Advanced Search (OLGA)

Gene: Pou4f3 (POU class 4 homeobox 3) Rattus norvegicus

Analyze

Symbol:

Pou4f3

Name:

POU class 4 homeobox 3

RGD ID:

1310459

Description:

Predicted to enable DNA-binding transcription activator activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Predicted to be involved in positive regulation of transcription by RNA polymerase II. Predicted to act upstream of or within several processes, including nervous system development; neuromuscular process controlling balance; and sensory perception of sound. Predicted to be located in cytoplasm and nucleoplasm. Human ortholog(s) of this gene implicated in autosomal dominant nonsyndromic deafness 15. Orthologous to human POU4F3 (POU class 4 homeobox 3); INTERACTS WITH bisphenol A; 2,3,7,8-tetrachlorodibenzodioxine (ortholog); aflatoxin B1 (ortholog).

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC364855; POU domain, class 4, transcription factor 3

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	POU4F3 (POU class 4 homeobox 3)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Pou4f3 (POU domain, class 4, transcription factor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Pou4f3 (POU class 4 homeobox 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	POU4F3 (POU class 4 homeobox 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	POU4F3 (POU class 4 homeobox 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Pou4f3 (POU class 4 homeobox 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	POU4F3 (POU class 4 homeobox 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	POU4F3 (POU class 4 homeobox 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Pou4f3 (POU class 4 homeobox 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	POU4F3 (POU class 4 homeobox 3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Pou4f3 (POU domain, class 4, transcription factor 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	pou4f3 (POU class 4 homeobox 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	unc-86	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	acj6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	pou4f3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	18	34,641,191 - 34,643,783 (+)	NCBI		GRCr8
mRatBN7.2	18	34,390,205 - 34,392,797 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	34,390,205 - 34,392,797 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	18	34,494,376 - 34,496,968 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	35,212,696 - 35,215,288 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	34,589,597 - 34,592,189 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	36,713,869 - 36,716,461 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	36,713,869 - 36,716,461 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	18	36,378,513 - 36,381,105 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	18	35,600,462 - 35,603,054 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	18	35,635,727 - 35,637,065 (+)	NCBI
Celera	18	33,986,853 - 33,989,445 (+)	NCBI		Celera
Cytogenetic Map	18	p11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autosomal dominant nonsyndromic deafness 15 (ISO)

autosomal recessive nonsyndromic deafness (ISO)

Deafness (ISO)

familial adenomatous polyposis 1 (ISO)

genetic disease (ISO)

Hearing Loss (ISO)

Hereditary Neoplastic Syndromes (ISO)

Neurodevelopmental Disorders (ISO)

Nonsyndromic Sensorineural Hearing Loss (ISO)

sensorineural hearing loss (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

2,3,7,8-tetrachlorodibenzodioxine (ISO)

aflatoxin B1 (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

butanal (ISO)

CGP 52608 (ISO)

chlorpyrifos (ISO)

cisplatin (ISO)

folic acid (ISO)

phorbol 13-acetate 12-myristate (ISO)

titanium dioxide (ISO)

triptonide (ISO)

valproic acid (ISO)

zinc atom (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

axon extension (ISO)

biological_process (ND)

inner ear auditory receptor cell differentiation (ISO)

inner ear development (ISO)

inner ear morphogenesis (ISO)

inner ear receptor cell differentiation (ISO)

neuromuscular process controlling balance (ISO)

neuron apoptotic process (ISO)

positive regulation of transcription by RNA polymerase II (ISO)

regulation of transcription by RNA polymerase II (IBA,ISO)

retinal ganglion cell axon guidance (ISO)

sensory perception of sound (ISO)

vestibulocochlear nerve development (ISO)

Cellular Component

cytoplasm (ISO,ISS)

nucleoplasm (IEA,ISO)

nucleus (ISO,ISS)

Molecular Function

DNA-binding transcription activator activity, RNA polymerase II-specific (ISO)

DNA-binding transcription factor activity (ISO)

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA)

protein binding (ISO)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA,ISO)

sequence-specific DNA binding (ISO,ISS)

sequence-specific double-stranded DNA binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
5.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Comprehensive gene review and curation	RGD comprehensive gene curation
8.	Mutation in transcription factor POU4F3 associated with inherited progressive hearing loss in humans.	Vahava O, etal., Science. 1998 Mar 20;279(5358):1950-4.

Additional References at PubMed

PMID:7623109	PMID:7935408	PMID:8290353	PMID:8637595	PMID:9256502	PMID:9735355	PMID:11807038	PMID:12585968	PMID:15465029	PMID:23805044	PMID:25372459	PMID:28790396

Genomics

Comparative Map Data

Pou4f3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	18	34,641,191 - 34,643,783 (+)	NCBI		GRCr8
mRatBN7.2	18	34,390,205 - 34,392,797 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	34,390,205 - 34,392,797 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	18	34,494,376 - 34,496,968 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	35,212,696 - 35,215,288 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	34,589,597 - 34,592,189 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	36,713,869 - 36,716,461 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	36,713,869 - 36,716,461 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	18	36,378,513 - 36,381,105 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	18	35,600,462 - 35,603,054 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	18	35,635,727 - 35,637,065 (+)	NCBI
Celera	18	33,986,853 - 33,989,445 (+)	NCBI		Celera
Cytogenetic Map	18	p11	NCBI

POU4F3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	146,338,839 - 146,341,728 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	146,338,839 - 146,341,728 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	5	145,718,402 - 145,721,291 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	145,698,869 - 145,700,200 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	5	145,698,868 - 145,700,200	NCBI
Celera	5	141,798,516 - 141,800,012 (+)	NCBI		Celera
Cytogenetic Map	5	q32	NCBI
HuRef	5	140,865,275 - 140,866,771 (+)	NCBI		HuRef
CHM1_1	5	145,151,269 - 145,152,765 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	5	146,874,404 - 146,877,293 (+)	NCBI		T2T-CHM13v2.0

Pou4f3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	18	42,527,662 - 42,529,158 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	18	42,527,604 - 42,530,314 (+)	Ensembl		GRCm39 Ensembl
GRCm38	18	42,394,597 - 42,396,093 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	18	42,394,539 - 42,397,249 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	18	42,554,251 - 42,555,747 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	18	42,520,616 - 42,521,983 (+)	NCBI		MGSCv36	mm8
Celera	18	43,756,095 - 43,757,583 (+)	NCBI		Celera
Cytogenetic Map	18	B3	NCBI
cM Map	18	22.58	NCBI

Pou4f3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955415	7,777,114 - 7,778,622 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955415	7,777,296 - 7,778,622 (-)	NCBI	ChiLan1.0	ChiLan1.0

POU4F3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	4	141,590,020 - 141,593,050 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	5	139,729,571 - 139,732,601 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	141,786,048 - 141,789,078 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	147,800,924 - 147,802,420 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	147,800,924 - 147,802,420 (+)	Ensembl	panpan1.1		panPan2

POU4F3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	40,762,499 - 40,764,131 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	40,762,477 - 40,765,161 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	37,806,385 - 37,807,718 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	41,220,849 - 41,222,182 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	41,220,849 - 41,222,182 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	38,292,452 - 38,293,785 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	39,102,291 - 39,103,624 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	39,927,685 - 39,929,018 (+)	NCBI		UU_Cfam_GSD_1.0

Pou4f3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	146,774,487 - 146,777,274 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936504	8,348,398 - 8,351,804 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936504	8,348,460 - 8,351,246 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

POU4F3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	147,692,751 - 147,695,346 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	147,693,013 - 147,694,345 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	154,124,728 - 154,126,059 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

POU4F3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	23	48,915,247 - 48,920,163 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	23	48,917,217 - 48,918,548 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666034	28,870,406 - 28,873,294 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pou4f3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624774	5,821,024 - 5,822,351 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624774	5,821,024 - 5,822,351 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Pou4f3
5 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	163
Count of miRNA genes:	118
Interacting mature miRNAs:	145
Transcripts:	ENSRNOT00000025465
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331733	Bp233	Blood pressure QTL 233	3.97196		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	24796977	79788953	Rat
1358358	Sradr6	Stress Responsive Adrenal Weight QTL 6	2.49		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	18	11944299	59330563	Rat
1331798	Bp224	Blood pressure QTL 224	3.53873		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31359408	59796643	Rat
2301413	Bp318	Blood pressure QTL 318		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	26548082	46969551	Rat
61383	Bp47	Blood pressure QTL 47	17.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	31271681	60377755	Rat
1331741	Bp232	Blood pressure QTL 232	3.59112		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	21372893	83213037	Rat
1331742	Bp228	Blood pressure QTL 228	3.88752		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31359408	59796643	Rat
61388	Bp2	Blood pressure QTL 2	3.23		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	1	35374722	Rat
1331776	Bp225	Blood pressure QTL 225	2.829		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	31359408	59796643	Rat
6903359	Bp355	Blood pressure QTL 355	3.6		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	11944544	59796478	Rat
12904668	Bw188	Body weight QTL 188		0.03	body mass (VT:0001259)	body weight (CMO:0000012)	18	26548082	46969551	Rat
2313082	Bss85	Bone structure and strength QTL 85	0.8	0.0001	long bone metaphysis morphology trait (VT:0000133)	tibia midshaft total cross-sectional area (CMO:0001715)	18	14951337	59951337	Rat
12904669	Cm125	Cardiac mass QTL 125		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	18	26548082	46969551	Rat
1641923	Colcr8	Colorectal carcinoma resistance QTL 8	3.1	0.0014	intestine integrity trait (VT:0010554)	poorly differentiated malignant colorectal tumor number (CMO:0002076)	18	22066242	52293055	Rat
12904670	Cm126	Cardiac mass QTL 126		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	18	26548082	46969551	Rat
6903347	Bp350	Blood pressure QTL 350	4.4		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31359530	59796478	Rat
2312568	Glom21	Glomerulus QTL 21	2	0.005	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	18	5185858	40503530	Rat
1331727	Bp237	Blood pressure QTL 237	3.053		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31359408	61698465	Rat
2300157	Bmd66	Bone mineral density QTL 66	13.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	18	28964853	73964853	Rat
738005	Anxrr11	Anxiety related response QTL 11	3.4		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	18	30039813	75039813	Rat
12904677	Kidm72	Kidney mass QTL 72		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	18	26548082	46969551	Rat
631274	Sprol1	Serum protein level QTL 1	5.3		blood total protein amount (VT:0005567)	serum total protein level (CMO:0000661)	18	31393320	77209694	Rat
1358193	Emca2	Estrogen-induced mammary cancer QTL 2	1.6		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	18	18007599	63571040	Rat
12904673	Cm127	Cardiac mass QTL 127		0.005	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	18	26548082	46969551	Rat
12904675	Am19	Aortic mass QTL 19		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	18	26548082	46969551	Rat
2293704	Bss35	Bone structure and strength QTL 35	4.59	0.0002	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	18	28964853	73964853	Rat
9589816	Gluco68	Glucose level QTL 68	7.25	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	18	29792965	74792965	Rat
1331774	Bp226	Blood pressure QTL 226	4.41065		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31359408	59796643	Rat
2325839	Bp348	Blood pressure QTL 348		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	25570985	70570985	Rat
1600373	Mamtr6	Mammary tumor resistance QTL 6			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	18	19278901	83218561	Rat
2293708	Bss46	Bone structure and strength QTL 46	8.8	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	18	11791518	63636873	Rat
8694378	Bw157	Body weight QTL 157	3.59	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	18	29792965	74792965	Rat
2300177	Bmd65	Bone mineral density QTL 65	19.7	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	18	28964853	73964853	Rat
9589153	Insul31	Insulin level QTL 31	7.15	0.05	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	18	1	42547119	Rat
1578667	Bss21	Bone structure and strength QTL 21	3.5		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	18	11791518	83218561	Rat
2303120	Mamtr8	Mammary tumor resistance QTL 8		0.001	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	18	31359408	83218561	Rat
61429	Cia17	Collagen induced arthritis QTL 17	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	18	31359408	70263868	Rat
2299160	Iddm35	Insulin dependent diabetes mellitus QTL 35	2.79		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	18	4207941	60377792	Rat
9590318	Scort22	Serum corticosterone level QTL 22	7.64	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	18	29792965	74792965	Rat
1578661	Bss20	Bone structure and strength QTL 20	3.7		femur morphology trait (VT:0000559)	femoral neck cross-sectional area (CMO:0001697)	18	11791518	83218561	Rat
1331753	Bp231	Blood pressure QTL 231	3.643		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	11944299	52293055	Rat
1331754	Bp230	Blood pressure QTL 230	4.61609		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	29792965	74792965	Rat
61375	Bp41	Blood pressure QTL 41	2.4		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	18	11944299	41122201	Rat

Markers in Region

PMC125354P3

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	34,390,664 - 34,390,894 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	36,714,329 - 36,714,558	NCBI	Rnor6.0
Rnor_5.0	18	36,378,973 - 36,379,202	UniSTS	Rnor5.0
RGSC_v3.4	18	35,600,922 - 35,601,151	UniSTS	RGSC3.4
Celera	18	33,987,313 - 33,987,542	UniSTS
Cytogenetic Map	18	p11	UniSTS

UniSTS:491575

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	34,390,158 - 34,391,625 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	36,713,823 - 36,715,289	NCBI	Rnor6.0
Rnor_5.0	18	36,378,467 - 36,379,933	UniSTS	Rnor5.0
RGSC_v3.4	18	35,600,416 - 35,601,882	UniSTS	RGSC3.4
Celera	18	33,986,807 - 33,988,273	UniSTS
Cytogenetic Map	18	p11	UniSTS

Pou4f3

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	34,390,251 - 34,391,124 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	36,713,916 - 36,714,788	NCBI	Rnor6.0
Rnor_5.0	18	36,378,560 - 36,379,432	UniSTS	Rnor5.0
RGSC_v3.4	18	35,600,509 - 35,601,381	UniSTS	RGSC3.4
Celera	18	33,986,900 - 33,987,772	UniSTS
Cytogenetic Map	18	p11	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	ectoderm	endocrine system	endoderm	exocrine system	hepatobiliary system	integumental system	mesenchyme	nervous system	renal system	reproductive system	respiratory system
1	71	4	3	1	1	5	3	66	1	21	2

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001108889	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473974	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000018	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000025465 ⟹ ENSRNOP00000025465

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	18	34,390,205 - 34,392,797 (+)	Ensembl
Rnor_6.0 Ensembl	18	36,713,869 - 36,716,461 (+)	Ensembl

RefSeq Acc Id:

NM_001108889 ⟹ NP_001102359

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	34,641,191 - 34,643,783 (+)	NCBI
mRatBN7.2	18	34,390,205 - 34,392,797 (+)	NCBI
Rnor_6.0	18	36,713,869 - 36,716,461 (+)	NCBI
Rnor_5.0	18	36,378,513 - 36,381,105 (+)	NCBI
RGSC_v3.4	18	35,600,462 - 35,603,054 (+)	RGD
Celera	18	33,986,853 - 33,989,445 (+)	RGD

Sequence:

show sequence

ATGATGGCCATGAACGCCAAGCAGCCTTTCGGCATGCACCCCGTACTGCAAGAACCCAAATTCT
CCAGCCTGCACTCCGGCTCTGAGGCCATGCGCCGAGTTTGTCTCCCAGCCCCGCAGCTGCAGGG
TAATATATTTGGAAGCTTTGATGAGAGCCTGCTGGCACGCGCCGAAGCTCTGGCGGCGGTGGAT
ATCGTCTCCCACGGCAAGAACCATCCGTTCAAGCCCGACGCCACCTACCATACCATGAGCAGCG
TGCCCTGCACGTCCACCTCGCCCACGGTGCCCATCTCCCACCCGGCTGCACTCACCTCGCACCC
GCATCACCCGGTACATCAGGGCCTCGAGGGCGACTTACTGGAGCACATCTCGCCCACGCTGAGC
GTGAGCGGCCTAGGGGCCCCGGAGCACTCCGTGATGCCGGCGCAGATCCACCCGCATCATCTAG
GCGCCATGGGCCACTTGCATCAGGCCATGGGCATGAGTCACCCGCATGCCGTAGCACCTCACAG
TGCCATGCCTGCGTGTCTCAGCGATGTGGAGTCAGACCCTCGAGAGCTGGAGGCGTTCGCCGAG
CGCTTCAAGCAGAGGCGCATCAAGTTGGGGGTAACCCAGGCGGACGTGGGCGCGGCTTTAGCCA
ATCTTAAGATCCCCGGCGTGGGCTCTCTCAGCCAGAGCACCATCTGCAGGTTCGAGTCTCTTAC
CCTGTCGCACAACAACATGATCGCGCTCAAGCCAGTCCTCCAGGCCTGGCTGGAGGAGGCCGAG
GCCGCCTACCGAGAGAAGAACAGCAAGCCGGAGCTCTTCAACGGCAGTGAGCGTAAGCGCAAAC
GCACGTCCATCGCCGCGCCAGAGAAGCGCTCACTCGAAGCCTATTTCGCCATCCAGCCACGTCC
TTCATCTGAAAAGATCGCGGCCATCGCTGAGAAACTGGACCTTAAAAAGAATGTGGTGAGGGTC
TGGTTCTGTAACCAGAGACAGAAACAGAAACGAATGAAGTACTCTGCTGTCCACTGATTGCGAC
GGGTGCAGTGTTCGGAGGAGCCTGGAGAACCTAGTGGCATCGCCCCCTTCCGATGGGAGGGGAC
GTTACGGGACACTCCAGGGTGTTTCCTGGCAGATCAGGTTCTTTCCCCCCATCCCCGAGTCACA
GACTTTCCCCCTTTGTTCCGCTTAATTGCCTCCTGGCCACCTTTTCCTCCCTATTCTCTCTTTT
CCCACCAAAAATGTTCTGGCGCTAGGAGGAAAAAAATTTCAAGGGAAAGCACGTCTGGACGTTG
TGCTGTCCGCGGTGCTGAAAGTAGACCTTGCTCTTTGAGACAGCAGGACCTCAGGCCTGTAGTC
CTGAGGCACACCGGCTTGGGAATTGACCCCACCATCCGACCTCAACGAGAAAGCACCACTTCTT
GGCTAGGCGTCATTAGGCAAGGGCGAAGGTAAGGAAAAGAGAGATAGATAATAATATAAAGTCT
AGGATATTTAAGCGGGACACAAACATGGAGATTAATTTATTAGAGTATATAAACACGTATGTTT
CCAAAGGATAGCCTTATAATAATTCCCTTCTGCGCCTAAATTCTTACCATTGTATCGGTTGGTT
TACTGTACATTCTCATAAGTAGCATGGGTTAAGTTCAGGGACAGTGTCCGAGGTGTTGGGAGTT
CTGGGCTGTTGGTGGGTCAGTAGGATTTCAAGGCAAGGTGGGTCCACCCCAGACTGAAAATACT
TGCAATGTCTTCTTCGCCCGTTGGTGAACAGAGGCCAGCGCGAGGTCTGGCTATCTTCGTCGAC
CTCCTGGAGTTTGAGGAGTATTTGCCTTTTGGAGGGGGCGTGATTTGTGGTTTCAGATCAGACC
AACTGAAGAAGATTCCCTCATCTCAGCTCACCGCTCTAAGCAGAATGTCAGTCCACAGTCCAGT
GTTCCCAAGTGACTGTAACTTCAGGAATCATAGCAAATCCTTCCAACAAACACATCTAACCTAA
CTGTTGCACTTTTATTACCGTGGCTGCTGGCATAGCTAGTTCTTGTTACTTATTTAACTCTGCT
TTCCCTGCCCGACTTTGTGTGTCTCTTGTGGACGTTCAGTATAGTTTCGAGCAGCAGGAGAGCA
GGACCACAGAACCGGACCCTTCTGGCTGCAGCCACAGTTCCCTCGTATTTTATTTATTTATTTT
TCTGTTGCTTTATGTAGTTTGTGTGTTGCTGTGTGACTTTTGGTTTCACTTCTGGAATAGAAAC
AAATAAAACATCGTGTTTCTTTCCTTGATCCC

hide sequence

Protein Sequences


Protein RefSeqs	NP_001102359	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	D3ZTL1	(Get FASTA)	NCBI Sequence Viewer
	EDL76485	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000025465.4
	ENSRNOP00055025532
	ENSRNOP00060015018
	ENSRNOP00065026283

RefSeq Acc Id:

NP_001102359 ⟸ NM_001108889

- UniProtKB:

D3ZTL1 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MMAMNAKQPFGMHPVLQEPKFSSLHSGSEAMRRVCLPAPQLQGNIFGSFDESLLARAEALAAVD
IVSHGKNHPFKPDATYHTMSSVPCTSTSPTVPISHPAALTSHPHHPVHQGLEGDLLEHISPTLS
VSGLGAPEHSVMPAQIHPHHLGAMGHLHQAMGMSHPHAVAPHSAMPACLSDVESDPRELEAFAE
RFKQRRIKLGVTQADVGAALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPVLQAWLEEAE
AAYREKNSKPELFNGSERKRKRTSIAAPEKRSLEAYFAIQPRPSSEKIAAIAEKLDLKKNVVRV
WFCNQRQKQKRMKYSAVH

hide sequence

Ensembl Acc Id:

ENSRNOP00000025465 ⟸ ENSRNOT00000025465

Protein Domains

POU-specific

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZTL1-F1-model_v2	AlphaFold	D3ZTL1	1-338	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1310459	AgrOrtholog
BioCyc Gene	G2FUF-7698	BioCyc
Ensembl Genes	ENSRNOG00000018842	Ensembl, UniProtKB/Swiss-Prot
	ENSRNOG00055018577	UniProtKB/Swiss-Prot
	ENSRNOG00060011350	UniProtKB/Swiss-Prot
	ENSRNOG00065019517	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000025465.5	UniProtKB/Swiss-Prot
	ENSRNOT00055031599	UniProtKB/Swiss-Prot
	ENSRNOT00060019198	UniProtKB/Swiss-Prot
	ENSRNOT00065032886	UniProtKB/Swiss-Prot
Gene3D-CATH	1.10.260.40	UniProtKB/Swiss-Prot
	Homeodomain-like	UniProtKB/Swiss-Prot
InterPro	Homeobox-like_sf	UniProtKB/Swiss-Prot
	Homeobox_CS	UniProtKB/Swiss-Prot
	Homeobox_dom	UniProtKB/Swiss-Prot
	Lambda_DNA-bd_dom_sf	UniProtKB/Swiss-Prot
	POU	UniProtKB/Swiss-Prot
	POU_dom	UniProtKB/Swiss-Prot
	POU_domain_TF	UniProtKB/Swiss-Prot
KEGG Report	rno:364855	UniProtKB/Swiss-Prot
NCBI Gene	364855	ENTREZGENE
PANTHER	POU DOMAIN	UniProtKB/Swiss-Prot
	PTHR11636:SF43	UniProtKB/Swiss-Prot
Pfam	Homeodomain	UniProtKB/Swiss-Prot
	Pou	UniProtKB/Swiss-Prot
PhenoGen	Pou4f3	PhenoGen
PRINTS	POUDOMAIN	UniProtKB/Swiss-Prot
PROSITE	HOMEOBOX_1	UniProtKB/Swiss-Prot
	HOMEOBOX_2	UniProtKB/Swiss-Prot
	POU_1	UniProtKB/Swiss-Prot
	POU_2	UniProtKB/Swiss-Prot
	POU_3	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000018842	RatGTEx
	ENSRNOG00055018577	RatGTEx
	ENSRNOG00060011350	RatGTEx
	ENSRNOG00065019517	RatGTEx
SMART	HOX	UniProtKB/Swiss-Prot
	POU	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF46689	UniProtKB/Swiss-Prot
	SSF47413	UniProtKB/Swiss-Prot
UniProt	D3ZTL1	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-09-24	Pou4f3	POU class 4 homeobox 3	Pou4f3	POU domain, class 4, transcription factor 3	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Pou4f3	POU domain, class 4, transcription factor 3	Pou4f3_predicted	POU domain, class 4, transcription factor 3 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Pou4f3_predicted	POU domain, class 4, transcription factor 3 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM