Advanced Search (OLGA)

Gene: Wnt2b (Wnt family member 2B) Rattus norvegicus

Analyze

Symbol:

Wnt2b

Name:

Wnt family member 2B

RGD ID:

69346

Description:

Predicted to enable cytokine activity and frizzled binding activity. Predicted to be involved in several processes, including chondrocyte differentiation; hematopoietic stem cell proliferation; and nervous system development. Predicted to act upstream of or within cellular response to starvation; mesenchymal-epithelial cell signaling; and regulation of morphogenesis of a branching structure. Predicted to be located in extracellular region. Predicted to be active in extracellular space. Human ortholog(s) of this gene implicated in congenital diarrhea. Orthologous to human WNT2B (Wnt family member 2B); PARTICIPATES IN Wnt signaling pathway; Wnt signaling, canonical pathway; basal cell carcinoma pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3,7-dihydropurine-6-thione; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

protein Wnt-2b; wingless related MMTV integration site 2b; wingless-type MMTV integration site 2B; wingless-type MMTV integration site family, member 2B

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	WNT2B (Wnt family member 2B)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Wnt2b (wingless-type MMTV integration site family, member 2B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Wnt2b (Wnt family member 2B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	WNT2B (Wnt family member 2B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	WNT2B (Wnt family member 2B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Wnt2b (Wnt family member 2B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	WNT2B (Wnt family member 2B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	WNT2B (Wnt family member 2B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Wnt2b (Wnt family member 2B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Wnt2b (Wnt family member 2B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	WNT2B (Wnt family member 2B)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Wnt2b (wingless-type MMTV integration site family, member 2B)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	wnt2bb (wingless-type MMTV integration site family, member 2Bb)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	wnt2ba (wingless-type MMTV integration site family, member 2Ba)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	cwn-1	Alliance	DIOPT (Ensembl Compara\|InParanoid\|SonicParanoid)
Caenorhabditis elegans (roundworm):	cwn-2	Alliance	DIOPT (Ensembl Compara\|OrthoInspector\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	wnt2b	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	wnt2b	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	195,142,573 - 195,156,945 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	195,135,176 - 195,157,144 (-)	Ensembl				GRCr8
mRatBN7.2	2	192,454,226 - 192,468,599 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	192,453,824 - 192,470,308 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	200,048,267 - 200,062,643 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	197,920,843 - 197,935,215 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	192,737,793 - 192,752,165 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	207,433,771 - 207,457,094 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	207,440,886 - 207,455,258 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	226,855,010 - 226,869,381 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	200,218,630 - 200,233,002 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	184,920,079 - 184,934,451 (-)	NCBI		Celera
RGSC_v3.1	2	200,181,392 - 200,189,478 (-)	NCBI
Cytogenetic Map	2	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Diarrhea 9 (ISO)

endodermal sinus tumor (ISO)

Failure to Thrive (ISO)

stroke (ISO)

teratoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

1,2-dichloroethane (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,4'-trichlorobiphenyl (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

3,7-dihydropurine-6-thione (EXP)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

antirheumatic drug (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

atrazine (ISO)

Azoxymethane (ISO)

benzo[a]pyrene (ISO)

beta-naphthoflavone (EXP)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

Bufotalin (ISO)

chlorpyrifos (EXP)

choline (ISO)

clofibrate (ISO)

decabromodiphenyl ether (ISO)

deguelin (ISO)

dextran sulfate (ISO)

diarsenic trioxide (ISO)

diazinon (EXP)

dieldrin (EXP)

diethylstilbestrol (ISO)

dorsomorphin (ISO)

entinostat (ISO)

flavonoids (EXP)

folic acid (ISO)

furan (EXP)

gentamycin (EXP)

hydroquinone (ISO)

L-methionine (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

mercaptopurine (EXP)

methotrexate (ISO)

methylmercury chloride (ISO)

N-nitrosodiethylamine (EXP)

nickel atom (EXP,ISO)

niclosamide (ISO)

paracetamol (EXP,ISO)

paraquat (EXP)

PCB138 (ISO)

phenylmercury acetate (ISO)

pioglitazone (ISO)

propanal (ISO)

purine-6-thiol (EXP)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

sotorasib (ISO)

Tetrachlorobisphenol A (ISO)

titanium dioxide (EXP,ISO)

trametinib (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

triptonide (ISO)

trovafloxacin (ISO)

valproic acid (ISO)

