Cd2 (Cd2 molecule) - Rat Genome Database

Name: Cd2
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Cd2 (Cd2 molecule) Rattus norvegicus

Analyze

Symbol:

Cd2

Name:

Cd2 molecule

RGD ID:

2297

Description:

Enables identical protein binding activity; protein self-association; and receptor tyrosine kinase binding activity. Involved in cell-cell adhesion. Located in cell surface. Part of protein-containing complex. Orthologous to human CD2 (CD2 molecule); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; acetamide; ammonium chloride.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

CD2 antigen; CD2R; LFA-2; LFA-3 receptor; LFA2; OX-34; OX-34 antigen; OX-45 surface antigen homolog to human T lymphocyte CD2 antigen; OX-45 surface antigen, homolog to human T lymphocyte CD2 antigen; OX34; T-cell surface antigen CD2; T-cell surface antigen T11/Leu-5

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CD2 (CD2 molecule)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther
Mus musculus (house mouse):	Cd2 (CD2 antigen)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Cd2 (CD2 molecule)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CD2 (CD2 molecule)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CD2 (CD2 molecule)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Cd2 (CD2 molecule)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CD2 (CD2 molecule)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CD2 (CD2 molecule)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Cd2 (CD2 molecule)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Cd2 (CD2 antigen)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	CD2 (CD2 molecule)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	si:dkey-11f4.20	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)

Candidate Gene For:

Cia10

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	191,399,510 - 191,412,659 (-)	NCBI		GRCr8
mRatBN7.2	2	188,710,895 - 188,724,044 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	188,710,900 - 188,724,026 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	196,344,644 - 196,357,772 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	194,196,679 - 194,209,718 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	189,021,373 - 189,034,432 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	203,666,706 - 203,680,073 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	203,666,637 - 203,680,083 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	223,111,198 - 223,124,565 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	196,332,547 - 196,346,221 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	196,295,300 - 196,660,648 (-)	NCBI
Celera	2	181,149,611 - 181,162,644 (-)	NCBI		Celera
Cytogenetic Map	2	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

nephrotic syndrome (ISO)

prostate cancer (ISO)

rheumatoid arthritis (ISO)

thrombosis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

3,3',5,5'-tetrabromobisphenol A (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

acetamide (EXP)

aflatoxin B1 (ISO)

ammonium chloride (EXP)

amphotericin B (ISO)

antirheumatic drug (ISO)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bleomycin A2 (ISO)

buta-1,3-diene (ISO)

carbon nanotube (ISO)

chloroprene (ISO)

clofibrate (ISO)

cyclophosphamide (ISO)

dexamethasone (ISO)

dimethylarsinic acid (EXP,ISO)

dioxygen (ISO)

disodium selenite (ISO)

ferroheme b (ISO)

flavonoids (EXP)

formaldehyde (ISO)

genistein (ISO)

gentamycin (EXP)

graphite (EXP)

heme b (ISO)

isotretinoin (ISO)

methotrexate (ISO)

methylarsonic acid (ISO)

N-(6-acetamidohexyl)acetamide (ISO)

nickel atom (ISO)

ozone (ISO)

paracetamol (ISO)

pirinixic acid (ISO)

silicon dioxide (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

tacrolimus hydrate (ISO)

temozolomide (ISO)

titanium dioxide (ISO)

trimellitic anhydride (ISO)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell-cell adhesion (IBA,IMP)

heterotypic cell-cell adhesion (ISO)

natural killer cell activation (ISO)

natural killer cell mediated cytotoxicity (ISO)

positive regulation of interleukin-8 production (ISO)

positive regulation of tumor necrosis factor production (ISO)

positive regulation of type II interferon production (IBA,ISO)

Cellular Component

cell surface (IDA,ISO)

cell-cell junction (ISO)

cytoplasmic side of plasma membrane (ISO)

external side of plasma membrane (ISO)

extracellular region (ISO)

Golgi apparatus (IEA,ISO)

nucleoplasm (IEA,ISO)

plasma membrane (ISO)

protein-containing complex (IDA)

