLYASVFLLTCLSIDRYL
hide sequence
Ensembl Acc Id:
ENSMUSP00000128724 ⟸ ENSMUST00000163776
Ensembl Acc Id:
ENSMUSP00000068298 ⟸ ENSMUST00000068316
RGD ID: 6880332 Promoter ID: EPDNEW_M3617 Type: multiple initiation site Name: Agtr1b_1 Description: Mus musculus angiotensin II receptor, type 1b , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 3 20,367,177 - 20,367,237 EPDNEW