XL147 (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

animal organ development (IEA)

biological_process (ND)

canonical Wnt signaling pathway (IBA,IEA,ISO)

cell fate commitment (IBA)

cellular response to starvation (ISO)

chondrocyte differentiation (IEA,ISO)

forebrain regionalization (IEA,ISO)

hematopoietic stem cell proliferation (IEA,ISO)

lung induction (ISO)

male gonad development (IEA,ISO)

mesenchymal-epithelial cell signaling (ISO)

neuron differentiation (IBA)

positive regulation of branching involved in ureteric bud morphogenesis (ISO)

system development (IEA)

Wnt signaling pathway (IEA)

Cellular Component

extracellular region (IEA)

extracellular space (IBA)

Molecular Function

cytokine activity (IBA)

frizzled binding (IBA)

protein binding (ISO)

signaling receptor binding (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

basal cell carcinoma pathway (IEA)

Hedgehog signaling pathway (IEA)

Wnt signaling pathway (IEA,ISO)

Wnt signaling, canonical pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Activation of Wnt/beta-catenin signaling in distinct histologic subtypes of human germ cell tumors.	Fritsch MK, etal., Pediatr Dev Pathol. 2006 Mar-Apr;9(2):115-31. Epub 2006 Jun 16.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
7.	GOA pipeline	RGD automated data pipeline
8.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
10.	Comprehensive gene review and curation	RGD comprehensive gene curation
11.	Wnt signaling in the ovary: identification and compartmentalized expression of wnt-2, wnt-2b, and frizzled-4 mRNAs.	Ricken A, etal., Endocrinology 2002 Jul;143(7):2741-9.
12.	The Wnt Homepage	Roel Nusse - Howard Hughes Medical Institute and the Department of Developmental Biology at Stanford University, California, USA
13.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
14.	Alternative wnt signaling is initiated by distinct receptors.	van Amerongen R, etal., Sci Signal. 2008 Sep 2;1(35):re9.

Additional References at PubMed

PMID:9787155	PMID:11507767	PMID:11741304	PMID:15135146	PMID:15164427	PMID:17848411	PMID:19686689	PMID:23260145

Genomics

Comparative Map Data

Wnt2b
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	195,142,573 - 195,156,945 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	195,135,176 - 195,157,144 (-)	Ensembl				GRCr8
mRatBN7.2	2	192,454,226 - 192,468,599 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	192,453,824 - 192,470,308 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	200,048,267 - 200,062,643 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	197,920,843 - 197,935,215 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	192,737,793 - 192,752,165 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	207,433,771 - 207,457,094 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	207,440,886 - 207,455,258 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	226,855,010 - 226,869,381 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	200,218,630 - 200,233,002 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	184,920,079 - 184,934,451 (-)	NCBI		Celera
RGSC_v3.1	2	200,181,392 - 200,189,478 (-)	NCBI
Cytogenetic Map	2	q34	NCBI

WNT2B
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	112,466,541 - 112,530,165 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	112,466,541 - 112,530,165 (+)	Ensembl			hg38	GRCh38
GRCh37	1	113,009,163 - 113,072,787 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	112,811,563 - 112,865,428 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	1	112,763,907 - 112,775,947	NCBI
Celera	1	111,240,572 - 111,294,438 (+)	NCBI		Celera
Cytogenetic Map	1	p13.2	NCBI
HuRef	1	110,867,409 - 110,923,758 (+)	NCBI		HuRef
CHM1_1	1	113,124,865 - 113,178,745 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	112,479,107 - 112,542,734 (+)	NCBI		T2T-CHM13v2.0

Wnt2b
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	104,852,121 - 104,869,025 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	104,852,588 - 104,869,237 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	3	104,944,805 - 104,961,709 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	104,945,272 - 104,961,921 (-)	Ensembl			mm10	GRCm38
MGSCv37	3	104,747,723 - 104,764,627 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	3	105,072,861 - 105,089,765 (-)	NCBI		MGSCv36	mm8
Celera	3	107,140,519 - 107,157,750 (-)	NCBI		Celera
Cytogenetic Map	3	F2.2	NCBI
cM Map	3	45.88	NCBI

Wnt2b
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955435	15,948,262 - 15,962,958 (+)	Ensembl
ChiLan1.0	NW_004955435	15,948,262 - 15,962,958 (+)	NCBI	ChiLan1.0	ChiLan1.0

WNT2B
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	114,513,844 - 114,526,373 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	113,661,998 - 113,674,496 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	115,119,360 - 115,177,942 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	125,173,906 - 125,230,675 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	125,173,906 - 125,230,675 (-)	Ensembl			panPan2	panpan1.1

WNT2B
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	17	63,034,719 - 63,054,369 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	17	63,035,883 - 63,047,956 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	17	62,545,377 - 62,561,339 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	17	64,206,154 - 64,222,116 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	17	64,210,037 - 64,222,433 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	17	62,939,810 - 62,955,755 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	17	62,998,528 - 63,014,476 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	17	63,758,404 - 63,774,367 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Wnt2b
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	16,381,126 - 16,400,255 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936690	1,079,227 - 1,097,041 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936690	1,077,538 - 1,094,005 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

WNT2B
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	107,903,502 - 107,921,118 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	4	107,906,141 - 107,923,343 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	117,974,503 - 117,990,621 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

WNT2B
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	21,116,310 - 21,129,461 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	21,117,415 - 21,123,516 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666038	23,924,622 - 23,946,252 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Wnt2b
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624772	8,304,708 - 8,319,349 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624772	8,305,042 - 8,319,882 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Wnt2b
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	3	53,158,312 - 53,166,484 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Wnt2b
104 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	84
Count of miRNA genes:	71
Interacting mature miRNAs:	78
Transcripts:	ENSRNOT00000019349
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1358356	Srcrt1	Stress Responsive Cort QTL1	3.66		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	2	163997722	225110681	Rat
1578648	Bss11	Bone structure and strength QTL 11	4.7		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	2	169358774	214358774	Rat
1331734	Bp204	Blood pressure QTL 204	3.61192		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	170656145	239614549	Rat
631566	Bp90	Blood pressure QTL 90		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	149957381	221199885	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	44537979	205135428	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	67845370	229470703	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	83465462	229820014	Rat
10755499	Bp389	Blood pressure QTL 389	2.61		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	20695736	231474293	Rat
1298076	Bp166	Blood pressure QTL 166		0.0009	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	138595962	205135428	Rat
1581576	Pur7	Proteinuria QTL 7		0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	2	80396178	220931218	Rat
152025245	Scl81	Serum cholesterol level QTL 81	3.49		blood cholesterol amount (VT:0000180)		2	124537199	209621565	Rat
1581578	Cm49	Cardiac mass QTL 49	4.9	0.01	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	145807215	220931416	Rat
61458	Bp10	Blood pressure QTL 10	3.42		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	191709311	217961898	Rat
631198	Cm22	Cardiac mass QTL 22	4.3	0.0008	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	78269809	208420281	Rat
1554319	Bmd2	Bone mineral density QTL 2	13.4	0.0001	lumbar vertebra area (VT:0010570)	lumbar vertebra cross-sectional area (CMO:0001689)	2	122597372	215234002	Rat
12879836	Kidm61	Kidney mass QTL 61		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	154723085	199723085	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	80396178	220931218	Rat
12879837	Am2	Aortic mass QTL 2		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	2	154723085	199723085	Rat
10043139	Iddm55	Insulin dependent diabetes mellitus QTL 55	3.1	0.0001	blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	2	150313808	195313808	Rat
12879838	Cm86	Cardiac mass QTL 86		0.002	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	154723085	199723085	Rat
1302793	Bw16	Body weight QTL 16	5	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	2	159440891	205135267	Rat
12879839	Cm85	Cardiac mass QTL 85		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	2	154723085	199723085	Rat
1549833	Bp257	Blood pressure QTL 257		0.003	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	170652929	215652929	Rat
1358900	Bw48	Body weight QTL 48	4.88		body mass (VT:0001259)	body weight (CMO:0000012)	2	159440891	220931218	Rat
4889834	Pur24	Proteinuria QTL 24	5.8	0.014	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	2	171994826	205135428	Rat
1359031	Bp275	Blood pressure QTL 275			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	188565047	233565047	Rat
1581499	Esta2	Estrogen-induced thymic atrophy QTL 2			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	2	192287802	229609668	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	4265106	205135428	Rat
12879840	Bw179	Body weight QTL 179		0.005	body mass (VT:0001259)	body weight (CMO:0000012)	2	154723085	199723085	Rat
9589044	Scfw1	Subcutaneous fat weight QTL 1	5.8	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	2	184856304	229856304	Rat
8694435	Bw166	Body weight QTL 166	14.08	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	2	184856304	229856304	Rat
1359032	Hrtrt18	Heart rate QTL 18			heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	2	159440760	195313808	Rat
2301966	Bp322	Blood pressure QTL 322	3.58		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	144882354	205135428	Rat
1298083	Bp158	Blood pressure QTL 158	2.62		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	191709311	217961898	Rat
1298080	Bp163	Blood pressure QTL 163		0.02	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	67845182	205135428	Rat
1357991	Ael2	Aortic elastin QTL 2	4.2	0.000071	aorta elastin amount (VT:0003905)	aortic elastin	2	169227906	214227906	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	83400752	223709938	Rat
1331745	Bp203	Blood pressure QTL 203	4.377		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	192287802	221089121	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	44537979	205135428	Rat
8694194	Abfw1	Abdominal fat weight QTL 1	11.7	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	2	184856304	229856304	Rat
61366	Iddm3	Insulin dependent diabetes mellitus QTL 3	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	192287802	237287802	Rat
1578671	Bmd10	Bone mineral density QTL 10	5.4		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	2	175931416	220931416	Rat
1641891	Alcrsp17	Alcohol response QTL 17			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	151869660	251712708	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	80396034	220931416	Rat
61374	Edpm2	Estrogen-dependent pituitary mass QTL 2	4.42	0.86	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	78269809	205135428	Rat
2300189	Bmd48	Bone mineral density QTL 48	5.8	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	2	182024327	227024327	Rat
8662843	Vetf9	Vascular elastic tissue fragility QTL 9	2.05		thoracic aorta molecular composition trait (VT:0010568)	aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003)	2	159440760	228950743	Rat
2301408	Kidm36	Kidney mass QTL 36		0.002	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	184482291	229482291	Rat
1331794	Bp202	Blood pressure QTL 202	3.66819		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	143344967	251712708	Rat
71113	Cari2	Carrageenan-induced inflammation QTL 2	2.7	0.009	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	2	143746578	205135428	Rat
1331805	Cm29	Cardiac mass QTL 29	3.50746		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	2	143344967	251712708	Rat
634308	Sach6	Saccharin preference QTL 6	4.9		taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	2	114384617	215381366	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	206613235	Rat
724568	Uae13	Urinary albumin excretion QTL 13	4.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	2	145306936	212705578	Rat
7488929	Bp366	Blood pressure QTL 366		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	187663373	195783351	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	206613235	Rat
1300165	Rf9	Renal function QTL 9	3.28		kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	2	113746222	205135428	Rat
738013	Alc15	Alcohol consumption QTL 15	4.1	0.00022	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	2	186850607	231850607	Rat
61398	Bp50	Blood pressure QTL 50	4.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	192287802	237287802	Rat
631507	Bp105	Blood pressure QTL 105		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	114384617	215381366	Rat
1641925	Alcrsp2	Alcohol response QTL 2			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	151869660	223841096	Rat
1354609	Niddm62	Non-insulin dependent diabetes mellitus QTL 62	4.72	0.000006	insulin secretion trait (VT:0003564)	plasma insulin level (CMO:0000342)	2	117415288	205135428	Rat
61417	Cia10	Collagen induced arthritis QTL 10	3.4		joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	2	182635347	227635347	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	83465462	225110681	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	47856345	205135428	Rat
631522	Bp74	Blood pressure QTL 74		0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	175008837	220008837	Rat
8694383	Bw158	Body weight QTL 158	7.69	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	2	184856304	229856304	Rat
7488927	Bp365	Blood pressure QTL 365		0.008	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	165453811	210453811	Rat
7488925	Bp364	Blood pressure QTL 364		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	163253030	208253030	Rat
2306901	Bp337	Blood pressure QTL 337		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	166372086	229820014	Rat
1354605	Rf48	Renal function QTL 48	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	2	76328396	209350714	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
15	12	67	139	86	85	54	54	54	6	295	149	5	122	69	90	31	12	12

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001191848	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017590582	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC106372	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF204873	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474015	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000019349 ⟹ ENSRNOP00000019349

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	195,142,170 - 195,157,144 (-)	Ensembl
mRatBN7.2 Ensembl	2	192,454,226 - 192,470,308 (-)	Ensembl
Rnor_6.0 Ensembl	2	207,440,886 - 207,455,258 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000115886 ⟹ ENSRNOP00000087654

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	195,135,176 - 195,157,144 (-)	Ensembl
mRatBN7.2 Ensembl	2	192,453,824 - 192,469,276 (-)	Ensembl

RefSeq Acc Id:

NM_001191848 ⟹ NP_001178777

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	195,142,573 - 195,156,945 (-)	NCBI
mRatBN7.2	2	192,454,226 - 192,468,599 (-)	NCBI
Rnor_6.0	2	207,440,886 - 207,455,258 (-)	NCBI
Rnor_5.0	2	226,855,010 - 226,869,381 (-)	NCBI
Celera	2	184,920,079 - 184,934,451 (-)	NCBI

Sequence:

show sequence

ATGCTGAAGCCGCGGGGTGAGGACGAAGCCGCGCAGCTCGCCCCTCGGCGTGCCCGCGTCCCGG
TCGCCGCGTTAAGACCCGCGCCCCCCGACGTGTCCCCAGCTTCTGCCCGTCTGGGTCTTGCCTG
TCTGCTGCTGCTGCTGCTTCTGACTCTGCCGGCCCGTGTAGACACGTCCTGGTGGTACATAGGG
GCACTGGGAGCCCGAGTGATCTGTGACAACATCCCGGGTCTGGTGAGCCGGCAGCGGCAGCTGT
GTCAGCGCTACCCAGACATCATGCGCTCAGTAGGAGAAGGTGCCCGGGAATGGATCCGAGAGTG
TCAACACCAGTTCCGTCATCACCGCTGGAATTGCACCACACTGGACCGGGACCACACTGTCTTT
GGCCGTGCTATGCTCAGAAGCAGTCGGGAGGCAGCGTTTGTCTATGCTATCTCATCAGCAGGAG
TGGTCCATGCTATCACTCGGGCCTGCAGCCAGGGTGAGCTGAGTGTGTGCAGCTGTGACCCATA
TACCCGTGGTCGGCACCATGATCAACGAGGGGACTTTGACTGGGGTGGCTGTAGTGACAACATC
CACTATGGTGTCCGCTTTGCCAAGGCTTTTGTGGATGCCAAAGAGAAGAGGCTTAAGGATGCCC
GGGCCCTCATGAACTTACATAACAACCGCTGCGGTCGCACGGCTGTACGGCGATTTCTGAAGCT
GGAGTGCAAGTGTCATGGTGTGAGTGGCTCCTGTACCCTGCGCACCTGCTGGAGGGCACTCTCA
GACTTCCGCCGTACCGGTGACTACCTGAGGAGGCGATATGATGGGGCTGTGCAGGTGACAGCCA
CACAGGATGGGGCCAACTTCACAGCAGCCCGCCAAGGCTATCGCCATGCCACCCGGACTGATCT
TGTCTACTTTGACAACTCCCCTGACTACTGTGTCTTGGACAAGGCTGCAGGTTCCCTAGGTACC
GCAGGCCGCGTCTGCAGCAAGACTTCTAAAGGAACAGATGGGTGTGAAATCATGTGTTGCGGCC
GAGGATATGACACAACTCGGGTCACCCGGGTCACCCAGTGTGAGTGCAAATTCCACTGGTGCTG
TGCTGTGCGGTGCAAGGAGTGCAGAAACACTGTGGATGTCCACACGTGCAAGGCCCCTAAGAAG
GCAGAGTGGCTGGACCAGACCTGAACACACAGATACCTCATTCTTCCCTCTACTTCAAGCCTCT
GACTCAAAAGCACAAGATCCTTGCATGCACACCTTCCTCCACCCTCAATCCTGGGCTGCTACAG
CTTCTGTTATGGACTTGGAGAATGACCCAGAGGGACCCCAATGTCCTGGCTGGTTCCTTAGCCC
TAGAGAGGTGTTGATAGGGGATGGATATAGGAGACTGAGTGGCTCCCTGATCATCCATCTGGAG
GTTTGAAGGGAAGAGTAGAAGAGGTAGGAGTCTGTCTTCAGAGTGATCTGAGTTGCACTAAGTC
AAGGCCCATTCTCCCCTTGCTTGCACTGACTTCTGGTCCTCTTGCACACTTGGGTATGCAACAG
GAAGGGAACCGGAGGTAGCTTCTGTGTTTGATCCTACTCTACCTAAGGAGAGATAAGACAGAGA
GAAAACTGCCTGTCCCTTCACTGCAGACAATCTTAGGCTATAGTACTCTGCTGAGACCCTGAGA
CAGCTAGATGAGTTAGCCACAGTGAACAAGGCTCCACCTCAGGCTTTTAATGCAGCTTATAATC
TAGTGGTTTTGTGAGGAGGAAAATCACAATACTGTTCAGATACATA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001178777	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAF18104	(Get FASTA)	NCBI Sequence Viewer
	EDL85447	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000019349
	ENSRNOP00000019349.3
	ENSRNOP00000087654.2

RefSeq Acc Id:

NP_001178777 ⟸ NM_001191848

- UniProtKB:

G3V7U3 (UniProtKB/TrEMBL), A6K3Q3 (UniProtKB/TrEMBL), A0A8I6A874 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MLKPRGEDEAAQLAPRRARVPVAALRPAPPDVSPASARLGLACLLLLLLLTLPARVDTSWWYIG
ALGARVICDNIPGLVSRQRQLCQRYPDIMRSVGEGAREWIRECQHQFRHHRWNCTTLDRDHTVF
GRAMLRSSREAAFVYAISSAGVVHAITRACSQGELSVCSCDPYTRGRHHDQRGDFDWGGCSDNI
HYGVRFAKAFVDAKEKRLKDARALMNLHNNRCGRTAVRRFLKLECKCHGVSGSCTLRTCWRALS
DFRRTGDYLRRRYDGAVQVTATQDGANFTAARQGYRHATRTDLVYFDNSPDYCVLDKAAGSLGT
AGRVCSKTSKGTDGCEIMCCGRGYDTTRVTRVTQCECKFHWCCAVRCKECRNTVDVHTCKAPKK
AEWLDQT

hide sequence

Ensembl Acc Id:

ENSRNOP00000019349 ⟸ ENSRNOT00000019349

Ensembl Acc Id:

ENSRNOP00000087654 ⟸ ENSRNOT00000115886

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-G3V7U3-F1-model_v2	AlphaFold	G3V7U3	1-391	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:69346	AgrOrtholog
BioCyc Gene	G2FUF-51757	BioCyc
Ensembl Genes	ENSRNOG00000014385	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000019349	ENTREZGENE
	ENSRNOT00000019349.6	UniProtKB/TrEMBL
	ENSRNOT00000115886.2	UniProtKB/TrEMBL
Gene3D-CATH	3.30.2460.20	UniProtKB/TrEMBL
InterPro	Wnt	UniProtKB/TrEMBL
	Wnt2	UniProtKB/TrEMBL
	Wnt_C	UniProtKB/TrEMBL
	Wnt_grthfactor_CS	UniProtKB/TrEMBL
KEGG Report	rno:116466	UniProtKB/TrEMBL
NCBI Gene	116466	ENTREZGENE
PANTHER	PROTEIN WNT-2B	UniProtKB/TrEMBL
	Wnt	UniProtKB/TrEMBL
Pfam	wnt	UniProtKB/TrEMBL
PhenoGen	Wnt2b	PhenoGen
PRINTS	WNT2PROTEIN	UniProtKB/TrEMBL
	WNTPROTEIN	UniProtKB/TrEMBL
PROSITE	WNT1	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000014385	RatGTEx
SMART	WNT1	UniProtKB/TrEMBL
TIGR	TC233164
UniProt	A0A8I6A874	ENTREZGENE, UniProtKB/TrEMBL
	A6K3Q3	ENTREZGENE, UniProtKB/TrEMBL
	G3V7U3	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-03-29	Wnt2b	Wnt family member 2B	Wnt2b	wingless-type MMTV integration site family, member 2B	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-11-14	Wnt2b	wingless-type MMTV integration site family, member 2B	Wnt2b	wingless related MMTV integration site 2b	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-02-18	Wnt2b	wingless related MMTV integration site 2b	Wnt2b	wingless-type MMTV integration site family, member 2B	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2003-04-09	Wnt2b	wingless-type MMTV integration site family, member 2B		wingless-type MMTV integration site 2B	Name updated	629478	APPROVED
2002-06-10	Wnt2b	wingless-type MMTV integration site 2B			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed in ovarian surface epithelium	634517

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)