Molecular Function

identical protein binding (IPI,ISO)

protein binding (IPI,ISO)

protein kinase binding (IPI)

receptor tyrosine kinase binding (IPI)

signaling receptor binding (IBA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	The SH3 domain of p56lck binds to proline-rich sequences in the cytoplasmic domain of CD2.	Bell GM, etal., J Exp Med. 1996 Jan 1;183(1):169-78.
2.	Association of Src-like protein tyrosine kinases with the CD2 cell surface molecule in rat T lymphocytes and natural killer cells.	Bell GM, etal., Mol Cell Biol. 1992 Dec;12(12):5548-54.
3.	CD2 physically associates with CD5 in rat T lymphocytes with the involvement of both extracellular and intracellular domains.	Castro MA, etal., Eur J Immunol 2002 May;32(5):1509-18.
4.	Determination of pK(a) values of carboxyl groups in the N-terminal domain of rat CD2: anomalous pK(a) of a glutamate on the ligand-binding surface.	Chen HA, etal., Biochemistry. 2000 Jun 13;39(23):6814-24.
5.	The role of charged residues mediating low affinity protein-protein recognition at the cell surface by CD2.	Davis SJ, etal., Proc Natl Acad Sci U S A. 1998 May 12;95(10):5490-4.
6.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
7.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
8.	Mapping autoimmunity genes.	Griffiths MM, etal., Curr Opin Immunol. 1999 Dec;11(6):689-700.
9.	Identification of a new non-major histocompatibility complex genetic locus on chromosome 2 that controls disease severity in collagen-induced arthritis in rats.	Gulko PS, etal., Arthritis Rheum 1998 Dec;41(12):2122-31
10.	The role of adhesion molecules in the recruitment of hepatic natural killer cells (pit cells) in rat liver.	Luo D, etal., Hepatology. 1996 Dec;24(6):1475-80.
11.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
12.	Better-surviving liver grafts by the injection of anti-CD2 antibody: the important roles of host CD8+ and CD2+CD28+ T cells in chronic graft rejection and beta type platelet-derived growth factor receptor (PDGFR-beta) expression on apoptotic liver grafts.	Nakatsuji T Tohoku J Exp Med. 1999 Mar;187(3):215-25.
13.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
14.	Protein interactions between CD2 and Lck are required for the lipid raft distribution of CD2.	Nunes RJ, etal., J Immunol. 2008 Jan 15;180(2):988-97.
15.	NMR exchange broadening arising from specific low affinity protein self-association: analysis of nitrogen-15 nuclear relaxation for rat CD2 domain 1.	Pfuhl M, etal., J Biomol NMR. 1999 Aug;14(4):307-20.
16.	GOA pipeline	RGD automated data pipeline
17.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
18.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
19.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
20.	Localization in rats of genetic loci regulating susceptibility to experimental erosive arthritis and related autoimmune diseases.	Wilder RL, etal., Transplant Proc 1999 May;31(3):1585-8
21.	Similarities in sequences and cellular expression between rat CD2 and CD4 antigens.	Williams AF, etal., J Exp Med 1987 Feb 1;165(2):368-80.
22.	Temperature-induced formation of a non-native intermediate state of the all beta-sheet protein CD2.	Yang JJ, etal., Cell Biochem Biophys 2002;36(1):1-18.

Additional References at PubMed

PMID:1383383	PMID:8125140	PMID:12369898	PMID:12477932	PMID:12874832	PMID:15233784	PMID:15345303	PMID:15946251	PMID:16803907	PMID:17344209	PMID:19109405	PMID:19811406
PMID:21460847	PMID:23793062	PMID:32213736

Genomics

Comparative Map Data

Cd2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	191,399,510 - 191,412,659 (-)	NCBI		GRCr8
mRatBN7.2	2	188,710,895 - 188,724,044 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	188,710,900 - 188,724,026 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	196,344,644 - 196,357,772 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	194,196,679 - 194,209,718 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	189,021,373 - 189,034,432 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	203,666,706 - 203,680,073 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	203,666,637 - 203,680,083 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	223,111,198 - 223,124,565 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	196,332,547 - 196,346,221 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	196,295,300 - 196,660,648 (-)	NCBI
Celera	2	181,149,611 - 181,162,644 (-)	NCBI		Celera
Cytogenetic Map	2	q34	NCBI

CD2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	116,754,430 - 116,769,229 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	116,754,430 - 116,769,229 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	117,297,052 - 117,311,851 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	117,098,609 - 117,113,374 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	117,009,143 - 117,023,892	NCBI
Celera	1	115,525,598 - 115,540,363 (+)	NCBI		Celera
Cytogenetic Map	1	p13.1	NCBI
HuRef	1	115,156,224 - 115,170,989 (+)	NCBI		HuRef
CHM1_1	1	117,411,979 - 117,426,744 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	116,764,873 - 116,779,672 (+)	NCBI		T2T-CHM13v2.0

Cd2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	101,183,224 - 101,195,255 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	101,183,215 - 101,195,255 (-)	Ensembl		GRCm39 Ensembl
GRCm38	3	101,275,908 - 101,287,939 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	101,275,899 - 101,287,939 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	3	101,079,831 - 101,091,862 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	3	101,404,969 - 101,417,000 (-)	NCBI		MGSCv36	mm8
Celera	3	103,490,645 - 103,502,693 (-)	NCBI		Celera
Cytogenetic Map	3	F2.2	NCBI
cM Map	3	44.17	NCBI

Cd2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955435	19,861,527 - 19,873,581 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955435	19,861,658 - 19,876,383 (+)	NCBI	ChiLan1.0	ChiLan1.0

CD2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	109,406,383 - 109,421,268 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	109,005,949 - 109,020,747 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	85,752,522 - 85,767,323 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	120,749,918 - 120,764,664 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	120,749,918 - 120,764,659 (-)	Ensembl	panpan1.1		panPan2

CD2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	17	54,171,764 - 54,184,221 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	17	54,171,848 - 54,184,225 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	17	53,818,723 - 53,831,191 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	17	55,052,775 - 55,065,243 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	17	55,052,794 - 55,065,240 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	17	54,089,963 - 54,102,397 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	17	54,126,006 - 54,138,470 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	17	54,699,355 - 54,711,821 (+)	NCBI		UU_Cfam_GSD_1.0

Cd2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	12,573,676 - 12,586,886 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936627	1,902,120 - 1,915,257 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936627	1,902,120 - 1,915,257 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CD2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	103,963,345 - 103,977,292 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	4	103,963,802 - 103,976,971 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	113,928,523 - 113,941,699 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CD2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	16,954,925 - 16,970,066 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	16,953,811 - 16,970,044 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	19,634,620 - 19,649,798 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cd2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624772	12,433,796 - 12,444,740 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624772	12,428,885 - 12,445,003 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Cd2
151 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	85
Count of miRNA genes:	73
Interacting mature miRNAs:	79
Transcripts:	ENSRNOT00000021268
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	43154682	202446871	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	43154682	202446871	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	46123260	202447032	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	56043031	202447032	Rat
1298080	Bp163	Blood pressure QTL 163		0.02	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118275	202447032	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118463	226797303	Rat
1354605	Rf48	Renal function QTL 48	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	2	74786664	206665859	Rat
61374	Edpm2	Estrogen-dependent pituitary mass QTL 2	4.42	0.86	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	76539322	202447032	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	78665619	219826953	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	78665619	249053267	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	81689826	221035911	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	81754530	222436696	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	81754530	227146641	Rat
631507	Bp105	Blood pressure QTL 105		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	112456140	212696837	Rat
634308	Sach6	Saccharin preference QTL 6	4.9		taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	2	112456140	212696837	Rat
1578648	Bss11	Bone structure and strength QTL 11	4.7		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	2	114837527	211674221	Rat
1554319	Bmd2	Bone mineral density QTL 2	13.4	0.0001	lumbar vertebra area (VT:0010570)	lumbar vertebra cross-sectional area (CMO:0001689)	2	114837675	212549332	Rat
1300165	Rf9	Renal function QTL 9	3.28		kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	2	133914684	202447032	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	135552573	202446871	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	135552573	202446871	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	135552573	202446871	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	2	135552573	202446871	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	2	135552573	202446871	Rat
1298076	Bp166	Blood pressure QTL 166		0.0009	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	136445150	202447032	Rat
1581502	Esta3	Estrogen-induced thymic atrophy QTL 3			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	2	136916935	189599348	Rat
1359022	Ppulsi1	Prepulse inhibition QTL 1	3.63		prepulse inhibition trait (VT:0003088)	acoustic startle response measurement (CMO:0001519)	2	136916935	213594495	Rat
1331794	Bp202	Blood pressure QTL 202	3.66819		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	141194931	223265385	Rat
1331805	Cm29	Cardiac mass QTL 29	3.50746		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	2	141194931	223265385	Rat
71113	Cari2	Carrageenan-induced inflammation QTL 2	2.7	0.009	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	2	141596551	202447032	Rat
724568	Uae13	Urinary albumin excretion QTL 13	4.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	2	143157029	210020885	Rat
10043136	Iddm54	Insulin dependent diabetes mellitus QTL 54	3.4	0.0001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	143657411	190602963	Rat
10043136	Iddm54	Insulin dependent diabetes mellitus QTL 54	3.4	0.0001	blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	2	143657411	190602963	Rat
61401	Niddm2	Non-insulin dependent diabetes mellitus QTL 2	4.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	144599348	189599348	Rat
1598833	Bp295	Blood pressure QTL 295	3.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	147798556	192798556	Rat
1641925	Alcrsp2	Alcohol response QTL 2			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	221167075	Rat
1641891	Alcrsp17	Alcohol response QTL 17			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	249053267	Rat
1598805	Memor8	Memory QTL 8	3		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	2	150341585	189039377	Rat
631501	Bp101	Blood pressure QTL 101	2.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	150341684	202446871	Rat
2301966	Bp322	Blood pressure QTL 322	3.58		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	150540301	202447032	Rat
1354609	Niddm62	Non-insulin dependent diabetes mellitus QTL 62	4.72	0.000006	insulin secretion trait (VT:0003564)	plasma insulin level (CMO:0000342)	2	150540301	202447032	Rat
1359032	Hrtrt18	Heart rate QTL 18			heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	2	157142078	192625452	Rat
1358900	Bw48	Body weight QTL 48	4.88		body mass (VT:0001259)	body weight (CMO:0000012)	2	157142078	211086598	Rat
8662843	Vetf9	Vascular elastic tissue fragility QTL 9	2.05		thoracic aorta molecular composition trait (VT:0010568)	aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003)	2	157142078	226277316	Rat
1302793	Bw16	Body weight QTL 16	5	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	2	157142209	202446871	Rat
7488925	Bp364	Blood pressure QTL 364		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	160564068	205564068	Rat
1358356	Srcrt1	Stress Responsive Cort QTL1	3.66		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	2	161699179	222436696	Rat
7488927	Bp365	Blood pressure QTL 365		0.008	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	162765032	207765032	Rat
2306901	Bp337	Blood pressure QTL 337		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	164073756	227146641	Rat
1598838	Bp290	Blood pressure QTL 290	1.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	166539266	211539266	Rat
1331734	Bp204	Blood pressure QTL 204	3.61192		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	168358098	223265385	Rat
2307174	Activ3	Activity QTL 3	4.83	0.000058	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	2	168594495	213594495	Rat
61469	Bp16	Blood pressure QTL 16	5.64		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	2	169745596	214745596	Rat
70162	Bp63	Blood pressure QTL 63	5.64		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	2	169745596	214745596	Rat
2293084	Iddm26	Insulin dependent diabetes mellitus QTL 26	2.9		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	174930955	213594495	Rat
2300189	Bmd48	Bone mineral density QTL 48	5.8	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	2	179335906	224335906	Rat
61417	Cia10	Collagen induced arthritis QTL 10	3.4		joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	2	179946951	224946951	Rat
8694435	Bw166	Body weight QTL 166	14.08	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	2	182171407	227171407	Rat
9589044	Scfw1	Subcutaneous fat weight QTL 1	5.8	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	2	182171407	227171407	Rat
8694383	Bw158	Body weight QTL 158	7.69	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	2	182171407	227171407	Rat
8694194	Abfw1	Abdominal fat weight QTL 1	11.7	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	2	182171407	227171407	Rat
4889834	Pur24	Proteinuria QTL 24	5.8	0.014	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	2	184114274	202447032	Rat
738013	Alc15	Alcohol consumption QTL 15	4.1	0.00022	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	2	184165752	229165752	Rat
7488929	Bp366	Blood pressure QTL 366		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	184974550	193094998	Rat
1359031	Bp275	Blood pressure QTL 275			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	185876309	219753474	Rat
1359031	Bp275	Blood pressure QTL 275			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	185876309	219753474	Rat

Markers in Region

UniSTS:141273

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	188,710,902 - 188,711,043 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	203,666,709 - 203,666,849	NCBI	Rnor6.0
Rnor_5.0	2	223,111,201 - 223,111,341	UniSTS	Rnor5.0
RGSC_v3.4	2	196,332,550 - 196,332,690	UniSTS	RGSC3.4
Celera	2	181,149,614 - 181,149,754	UniSTS
Cytogenetic Map	2	q34	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	2		8		19							5
Low	1	14	14	8		8	5	6	7	16	19	6	5
Below cutoff		23	27	25		25	3	5	35	11	11		3

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_012830	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC088164	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000021268 ⟹ ENSRNOP00000021268

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	188,710,900 - 188,724,026 (-)	Ensembl
Rnor_6.0 Ensembl	2	203,666,637 - 203,680,083 (-)	Ensembl

RefSeq Acc Id:

NM_012830 ⟹ NP_036962

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	191,399,510 - 191,412,659 (-)	NCBI
mRatBN7.2	2	188,710,895 - 188,724,044 (-)	NCBI
Rnor_6.0	2	203,666,706 - 203,680,073 (-)	NCBI
Rnor_5.0	2	223,111,198 - 223,124,565 (-)	NCBI
RGSC_v3.4	2	196,332,547 - 196,346,221 (-)	RGD
Celera	2	181,149,611 - 181,162,644 (-)	RGD

Sequence:

show sequence

GGCCAAGGAGGAAGACAGAACAGAAGGTGAGGGAACACAGCCCTGGCAGAAAGAAGAACTCAGA
GCCACCACTGGGAAAAGAATGTAAAGATGAGATGTAAATTCCTAGGGAGTTTCTTTCTGCTCTT
CAGCCTGTCCAGCAAAGGAGCAGACTGCAGAGACAGTGGGACCGTCTGGGGTGCCCTGGGTCAT
GGCATCAACCTGAACATCCCTAACTTTCAAATGACTGATGATATTGATGAGGTGCGATGGGAGA
GGGGGAGCACCCTGGTTGCCGAGTTTAAAAGGAAGATGAAGCCTTTTTTGAAATCGGGAGCATT
TGAGATCTTAGCAAATGGAGACTTGAAGATAAAGAATCTGACAAGAGATGACAGTGGCACCTAT
AATGTAACGGTATACAGCACAAATGGGACACGTATCCTGGACAAGGCACTGGACTTGAGGATTC
TAGAGATGGTCTCAAAGCCGATGATCTACTGGGAGTGCAGCAACGCAACCCTGACCTGTGAGGT
CTTGGAAGGAACAGATGTTGAACTAAAGCTGTACCAAGGAAAGGAGCATCTCAGGAGCCTCCGT
CAGAAGACCATGAGTTACCAGTGGACCAACCTGAGAGCACCGTTTAAGTGCAAGGCGGTAAACA
GGGTCAGCCAGGAGTCTGAGATGGAAGTTGTCAACTGTCCAGAGAAAGGTCTGCCCCTCTATCT
CATAGTGGGGGTCAGTGCAGGAGGACTCCTCTTGGTGTTCTTTGGGGCGCTGTTTATTTTCTGT
ATCTGCAAGAGGAAAAAACGGAACAGGAGGAGAAAAGGTGAAGAGCTGGAGATAAAAGCTTCCA
GAATGAGCACTGTGGAAAGGGGACCCAAGCCACACTCAACCCAGGCCTCAGCACCAGCATCACA
GAATCCAGTGGCTTCCCAAGCTCCTCCTCCACCTGGCCATCATCTCCAGACACCTGGCCATCGT
CCCCTGCCTCCAAGCCACCGTAACCGTGAGCACCAGCCGAAGAAGAGACCTCCTCCATCAGGCA
CACAGGTTCACCAGCAGAAAGGCCCTCCTTTGCCCAGACCCCGAGTTCAGCCAAAGCCTCCCTG
TGGGAGTGGAGATGTTTCGTTGCCACCCCCTAATTAAAAAGGCAGAATCTGCCATTTCCAATAA
AAAGCTGTGTGGATAT

hide sequence

Protein Sequences


Protein RefSeqs	NP_036962	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH88164	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000021268
	ENSRNOP00000021268.6
	ENSRNOP00055027276
	ENSRNOP00060017024
	ENSRNOP00065045983
GenBank Protein	P08921	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_036962 ⟸ NM_012830
- Peptide Label:	precursor
- UniProtKB:	Q5I0M6 (UniProtKB/Swiss-Prot), P08921 (UniProtKB/Swiss-Prot), F1M9W7 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MRCKFLGSFFLLFSLSSKGADCRDSGTVWGALGHGINLNIPNFQMTDDIDEVRWERGSTLVAEF KRKMKPFLKSGAFEILANGDLKIKNLTRDDSGTYNVTVYSTNGTRILDKALDLRILEMVSKPMI YWECSNATLTCEVLEGTDVELKLYQGKEHLRSLRQKTMSYQWTNLRAPFKCKAVNRVSQESEME VVNCPEKGLPLYLIVGVSAGGLLLVFFGALFIFCICKRKKRNRRRKGEELEIKASRMSTVERGP KPHSTQASAPASQNPVASQAPPPPGHHLQTPGHRPLPPSHRNREHQPKKRPPPSGTQVHQQKGP PLPRPRVQPKPPCGSGDVSLPPPN hide sequence

RefSeq Acc Id:

ENSRNOP00000021268 ⟸ ENSRNOT00000021268

Protein Domains

Ig-like C2-type Ig-like V-type

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P08921-F1-model_v2	AlphaFold	P08921	1-344	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13691613

Promoter ID:

EPDNEW_R2138

Type:

multiple initiation site

Name:

Cd2_1

Description:

Cd2 molecule

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	2	203,680,079 - 203,680,139	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2297	AgrOrtholog
BioCyc Gene	G2FUF-51853	BioCyc
Ensembl Genes	ENSRNOG00000015821	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOG00055019708	UniProtKB/Swiss-Prot
	ENSRNOG00060012683	UniProtKB/Swiss-Prot
	ENSRNOG00065032445	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000021268	ENTREZGENE
	ENSRNOT00000021268.8	UniProtKB/Swiss-Prot
	ENSRNOT00055033626	UniProtKB/Swiss-Prot
	ENSRNOT00060021542	UniProtKB/Swiss-Prot
	ENSRNOT00065055828	UniProtKB/Swiss-Prot
Gene3D-CATH	2.60.40.10	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7374969	IMAGE-MGC_LOAD
InterPro	CD2	UniProtKB/Swiss-Prot
	Ig-like_dom_sf	UniProtKB/Swiss-Prot
	Ig-like_fold	UniProtKB/Swiss-Prot
	Ig_C2-set	UniProtKB/Swiss-Prot
	Ig_V-set	UniProtKB/Swiss-Prot
KEGG Report	rno:497761	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:108759	IMAGE-MGC_LOAD
NCBI Gene	Cd2	ENTREZGENE
PANTHER	SIGNALING LYMPHOCYTIC ACTIVATION MOLECULE	UniProtKB/Swiss-Prot
	T-CELL SURFACE ANTIGEN CD2	UniProtKB/Swiss-Prot
Pfam	C2-set	UniProtKB/Swiss-Prot
	V-set	UniProtKB/Swiss-Prot
PhenoGen	Cd2	PhenoGen
PRINTS	CD2ANTIGEN	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000015821	RatGTEx
	ENSRNOG00055019708	RatGTEx
	ENSRNOG00060012683	RatGTEx
	ENSRNOG00065032445	RatGTEx
Superfamily-SCOP	SSF48726	UniProtKB/Swiss-Prot
TIGR	TC214306
UniProt	CD2_RAT	UniProtKB/Swiss-Prot
	F1M9W7	ENTREZGENE
	P08921	ENTREZGENE
	Q5I0M6	ENTREZGENE
UniProt Secondary	F1M9W7	UniProtKB/Swiss-Prot
	Q5I0M6	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-06-27	Cd2	Cd2 molecule	Cd2	CD2 antigen	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-11-06	Cd2	CD2 antigen		OX-45 surface antigen, homolog to human T lymphocyte CD2 antigen	Name updated	625702	APPROVED
2002-06-10	Cd2	OX-45 surface antigen, homolog to human T lymphocyte CD2 antigen			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed on T lymphocytes and splenic macrophages; not expressed on peritoneal or liver macrophages	634710
gene_physical_interaction	interacts with CD5	634711
gene_process	involved in T lymphocyte activation and induction to proliferate	634711
gene_product	belongs to immunoglobulin superfamily	1299861

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD