Symbol:
Slain1
Name:
SLAIN motif family, member 1
RGD ID:
1308626
Description:
Orthologous to human SLAIN1 (SLAIN motif family member 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 4,4'-sulfonyldiphenol; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
hypothetical protein LOC361087; LOC361087; RGD1308626; similar to 9630044O09Rik protein; SLAIN motif-containing protein 1; uncharacterized protein LOC361087
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
mRatBN7.2 - mRatBN7.2 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 15 86,897,476 - 86,957,113 (+) NCBI GRCr8 mRatBN7.2 15 80,482,818 - 80,542,461 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 15 80,482,367 - 80,542,350 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 15 84,462,499 - 84,522,163 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 15 85,585,541 - 85,645,202 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 15 82,513,170 - 82,572,840 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 15 87,862,832 - 87,906,472 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 15 87,886,783 - 87,906,474 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 15 91,357,889 - 91,401,695 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 15 87,720,662 - 87,770,016 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 15 87,736,441 - 87,785,803 (+) NCBI Celera 15 79,632,758 - 79,675,830 (+) NCBI Celera Cytogenetic Map 15 q21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Slain1 Rat 1,2-dimethylhydrazine increases expression ISO Slain1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of SLAIN1 mRNA CTD PMID:22206623 Slain1 Rat 17beta-estradiol multiple interactions ISO SLAIN1 (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in decreased expression of SLAIN1 mRNA CTD PMID:30165855 Slain1 Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Slain1 (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Slain1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of SLAIN1 mRNA CTD PMID:34747641 Slain1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether decreases expression ISO SLAIN1 (Homo sapiens) 6480464 2 more ... CTD PMID:26705709 Slain1 Rat 4,4'-sulfonyldiphenol decreases methylation ISO SLAIN1 (Homo sapiens) 6480464 bisphenol S results in decreased methylation of SLAIN1 gene CTD PMID:31601247 Slain1 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of SLAIN1 mRNA CTD PMID:36041667 Slain1 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of SLAIN1 mRNA CTD PMID:24780913 and PMID:30047161 Slain1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of SLAIN1 mRNA CTD PMID:36843608 Slain1 Rat aflatoxin B1 decreases methylation ISO SLAIN1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of SLAIN1 gene CTD PMID:27153756 Slain1 Rat aflatoxin M1 decreases expression ISO SLAIN1 (Homo sapiens) 6480464 Aflatoxin M1 results in decreased expression of SLAIN1 mRNA CTD PMID:30928695 Slain1 Rat all-trans-retinoic acid decreases expression ISO Slain1 (Mus musculus) 6480464 Tretinoin results in decreased expression of SLAIN1 mRNA CTD PMID:16788091 Slain1 Rat all-trans-retinoic acid decreases expression ISO SLAIN1 (Homo sapiens) 6480464 Tretinoin results in decreased expression of SLAIN1 mRNA CTD PMID:33167477 Slain1 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of SLAIN1 mRNA CTD PMID:30047161 Slain1 Rat amphetamine decreases expression EXP 6480464 Amphetamine results in decreased expression of SLAIN1 mRNA CTD PMID:30779732 Slain1 Rat antirheumatic drug decreases expression ISO SLAIN1 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of SLAIN1 mRNA CTD PMID:24449571 Slain1 Rat aristolochic acid A decreases expression ISO SLAIN1 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of SLAIN1 mRNA CTD PMID:33212167 Slain1 Rat arsenous acid decreases expression ISO SLAIN1 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of SLAIN1 mRNA CTD PMID:26705709 Slain1 Rat beta-lapachone decreases expression ISO SLAIN1 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of SLAIN1 mRNA CTD PMID:38218311 Slain1 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Slain1 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of SLAIN1 mRNA CTD PMID:39150890 Slain1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of SLAIN1 mRNA CTD PMID:25181051 more ... Slain1 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of SLAIN1 mRNA CTD PMID:36041667 Slain1 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of SLAIN1 gene CTD PMID:28505145 Slain1 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of SLAIN1 mRNA CTD PMID:36041667 Slain1 Rat buta-1,3-diene decreases expression ISO Slain1 (Mus musculus) 6480464 1 and 3-butadiene results in decreased expression of SLAIN1 mRNA CTD PMID:29038090 Slain1 Rat Butylbenzyl phthalate multiple interactions ISO Slain1 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of SLAIN1 mRNA CTD PMID:39150890 Slain1 Rat cadmium atom multiple interactions ISO SLAIN1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of SLAIN1 mRNA CTD PMID:35301059 Slain1 Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of SLAIN1 mRNA CTD PMID:33453195 Slain1 Rat cadmium dichloride multiple interactions ISO SLAIN1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of SLAIN1 mRNA CTD PMID:35301059 Slain1 Rat copper atom multiple interactions ISO SLAIN1 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of SLAIN1 mRNA CTD PMID:20971185 Slain1 Rat copper(0) multiple interactions ISO SLAIN1 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of SLAIN1 mRNA CTD PMID:20971185 Slain1 Rat cordycepin increases expression ISO Slain1 (Mus musculus) 6480464 cordycepin results in increased expression of SLAIN1 mRNA CTD PMID:32042022 Slain1 Rat crocidolite asbestos increases methylation ISO SLAIN1 (Homo sapiens) 6480464 Asbestos and Crocidolite results in increased methylation of SLAIN1 gene CTD PMID:29523930 Slain1 Rat cyclosporin A increases expression ISO SLAIN1 (Homo sapiens) 6480464 Cyclosporine results in increased expression of SLAIN1 mRNA CTD PMID:20106945 Slain1 Rat diarsenic trioxide decreases expression ISO SLAIN1 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of SLAIN1 mRNA CTD PMID:26705709 Slain1 Rat Dibutyl phosphate affects expression ISO SLAIN1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of SLAIN1 mRNA CTD PMID:37042841 Slain1 Rat dibutyl phthalate multiple interactions ISO Slain1 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of SLAIN1 mRNA CTD PMID:39150890 Slain1 Rat diethyl phthalate multiple interactions ISO Slain1 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of SLAIN1 mRNA CTD PMID:39150890 Slain1 Rat diisobutyl phthalate multiple interactions ISO Slain1 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of SLAIN1 mRNA CTD PMID:39150890 Slain1 Rat diisononyl phthalate multiple interactions ISO Slain1 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of SLAIN1 mRNA CTD PMID:39150890 Slain1 Rat dorsomorphin multiple interactions ISO SLAIN1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Slain1 Rat doxorubicin decreases expression ISO SLAIN1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of SLAIN1 mRNA CTD PMID:29803840 Slain1 Rat epoxiconazole decreases expression ISO Slain1 (Mus musculus) 6480464 epoxiconazole results in decreased expression of SLAIN1 mRNA CTD PMID:35436446 Slain1 Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of SLAIN1 mRNA CTD PMID:30307764 Slain1 Rat folic acid decreases expression ISO Slain1 (Mus musculus) 6480464 Folic Acid results in decreased expression of SLAIN1 mRNA CTD PMID:25629700 Slain1 Rat formaldehyde decreases expression ISO SLAIN1 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of SLAIN1 mRNA CTD PMID:23649840 Slain1 Rat gallic acid increases expression ISO SLAIN1 (Homo sapiens) 6480464 Gallic Acid results in increased expression of SLAIN1 mRNA CTD PMID:34408198 Slain1 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of SLAIN1 mRNA CTD PMID:30047161 Slain1 Rat methyl methanesulfonate decreases expression ISO SLAIN1 (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of SLAIN1 mRNA CTD PMID:23649840 Slain1 Rat Muraglitazar decreases expression EXP 6480464 muraglitazar results in decreased expression of SLAIN1 mRNA CTD PMID:21515302 Slain1 Rat paracetamol increases expression ISO SLAIN1 (Homo sapiens) 6480464 Acetaminophen results in increased expression of SLAIN1 mRNA CTD PMID:26690555 Slain1 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of SLAIN1 mRNA CTD PMID:33387578 Slain1 Rat phenylmercury acetate decreases expression ISO SLAIN1 (Homo sapiens) 6480464 Phenylmercuric Acetate results in decreased expression of SLAIN1 mRNA CTD PMID:26272509 Slain1 Rat phenylmercury acetate multiple interactions ISO SLAIN1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of SLAIN1 mRNA CTD PMID:27188386 Slain1 Rat potassium chromate increases expression ISO SLAIN1 (Homo sapiens) 6480464 potassium chromate(VI) results in increased expression of SLAIN1 mRNA CTD PMID:22714537 Slain1 Rat progesterone decreases expression ISO SLAIN1 (Homo sapiens) 6480464 Progesterone results in decreased expression of SLAIN1 mRNA CTD PMID:21540246 Slain1 Rat SB 431542 multiple interactions ISO SLAIN1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Slain1 Rat sodium arsenite increases expression ISO SLAIN1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of SLAIN1 mRNA CTD PMID:34032870 Slain1 Rat sunitinib increases expression ISO SLAIN1 (Homo sapiens) 6480464 Sunitinib results in increased expression of SLAIN1 mRNA CTD PMID:31533062 Slain1 Rat temozolomide increases expression ISO SLAIN1 (Homo sapiens) 6480464 Temozolomide results in increased expression of SLAIN1 mRNA CTD PMID:31758290 Slain1 Rat Tesaglitazar decreases expression EXP 6480464 tesaglitazar results in decreased expression of SLAIN1 mRNA CTD PMID:21515302 Slain1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of SLAIN1 mRNA CTD PMID:23411599 Slain1 Rat trichostatin A decreases expression ISO SLAIN1 (Homo sapiens) 6480464 trichostatin A results in decreased expression of SLAIN1 mRNA CTD PMID:24935251 and PMID:26272509 Slain1 Rat trichostatin A multiple interactions ISO SLAIN1 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of SLAIN1 mRNA CTD PMID:27188386 Slain1 Rat triphenyl phosphate affects expression ISO SLAIN1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of SLAIN1 mRNA CTD PMID:37042841 Slain1 Rat troglitazone decreases expression EXP 6480464 troglitazone results in decreased expression of SLAIN1 mRNA CTD PMID:21515302 Slain1 Rat valproic acid increases expression ISO SLAIN1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of SLAIN1 mRNA CTD PMID:29154799 Slain1 Rat valproic acid affects expression ISO SLAIN1 (Homo sapiens) 6480464 Valproic Acid affects the expression of SLAIN1 mRNA CTD PMID:25979313 Slain1 Rat valproic acid decreases methylation ISO SLAIN1 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of SLAIN1 gene CTD PMID:29154799
1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 6-propyl-2-thiouracil (EXP) aflatoxin B1 (ISO) aflatoxin M1 (ISO) all-trans-retinoic acid (ISO) amitrole (EXP) amphetamine (EXP) antirheumatic drug (ISO) aristolochic acid A (ISO) arsenous acid (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP) bisphenol F (EXP) buta-1,3-diene (ISO) Butylbenzyl phthalate (ISO) cadmium atom (ISO) cadmium dichloride (EXP,ISO) copper atom (ISO) copper(0) (ISO) cordycepin (ISO) crocidolite asbestos (ISO) cyclosporin A (ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) diethyl phthalate (ISO) diisobutyl phthalate (ISO) diisononyl phthalate (ISO) dorsomorphin (ISO) doxorubicin (ISO) epoxiconazole (ISO) fenvalerate (EXP) folic acid (ISO) formaldehyde (ISO) gallic acid (ISO) methimazole (EXP) methyl methanesulfonate (ISO) Muraglitazar (EXP) paracetamol (EXP,ISO) phenylmercury acetate (ISO) potassium chromate (ISO) progesterone (ISO) SB 431542 (ISO) sodium arsenite (ISO) sunitinib (ISO) temozolomide (ISO) Tesaglitazar (EXP) thioacetamide (EXP) trichostatin A (ISO) triphenyl phosphate (ISO) troglitazone (EXP) valproic acid (ISO)
Slain1 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 15 86,897,476 - 86,957,113 (+) NCBI GRCr8 mRatBN7.2 15 80,482,818 - 80,542,461 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 15 80,482,367 - 80,542,350 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 15 84,462,499 - 84,522,163 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 15 85,585,541 - 85,645,202 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 15 82,513,170 - 82,572,840 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 15 87,862,832 - 87,906,472 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 15 87,886,783 - 87,906,474 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 15 91,357,889 - 91,401,695 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 15 87,720,662 - 87,770,016 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 15 87,736,441 - 87,785,803 (+) NCBI Celera 15 79,632,758 - 79,675,830 (+) NCBI Celera Cytogenetic Map 15 q21 NCBI
SLAIN1 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 13 77,697,687 - 77,764,229 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 13 77,697,687 - 77,764,242 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 13 78,271,822 - 78,338,364 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 13 77,170,471 - 77,236,378 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 13 59,170,471 - 59,236,367 (+) NCBI Celera Cytogenetic Map 13 q22.3 NCBI HuRef 13 58,969,702 - 59,037,136 (+) NCBI HuRef CHM1_1 13 78,239,942 - 78,305,763 (+) NCBI CHM1_1 T2T-CHM13v2.0 13 76,922,360 - 76,989,219 (+) NCBI T2T-CHM13v2.0
Slain1 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 14 103,887,664 - 103,942,343 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 14 103,887,664 - 103,942,343 (+) Ensembl GRCm39 Ensembl GRCm38 14 103,650,228 - 103,704,907 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 14 103,650,228 - 103,704,907 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 14 104,049,460 - 104,104,019 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 14 102,535,922 - 102,590,481 (+) NCBI MGSCv36 mm8 Celera 14 102,277,925 - 102,332,181 (+) NCBI Celera Cytogenetic Map 14 E2.3 NCBI cM Map 14 52.75 NCBI
Slain1 (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955404 29,535,923 - 29,595,141 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955404 29,537,497 - 29,594,617 (-) NCBI ChiLan1.0 ChiLan1.0
SLAIN1 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 14 79,266,077 - 79,332,927 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 13 77,862,202 - 77,929,068 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 13 58,914,327 - 58,981,193 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 13 77,956,027 - 78,021,872 (+) NCBI panpan1.1 PanPan1.1 panPan2
SLAIN1 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 22 31,199,494 - 31,258,920 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 22 31,199,533 - 31,258,021 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 22 31,059,969 - 31,119,380 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 22 31,518,440 - 31,577,868 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 22 31,518,472 - 31,577,762 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 22 31,178,235 - 31,237,893 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 22 31,216,534 - 31,275,927 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 22 31,290,054 - 31,349,399 (+) NCBI UU_Cfam_GSD_1.0
Slain1 (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 128,198,023 - 128,254,849 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936511 3,614,303 - 3,671,847 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936511 3,615,251 - 3,671,429 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SLAIN1 (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 11 49,807,994 - 49,886,822 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 11 49,807,976 - 49,886,829 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 11 54,498,235 - 54,504,073 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SLAIN1 (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 3 56,774,381 - 56,840,862 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 3 56,774,157 - 56,839,851 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666046 12,994,744 - 13,061,499 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Slain1 (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 136 Count of miRNA genes: 87 Interacting mature miRNAs: 120 Transcripts: ENSRNOT00000065710 Prediction methods: Miranda, Targetscan Result types: miRGate_prediction
731177 Uae26 Urinary albumin excretion QTL 26 2.4 0.025 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 15 67588667 101769107 Rat 1300144 Rf23 Renal function QTL 23 3.61 renal blood flow trait (VT:2000006) absolute change in renal vascular resistance (CMO:0001900) 15 40631268 98288169 Rat 1576315 Schws6 Schwannoma susceptibility QTL 6 0.0069 nervous system integrity trait (VT:0010566) post-insult time of death (CMO:0002005) 15 53806152 98806152 Rat 1549844 Bss7 Bone structure and strength QTL 7 6.4 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 15 75788062 101769107 Rat 61477 Aia4 Adjuvant induced arthritis QTL 4 3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 15 55596089 91365858 Rat 2300326 Plaw1 Placental weight QTL 1 15 0.005 placenta mass (VT:0004257) placenta wet weight (CMO:0002088) 15 68327165 100062518 Rat 70182 BpQTLcluster12 Blood pressure QTL cluster 12 3.53 arterial blood pressure trait (VT:2000000) absolute change in mean arterial blood pressure (CMO:0000533) 15 73690657 95018120 Rat 152025253 Hrtrt24 Heart rate QTL 24 3.82 heart pumping trait (VT:2000009) 15 27885774 86257085 Rat 70155 Gcs1 Gastric cancer susceptibility QTL1 3.8 stomach morphology trait (VT:0000470) stomach tumor susceptibility score (CMO:0002043) 15 76306099 101769107 Rat 1582227 Gluco30 Glucose level QTL 30 3.6 0.0003 blood glucose amount (VT:0000188) absolute change in blood glucose level area under curve (CMO:0002034) 15 28030665 82262678 Rat 1581555 Eae19 Experimental allergic encephalomyelitis QTL 19 4.7 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis severity score (CMO:0001419) 15 76306099 90088744 Rat 1582228 Epfw3 Epididymal fat weight QTL 3 4.1 0.0002 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 15 28030665 82262678 Rat 1578646 Bmd18 Bone mineral density QTL 18 5.2 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 15 22806240 98288169 Rat 631655 Bp126 Blood pressure QTL 126 4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 15 58156477 101769107 Rat 1578647 Bmd17 Bone mineral density QTL 17 4 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 15 22806240 98288169 Rat 61424 Scl1 Serum cholesterol level QTL 1 7.7 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 15 16725528 80672115 Rat 631516 Gluco31 Glucose level QTL 31 7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 15 55596089 95018120 Rat 1331724 Bp223 Blood pressure QTL 223 3.53715 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 15 73690518 95018228 Rat 1641889 Colcr6 Colorectal carcinoma resistance QTL 6 2.9 0.0126 intestine integrity trait (VT:0010554) benign colorectal tumor surface area measurement (CMO:0001799) 15 73690518 99794247 Rat 1582242 Gluco28 Glucose level QTL 28 3.3 0.0008 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 15 28030665 82262678 Rat 1578660 Bss19 Bone structure and strength QTL 19 4.3 femur morphology trait (VT:0000559) bone trabecular cross-sectional area (CMO:0002311) 15 22806240 98288169 Rat 1582244 Bw79 Body weight QTL 79 4 0.0002 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 15 28030665 82262678 Rat 2317055 Aia10 Adjuvant induced arthritis QTL 10 3.41 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 15 75788062 101769107 Rat 1582214 Stl21 Serum triglyceride level QTL 21 3.1 0.022 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 15 28030665 82262678 Rat
AU048285
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 80,539,149 - 80,539,272 (+) MAPPER mRatBN7.2 Rnor_6.0 15 87,903,276 - 87,903,396 NCBI Rnor6.0 Rnor_5.0 15 91,398,499 - 91,398,619 UniSTS Rnor5.0 RGSC_v3.4 15 87,766,820 - 87,766,940 UniSTS RGSC3.4 Celera 15 79,672,634 - 79,672,754 UniSTS Cytogenetic Map 15 q22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
10
49
113
91
90
59
25
59
6
217
96
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000065710 ⟹ ENSRNOP00000061269
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 80,498,647 - 80,542,350 (+) Ensembl Rnor_6.0 Ensembl 15 87,886,783 - 87,906,474 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000096527 ⟹ ENSRNOP00000090352
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 80,482,367 - 80,542,350 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000109076 ⟹ ENSRNOP00000092556
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 80,482,367 - 80,542,350 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000117967 ⟹ ENSRNOP00000081350
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 80,482,367 - 80,542,350 (+) Ensembl
RefSeq Acc Id:
NM_001014139 ⟹ NP_001014161
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 86,913,301 - 86,957,113 (+) NCBI mRatBN7.2 15 80,498,647 - 80,542,461 (+) NCBI Rnor_6.0 15 87,862,832 - 87,906,472 (+) NCBI Rnor_5.0 15 91,357,889 - 91,401,695 (+) NCBI RGSC_v3.4 15 87,720,662 - 87,770,016 (+) RGD Celera 15 79,632,758 - 79,675,830 (+) RGD
Sequence:
CAGTGATCAGAAAGGTGGCCTTTTCATTTGTAAAATACGACACAGATTGAGCTGAGCCATTAGGAGCTTATCAAGAATCTGTCTCGTGGAGCCTGTCCAGTGTCTCCTTGCATGGCCCAAGATGCTAT CCCTGCCCGATCGTGTTTCCACTCCTGAGGTGCTCTGCCACATTTGGAACACTGATTTAAAGCTTTGAAGGAGAGGTCATTTTAGGTTATACCTCCAGGGGCTCCCCACTTAGTCCACAGTCATCTAT CGACAGTGAGCTGAGTACCTCAGAGTTGGAGGATGATTCTATATCCATGGGCTACAAGTTACAGGACCTTACTGACGTCCAGATCATGGCTCGTCTGCAAGAAGAGAGCCTCAGGCAAGACTGTGCTT CCACTTCAGGATCTGTGTCCAGGAACAGCTCCACCATTTCCCTGAGCTCAGGGAAAAAGGGGACGTGCAGTGATCAAGAGTACGATCGGTATAGCCTGGAGGACGAGGAAGAATTCGACCATTTGCCA CCACCTCAGCCCCGACTTCCGAGGTGTTCACCCTTCCAAAGAGGCATCCCCCACTCACAGACTTTCTCCAGCATTCGGGATTGCAGGAGGAGCCCCAGTTCCCAGTATTTCCCTTCAAATAATTTCCA GCAGCCACAGTATTATTCACCTCAAGCCCAAACTCCAGATCAGCAACCAAATAGGACCAATGGAGATAAACTACGAAGAAGTATGCCTAATCTGGCCCGGATGCCAAGCACCACTGCAGTCAGTAGCA ACCTCAGCTCTCCCGTGACAGTGAGGAGCAGTCAGAGTTTTGACTCAAGCTTGCACGGAGCTGGAAGTGGGGTTTCTCGGGTACCGTCCTGCATCCCGTCACCAGGACAGATTCAGCACAGAGTCCAC AGCGTGGGGCATTTCCCAGTGCCCATCCGGCAGCCCCTGAAGGCCACAGCCTACGTCAGTCCGACTGTTCAGGGCAGCAGCAGCAGCATGCCTTTGTCCAATGGCACACAGTTATATTCCAACACCGG CATCCCTACCCCAAACAAAGCTGCGGCTTCCGGGATTATGGGCCGCAGCGCCCTTCCGCGACCTTCCTTGGCAATAAATGGGAGTAACCTGCCTCGAAGCAAGATTGCACAGCCTGTCAGGAGTTTCC TGCAGCCCCCCAAGCCTCTATCTTCACTCAGCACACTGAGGGATGGAAATTGGAGAGACGGTTGCTACTGATGCAGTTTTATGGACCCTTGTAGAATGGGAAGAATCGAAAATGAGGGTGTGTTACCT AGCTGGCTGGGTAACCGTGGATGCTGGGATGCTCTCCCCTTCACCCTAACACGTGCGCACGGCATCGTTTTCAGTGGACCAATCACCAGAGACTAACGATCGCACTTACTCTCTGCCTGAAATACTGT GGCAACCCCAAACCCATGGCCACGGTATTGTTACCTTAGATCTAGGAAGTTTTTGTAGAACTGCTCTGTACCTGAATACTTTTTGAGAGAGATTGAGGCGTATCAATAATGCTTTGCCATATGGGGTT TTTAAAGTACCTTTGTTCATTTTACCTACGTGTTCTAAACACCTTTCCATTACGTGTTCTGCATTTTAATACACTGCATATTTACAACTAGGTTCTATAACATGGTTTGGATTTTAATTTTTTTTTAT AGTTTACAGGAATTTTATTTTTTTGTGCCTATTTCTTTTTATGCCTATGTGAACCACTATGGAACAACTTAAATTTTGTGCCATAAAAGTATTTTTGTGGTAAGGTACTATTTTTTTAGCTCTAGGGA TTATATCAGCAAAAAGAAAAAAAAAAAACCACACCATACGATTTGAGACATAACTTTACGTTGAACGAGCACAATTTAGTCTAAAGCGTCGCAAAGGAGACAGCCAGACGGCAGAGTTAAGCGGTCTT GTCTTTTTTCATTGTTAATTTATTGTCTTACATGAGTTTCATATTTATGATGGCATCACAGACCCGTTGCACTTAAGACCCGCAATGTTTGCTACTCAACCACAATTGATTTTCAATACTTTATTACA AAGGACGAAACTGTAATGTTTTATTAACAATGCTTCTGGAAACGAACGCATTTTAAAGCAAATAAATCTTTTTGATAGACCTTTTCCAAAAAAAAAAAAAAAAAAAAAAAAAGG
hide sequence
RefSeq Acc Id:
NM_001393854 ⟹ NP_001380783
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 86,897,476 - 86,957,113 (+) NCBI mRatBN7.2 15 80,482,818 - 80,542,461 (+) NCBI
RefSeq Acc Id:
NM_001393855 ⟹ NP_001380784
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 86,897,476 - 86,957,113 (+) NCBI mRatBN7.2 15 80,482,818 - 80,542,461 (+) NCBI
RefSeq Acc Id:
XM_039093535 ⟹ XP_038949463
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 86,905,149 - 86,957,113 (+) NCBI mRatBN7.2 15 80,491,080 - 80,542,461 (+) NCBI
RefSeq Acc Id:
NP_001014161 ⟸ NM_001014139
- Peptide Label:
isoform 3
- UniProtKB:
Q5HZW0 (UniProtKB/TrEMBL), D4A5Y9 (UniProtKB/TrEMBL)
- Sequence:
MGYKLQDLTDVQIMARLQEESLRQDCASTSGSVSRNSSTISLSSGKKGTCSDQEYDRYSLEDEEEFDHLPPPQPRLPRCSPFQRGIPHSQTFSSIRDCRRSPSSQYFPSNNFQQPQYYSPQAQTPDQQ PNRTNGDKLRRSMPNLARMPSTTAVSSNLSSPVTVRSSQSFDSSLHGAGSGVSRVPSCIPSPGQIQHRVHSVGHFPVPIRQPLKATAYVSPTVQGSSSSMPLSNGTQLYSNTGIPTPNKAAASGIMGR SALPRPSLAINGSNLPRSKIAQPVRSFLQPPKPLSSLSTLRDGNWRDGCY
hide sequence
Ensembl Acc Id:
ENSRNOP00000061269 ⟸ ENSRNOT00000065710
RefSeq Acc Id:
XP_038949463 ⟸ XM_039093535
- Peptide Label:
isoform X1
- UniProtKB:
D4A5Y9 (UniProtKB/TrEMBL), Q5HZW0 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000090352 ⟸ ENSRNOT00000096527
Ensembl Acc Id:
ENSRNOP00000081350 ⟸ ENSRNOT00000117967
Ensembl Acc Id:
ENSRNOP00000092556 ⟸ ENSRNOT00000109076
RefSeq Acc Id:
NP_001380783 ⟸ NM_001393854
- Peptide Label:
isoform 1
- UniProtKB:
A0A8I5ZRS3 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001380784 ⟸ NM_001393855
- Peptide Label:
isoform 2
- UniProtKB:
A0A8I6ABM8 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2012-10-10
Slain1
SLAIN motif family, member 1
RGD1308626
similar to 9630044O09Rik protein
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2005-12-06
RGD1308626
similar to 9630044O09Rik protein
RGD1308626_predicted
similar to 9630044O09Rik protein (predicted)
Symbol and Name updated
1559027
APPROVED
2005-01-20
RGD1308626_predicted
similar to 9630044O09Rik protein (predicted)
LOC361087_predicted
Symbol and Name status set to approved
1331353
APPROVED
2005-01-12
LOC361087_predicted
similar to 9630044O09Rik protein (predicted)
Symbol and Name status set to provisional
70820
PROVISIONAL