Advanced Search (OLGA)

Gene: Gcdh (glutaryl-CoA dehydrogenase) Rattus norvegicus

Analyze

Symbol:

Gcdh

Name:

glutaryl-CoA dehydrogenase

RGD ID:

1308829

Description:

Enables fatty-acyl-CoA binding activity; flavin adenine dinucleotide binding activity; and glutaryl-CoA dehydrogenase activity. Involved in fatty acid oxidation and fatty-acyl-CoA biosynthetic process. Predicted to be located in mitochondrion. Human ortholog(s) of this gene implicated in glutaric acidemia I. Orthologous to human GCDH (glutaryl-CoA dehydrogenase); PARTICIPATES IN 2-aminoadipic 2-oxoadipic aciduria pathway; carnitine palmitoyltransferase I deficiency pathway; ethylmalonic encephalopathy pathway; INTERACTS WITH (+)-schisandrin B; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

glutaryl-CoA dehydrogenase, mitochondrial; glutaryl-Coenzyme A dehydrogenase; LOC364975

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GCDH (glutaryl-CoA dehydrogenase)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Gcdh (glutaryl-Coenzyme A dehydrogenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Gcdh (glutaryl-CoA dehydrogenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GCDH (glutaryl-CoA dehydrogenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GCDH (glutaryl-CoA dehydrogenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Gcdh (glutaryl-CoA dehydrogenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GCDH (glutaryl-CoA dehydrogenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GCDH (glutaryl-CoA dehydrogenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Gcdh (glutaryl-CoA dehydrogenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	SPRY2 (sprouty RTK signaling antagonist 2)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	GCDH (glutaryl-CoA dehydrogenase)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Gcdh (glutaryl-Coenzyme A dehydrogenase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	gcdha (glutaryl-CoA dehydrogenase a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	gcdhb (glutaryl-CoA dehydrogenase b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	F54D5.7	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG9547	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	gcdh	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)

Allele / Splice:

Gcdh^em1Dba

Genetic Models:

SD-Gcdh^em1Dba

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	40,168,038 - 40,174,536 (+)	NCBI		GRCr8
mRatBN7.2	19	23,263,215 - 23,269,689 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	23,263,264 - 23,269,681 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	30,086,109 - 30,092,571 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	30,740,469 - 30,746,931 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	32,963,158 - 32,969,621 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	26,000,497 - 26,006,970 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	26,000,497 - 26,006,970 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	36,976,120 - 36,982,606 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	24,919,470 - 24,925,943 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	19	24,924,493 - 24,930,910 (+)	NCBI
Celera	19	22,820,112 - 22,826,585 (+)	NCBI		Celera
Cytogenetic Map	19	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Aicardi-Goutieres Syndrome 4 (ISO)

alpha-mannosidosis (ISO)

Charcot-Marie-Tooth disease dominant intermediate B (ISO)

congenital dyserythropoietic anemia type IV (ISO)

episodic ataxia type 2 (ISO)

genetic disease (ISO)

glutaric acidemia I (ISO,ISS)

Glutaric Aciduria (ISO)

hypomyelinating leukodystrophy 2 (ISO)

intellectual disability (ISO)

primary ciliary dyskinesia 29 (ISO)

tyrosinemia type III (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-dexrazoxane (ISO)

(+)-schisandrin B (EXP)

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

4,4'-sulfonyldiphenol (EXP,ISO)

acetamide (EXP)

acrylamide (ISO)

aflatoxin B1 (ISO)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (EXP,ISO)

buspirone (EXP)

cadmium dichloride (ISO)

chlorpyrifos (EXP,ISO)

cisplatin (ISO)

clofibric acid (EXP)

cobalt dichloride (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

decabromodiphenyl ether (EXP)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP,ISO)

dicyclanil (ISO)

doxorubicin (ISO)

ethanol (EXP)

fenthion (ISO)

flutamide (EXP)

gentamycin (EXP)

glafenine (EXP)

glyphosate (ISO)

gold atom (ISO)

gold(0) (ISO)

inulin (ISO)

leflunomide (EXP)

manganese(II) chloride (EXP)

methidathion (ISO)

O-methyleugenol (ISO)

paracetamol (EXP,ISO)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

phenobarbital (ISO)

PhIP (EXP)

pirinixic acid (ISO)

propiconazole (ISO)

sodium arsenite (EXP,ISO)

sodium fluoride (ISO)

Soman (EXP)

sulindac (EXP)

testosterone (ISO)

tetrachloromethane (EXP,ISO)

thapsigargin (ISO)

thioacetamide (EXP)

tolcapone (EXP)

trichostatin A (ISO)

tunicamycin (ISO)

valproic acid (ISO)

vancomycin (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

acyl-CoA metabolic process (IDA)

fatty acid beta-oxidation using acyl-CoA dehydrogenase (IBA,ISO)

fatty acid oxidation (IDA)

fatty-acyl-CoA biosynthetic process (IBA,IDA)

Cellular Component

mitochondrial matrix (IEA)

mitochondrion (ISO)

Molecular Function

fatty-acyl-CoA binding (IBA,IDA)

flavin adenine dinucleotide binding (IBA,IDA)

glutaryl-CoA dehydrogenase activity (IBA,IDA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

2-aminoadipic 2-oxoadipic aciduria pathway (ISO)

carnitine palmitoyltransferase I deficiency pathway (ISO)

ethylmalonic encephalopathy pathway (ISO)

fatty acid metabolic pathway (IEA,ISO)

glutaric aciduria type I pathway (ISO)

hyperlysinemia pathway (ISO)

lysine degradation pathway (IEA,ISO)

medium chain acyl-CoA dehydrogenase deficiency pathway (ISO)

saccharopinuria pathway (ISO)

short-chain acyl-CoA dehydrogenase deficiency pathway (ISO)

trifunctional protein deficiency pathway (ISO)

tryptophan metabolic pathway (IEA)

very long-chain acyl-CoA dehydrogenase deficiency pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Elevated glutaric acid levels in Dhtkd1-/Gcdh- double knockout mice challenge our current understanding of lysine metabolism.	Biagosch C, etal., Biochim Biophys Acta. 2017 Sep;1863(9):2220-2228. doi: 10.1016/j.bbadis.2017.05.018. Epub 2017 May 22.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Organic aciduria in the riboflavin-deficient rat.	Goodman SI Am J Clin Nutr. 1981 Nov;34(11):2434-7.
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
7.	Online Mendelian Inheritance in Man, OMIM (TM).	Online Mendelian Inheritance in Man, OMIM (TM).
8.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
9.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
10.	Enzymes of fatty acid beta-oxidation in developing brain.	Reichmann H, etal., J Neurochem. 1988 Aug;51(2):339-44.
11.	GOA pipeline	RGD automated data pipeline
12.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
13.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12865426	PMID:14651853	PMID:18614015	PMID:18775954	PMID:23658800	PMID:25416781	PMID:25931508	PMID:27984186	PMID:31505169	PMID:33965309

Genomics

Comparative Map Data

Gcdh
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	40,168,038 - 40,174,536 (+)	NCBI		GRCr8
mRatBN7.2	19	23,263,215 - 23,269,689 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	23,263,264 - 23,269,681 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	30,086,109 - 30,092,571 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	30,740,469 - 30,746,931 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	32,963,158 - 32,969,621 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	26,000,497 - 26,006,970 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	26,000,497 - 26,006,970 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	36,976,120 - 36,982,606 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	24,919,470 - 24,925,943 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	19	24,924,493 - 24,930,910 (+)	NCBI
Celera	19	22,820,112 - 22,826,585 (+)	NCBI		Celera
Cytogenetic Map	19	q11	NCBI

GCDH
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	12,891,129 - 12,899,999 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	12,891,128 - 12,915,126 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	13,001,943 - 13,010,813 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	12,862,974 - 12,871,783 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	12,862,973 - 12,871,782	NCBI
Celera	19	12,891,682 - 12,900,491 (+)	NCBI		Celera
Cytogenetic Map	19	p13.13	NCBI
HuRef	19	12,573,809 - 12,582,680 (+)	NCBI		HuRef
CHM1_1	19	13,002,442 - 13,011,310 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	13,015,581 - 13,024,452 (+)	NCBI		T2T-CHM13v2.0

Gcdh
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	85,613,016 - 85,629,378 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	85,613,022 - 85,620,550 (-)	Ensembl		GRCm39 Ensembl
GRCm38	8	84,886,387 - 84,893,921 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	84,886,393 - 84,893,921 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	87,410,286 - 87,417,820 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	87,776,696 - 87,783,807 (-)	NCBI		MGSCv36	mm8
Celera	8	89,185,944 - 89,193,269 (-)	NCBI		Celera
Cytogenetic Map	8	C3	NCBI
cM Map	8	41.28	NCBI

Gcdh
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955415	31,952,580 - 31,961,615 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955415	31,952,400 - 31,958,067 (+)	NCBI	ChiLan1.0	ChiLan1.0

GCDH
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	17,819,800 - 17,828,749 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	16,820,417 - 16,829,367 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	12,452,779 - 12,461,757 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	13,195,241 - 13,204,253 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	13,195,241 - 13,204,223 (+)	Ensembl	panpan1.1		panPan2

GCDH
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	49,284,341 - 49,290,456 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	49,284,425 - 49,290,849 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	49,156,598 - 49,162,728 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	49,801,277 - 49,807,408 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	49,800,586 - 49,807,454 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	49,012,394 - 49,018,522 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	49,438,870 - 49,444,995 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	49,681,416 - 49,687,548 (-)	NCBI		UU_Cfam_GSD_1.0

Gcdh
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	208,392,780 - 208,399,126 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936659	1,955,559 - 1,962,758 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936659	1,955,601 - 1,961,925 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GCDH
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	66,130,625 - 66,138,868 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	66,131,154 - 66,138,963 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	66,461,407 - 66,466,086 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GCDH
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	11,572,512 - 11,588,108 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	11,572,540 - 11,588,224 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666074	8,202,199 - 8,216,104 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gcdh
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624901	475,073 - 479,292 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624901	474,836 - 479,674 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Gcdh
11 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	63
Count of miRNA genes:	52
Interacting mature miRNAs:	60
Transcripts:	ENSRNOT00000004570
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1549847	Bss8	Bone structure and strength QTL 8	4		lumbar vertebra strength trait (VT:0010574)	vertebra ultimate force (CMO:0001678)	19	1	31963836	Rat
61447	Tcas1	Tongue tumor susceptibility QTL 1	6.08		tongue integrity trait (VT:0010553)	squamous cell carcinoma of the tongue maximum tumor diameter (CMO:0001875)	19	2316121	47316121	Rat
631681	Cm12	Cardiac mass QTL 12	3.33	0.00053	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	19	1	28982497	Rat
9590298	Uminl5	Urine mineral level QTL 5	3.59	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	19	1	36824771	Rat
1331737	Uae29	Urinary albumin excretion QTL 29	5.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	4096155	55283277	Rat
2298478	Eau8	Experimental allergic uveoretinitis QTL 8		0.0163	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	19	17154433	57337602	Rat
1578764	Stresp19	Stress response QTL 19	3.6	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	19	15630201	57337602	Rat
1558656	Prcs1	Prostate cancer susceptibility QTL 1	5		prostate integrity trait (VT:0010571)	percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943)	19	15114598	34521833	Rat
9590090	Insglur8	Insulin/glucose ratio QTL 8	10.81	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	19	1	36824771	Rat
1331788	Rf45	Renal function QTL 45	2.818		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	19	15605023	46559041	Rat
724566	Uae12	Urinary albumin excretion QTL 12	5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	2187927	56457239	Rat
724565	Tcas5	Tongue tumor susceptibility QTL 5	10.04		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	19	9977753	39654489	Rat
61407	Scl12	Serum cholesterol level QTL 12		0.001	blood HDL cholesterol amount (VT:0000184)	serum high density lipoprotein cholesterol level (CMO:0000361)	19	13926401	30303727	Rat
8552935	Pigfal10	Plasma insulin-like growth factor 1 level QTL 10	5.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	19	1	36824771	Rat
61350	Bp32	Blood pressure QTL 32		0.012	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	19	20483575	57337602	Rat
7411549	Bw130	Body weight QTL 130	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	15455860	57337602	Rat
10054132	Srcrt9	Stress Responsive Cort QTL 9	2.87	0.0017	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	19	1	27355345	Rat
724518	Uae19	Urinary albumin excretion QTL 19	5.5		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	7457249	42983518	Rat
8694186	Bw152	Body weight QTL 152	3.34	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	569374	45569374	Rat
61423	Cia14	Collagen induced arthritis QTL 14	3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	19	10827970	43544039	Rat
7411590	Foco7	Food consumption QTL 7	6.8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	19	1	24688055	Rat
631678	Cm9	Cardiac mass QTL 9	4.27	0.0001	aorta mass (VT:0002845)	aorta weight (CMO:0000076)	19	1	28982497	Rat
9590250	Scort11	Serum corticosterone level QTL 11	23.45	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	19	1	36824771	Rat
2317848	Alcrsp21	Alcohol response QTL 21	1.899999976158142	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	19	3204777	48204777	Rat
9589102	Slep13	Serum leptin concentration QTL 13	4.63	0.001	blood leptin amount (VT:0005667)	plasma leptin level (CMO:0000781)	19	569374	45569374	Rat
7247442	Uae39	Urinary albumin excretion QTL 39			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	2187927	46708701	Rat

Markers in Region

RH137276

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	23,269,426 - 23,269,632 (-)	MAPPER	mRatBN7.2
Rnor_6.0	19	26,000,554 - 26,000,759	NCBI	Rnor6.0
Rnor_5.0	19	36,976,177 - 36,976,382	UniSTS	Rnor5.0
RGSC_v3.4	19	24,925,681 - 24,925,886	UniSTS	RGSC3.4
Celera	19	22,826,323 - 22,826,528	UniSTS
Cytogenetic Map	19	q11	UniSTS

RH143238

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	23,263,273 - 23,263,409 (-)	MAPPER	mRatBN7.2
Rnor_6.0	19	26,006,776 - 26,006,911	NCBI	Rnor6.0
Rnor_5.0	19	36,982,399 - 36,982,534	UniSTS	Rnor5.0
RGSC_v3.4	19	24,919,529 - 24,919,664	UniSTS	RGSC3.4
Celera	19	22,820,171 - 22,820,306	UniSTS
Cytogenetic Map	19	q11	UniSTS

Genetic Models

This gene Gcdh is modified in the following models/strains:

SD-Gcdh^em1Dba

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001108896	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063278170	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063278171	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063278172	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063278173	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473972	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228966	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000019	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000004570 ⟹ ENSRNOP00000004570

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	19	23,263,317 - 23,269,674 (+)	Ensembl
Rnor_6.0 Ensembl	19	26,000,497 - 26,006,970 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000103013 ⟹ ENSRNOP00000079491

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	19	23,263,281 - 23,269,678 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000116825 ⟹ ENSRNOP00000082785

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	19	23,263,264 - 23,269,681 (+)	Ensembl

RefSeq Acc Id:

NM_001108896 ⟹ NP_001102366

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	40,168,063 - 40,174,536 (+)	NCBI
mRatBN7.2	19	23,263,215 - 23,269,689 (+)	NCBI
Rnor_6.0	19	26,000,497 - 26,006,970 (-)	NCBI
Rnor_5.0	19	36,976,120 - 36,982,606 (-)	NCBI
RGSC_v3.4	19	24,919,470 - 24,925,943 (+)	RGD
Celera	19	22,820,112 - 22,826,585 (+)	RGD

Sequence:

show sequence

GCTCTTTTAAAAGGCAGAGCCACAGAGAAGGCGGTGCTCTGGGAGGAACCAAGGAGAAACCAAT
GAGCAGCCCCTATTAGGCCTAGGTCAAGTGTGCTGGTCCAGAACGCAGCCTGCAAGCACCAGGT
TATGGTCCCTGCGATGCTCACCGGCTACATGTCCCTGAGAGGAGTCTCTGCGTGGTTGCTGAGC
CGCAAGCTCGGCCTGCGCTTCTCGCGCGTTCCACGTACGTGGAGCTCGGCGGCCGCGCACACGG
AGAAGACACAGATCCGATCGGTCAAATCCTCTCGTCCTGTGTTTGACTGGAAGGACCCACTGGT
CCTGGAGGAGCAGTTGACTGCCGATGAGAAACTCATCAGGGACACCTTCCGTAACTACTGCCAG
GAACGACTTATGTCTCGAATTCTGCTGGCCAATCGAAATGAAGTTTTTCACAGGGACATTGTAT
ATGAGATGGGGGAGCTGGGTGTGCTGGGACCCACCATTAAAGGGTATGGCTGTGCTGGAGTGTC
ATCGGTGGCCTATGGGCTCCTGACTCGAGAGCTAGAGAGGGTGGACAGCGGCTACAGGTCGATG
ATGAGTGTTCAGTCCTCCCTTGTCATGCACCCCATCTATACCTATGGGAGTGAGGAGCAGCGAC
AGAAGTATCTGCCCCGACTGGCCAAGGGTGAACTTCTGGGCTGCTTCGGACTTACAGAGCCCAA
CCATGGGAGTGATCCAGGCAGCATGGAGACCAGAGCTCGCCACAATCCATCAAACAAGAGCTAC
ACTCTCAGTGGAACCAAGACCTGGATCACCAACTCCCCTGTGGCTGACCTATTCGTAGTGTGGG
CTCGGTGTGAGGATAACTGTATCCGGGGCTTCCTGCTGGAGAAGGGGATGCGGGGCCTCTCAGC
CCCTAGGATTGAAGGAAAGTTCTCCTTGCGGGCCTCAGCTACTGGTATGATCATCATGGACAGC
GTGGAAGTGCCCGAGGAGAATGTGCTGCCTAATGTGTCAAGCCTGGCGGGCCCTTTTGGCTGCC
TTAACACTGCCCGATATGGCATCACATGGGGTGTGTTGGGAGCTGCTGAGTTCTGTTTGCACAC
AGCTCGGCAGTATGCTCTGGACAGGATCCAGTTTGGAGTCCCCTTGGCCAGGAACCAGCTGGTT
CAGAAGAAGTTGGCAGACATGCTCACTGAGATCACACTGGGCCTCCATGCATGTTTACAACTTG
GCCGTCTAAAGGATCAGGACAAGGCTACTCCAGAAATGGTCTCCCTGTTGAAGAGAAACAACTG
TGGGAAAGCCCTGGACATCGCCCGCCAGGCACGAGACATCCTGGGAGGAAATGGGATTTCTGAT
GAGTACCATGTGATCCGGCATGCTATGAATTTAGAGGCAGTGAACACTTACGAAGGTACACATG
ACATCCATGCTCTGATCCTGGGGAGAGCAATTACTGGGATTCAGGCATTCACGGTTGAAAAATG
AACCCACTTCAACAGAGAAATACTTTGCTCAAGAAGTAATGGATGGACCCAGCTTTTATGGTTG
AAAGTGAGACACTGATTTGAGACTTAGGAAATGTCTTTCTTCATTCAGATATGCTCTATAGAAA
GAAGAAGAAATTAATTCTCAGTGTGGCTCTTGGCCCTCAGTGCTTTTTAACTGTGGATGAAATC
AAACTCCATCTACCCTGTTTTAAGTTTTTTGGAACTGGAAGAGACAAAGGGGAGTGACACAGAA
GCCACTGAGACGGAGCAGACCTTGTGTGAGAAGGTGTAGTGGACTTTACAGTGAGCCTTCCTGC
CTCTATCCCAGGAGCAGTACCTTCTGTGTTCAACACTAAGCAGATAAAAGAGGAAAATAAAGAG
CCTGTGCCTTACTCCTTGG

hide sequence

RefSeq Acc Id:

XM_063278170 ⟹ XP_063134240

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	40,168,038 - 40,174,528 (+)	NCBI

RefSeq Acc Id:

XM_063278171 ⟹ XP_063134241

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	40,168,038 - 40,174,528 (+)	NCBI

RefSeq Acc Id:

XM_063278172 ⟹ XP_063134242

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	40,168,039 - 40,174,528 (+)	NCBI

RefSeq Acc Id:

XM_063278173 ⟹ XP_063134243

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	40,168,039 - 40,174,007 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001102366	(Get FASTA)	NCBI Sequence Viewer
	XP_063134240	(Get FASTA)	NCBI Sequence Viewer
	XP_063134241	(Get FASTA)	NCBI Sequence Viewer
	XP_063134242	(Get FASTA)	NCBI Sequence Viewer
	XP_063134243	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL92192	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000004570.5
	ENSRNOP00000079491.1
	ENSRNOP00000082785.1

RefSeq Acc Id:

NP_001102366 ⟸ NM_001108896

- UniProtKB:

A6IY64 (UniProtKB/TrEMBL), A0A8I5ZN89 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MVPAMLTGYMSLRGVSAWLLSRKLGLRFSRVPRTWSSAAAHTEKTQIRSVKSSRPVFDWKDPLV
LEEQLTADEKLIRDTFRNYCQERLMSRILLANRNEVFHRDIVYEMGELGVLGPTIKGYGCAGVS
SVAYGLLTRELERVDSGYRSMMSVQSSLVMHPIYTYGSEEQRQKYLPRLAKGELLGCFGLTEPN
HGSDPGSMETRARHNPSNKSYTLSGTKTWITNSPVADLFVVWARCEDNCIRGFLLEKGMRGLSA
PRIEGKFSLRASATGMIIMDSVEVPEENVLPNVSSLAGPFGCLNTARYGITWGVLGAAEFCLHT
ARQYALDRIQFGVPLARNQLVQKKLADMLTEITLGLHACLQLGRLKDQDKATPEMVSLLKRNNC
GKALDIARQARDILGGNGISDEYHVIRHAMNLEAVNTYEGTHDIHALILGRAITGIQAFTVEK

hide sequence

Ensembl Acc Id:

ENSRNOP00000004570 ⟸ ENSRNOT00000004570

Ensembl Acc Id:

ENSRNOP00000082785 ⟸ ENSRNOT00000116825

Ensembl Acc Id:

ENSRNOP00000079491 ⟸ ENSRNOT00000103013

RefSeq Acc Id:	XP_063134240 ⟸ XM_063278170
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_063134241 ⟸ XM_063278171
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_063134242 ⟸ XM_063278172
- Peptide Label:	isoform X3

RefSeq Acc Id:	XP_063134243 ⟸ XM_063278173
- Peptide Label:	isoform X4

Protein Domains

Acyl-CoA dehydrogenase/oxidase C-terminal Acyl-CoA dehydrogenase/oxidase N-terminal Acyl-CoA oxidase/dehydrogenase middle

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZT90-F1-model_v2	AlphaFold	D3ZT90	1-447	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13701027

Promoter ID:

EPDNEW_R11551

Type:

multiple initiation site

Name:

Gcdh_1

Description:

glutaryl-CoA dehydrogenase

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	19	26,006,867 - 26,006,927	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1308829	AgrOrtholog
BioCyc Gene	G2FUF-6126	BioCyc
BioCyc Pathway	PWY-5177 [glutaryl-CoA degradation]	BioCyc
BioCyc Pathway Image	PWY-5177	BioCyc
Ensembl Genes	ENSRNOG00000003307	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000004570.6	UniProtKB/TrEMBL
	ENSRNOT00000103013.1	UniProtKB/TrEMBL
	ENSRNOT00000116825.1	UniProtKB/TrEMBL
Gene3D-CATH	1.10.540.10	UniProtKB/TrEMBL
	2.40.110.10	UniProtKB/TrEMBL
	Butyryl-CoA Dehydrogenase, subunit A, domain 3	UniProtKB/TrEMBL
InterPro	Acyl-CoA_DH_CS	UniProtKB/TrEMBL
	Acyl-CoA_Oxase/DH_cen-dom	UniProtKB/TrEMBL
	Acyl-CoA_Oxase/DH_mid-dom_sf	UniProtKB/TrEMBL
	AcylCo_DH/oxidase_C	UniProtKB/TrEMBL
	AcylCo_DH_C-like	UniProtKB/TrEMBL
	AcylCoA_DH/ox_N	UniProtKB/TrEMBL
	AcylCoA_DH/ox_N_sf	UniProtKB/TrEMBL
	AcylCoA_DH/oxidase	UniProtKB/TrEMBL
	Glutaryl-CoA_DH_mitochondrial	UniProtKB/TrEMBL
KEGG Report	rno:364975	UniProtKB/TrEMBL
NCBI Gene	364975	ENTREZGENE
PANTHER	GLUTARYL-COA DEHYDROGENASE, MITOCHONDRIAL	UniProtKB/TrEMBL
	GLUTARYL-COA DEHYDROGENASE, MITOCHONDRIAL	UniProtKB/TrEMBL
Pfam	Acyl-CoA_dh_1	UniProtKB/TrEMBL
	Acyl-CoA_dh_M	UniProtKB/TrEMBL
	Acyl-CoA_dh_N	UniProtKB/TrEMBL
PhenoGen	Gcdh	PhenoGen
PROSITE	ACYL_COA_DH_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000003307	RatGTEx
Superfamily-SCOP	AcylCoA_dehyd_NM	UniProtKB/TrEMBL
	AcylCoADH_C_like	UniProtKB/TrEMBL
UniProt	A0A8I5ZN89	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I5ZUK9_RAT	UniProtKB/TrEMBL
	A6IY64	ENTREZGENE, UniProtKB/TrEMBL
	D3ZT90_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2011-08-02	Gcdh	glutaryl-CoA dehydrogenase	Gcdh	glutaryl-Coenzyme A dehydrogenase	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Gcdh	glutaryl-Coenzyme A dehydrogenase	Gcdh_predicted	glutaryl-Coenzyme A dehydrogenase (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Gcdh_predicted	glutaryl-Coenzyme A dehydrogenase (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways