Advanced Search (OLGA)

Gene: Ermn (ermin) Rattus norvegicus

Analyze

Symbol:

Ermn

Name:

ermin

RGD ID:

1308367

Description:

Predicted to enable actin filament binding activity. Predicted to be involved in several processes, including actin filament organization; morphogenesis of a branching structure; and regulation of cell shape. Predicted to be located in cytoplasm and glial cell projection. Predicted to be active in several cellular components, including filopodium; main axon; and neuronal cell body. Orthologous to human ERMN (ermin); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; amitrole.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

ermin, ERM-like protein; JN; juxtanodin; LOC295619; MGC105579; RGD1308367; similar to KIAA1189 protein

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ERMN (ermin)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Ermn (ermin, ERM-like protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ermn (ermin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ERMN (ermin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ERMN (ermin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ermn (ermin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ERMN (ermin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ERMN (ermin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ermn (ermin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	ERMN (ermin)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ermn (ermin, ERM-like protein)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	63,037,001 - 63,042,657 (-)	NCBI		GRCr8
mRatBN7.2	3	42,628,160 - 42,633,816 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	42,626,309 - 42,633,744 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	45,959,546 - 45,965,202 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	54,555,965 - 54,561,629 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	52,335,697 - 52,341,346 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	44,080,350 - 44,086,006 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	44,068,057 - 44,086,022 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	49,193,350 - 49,199,006 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	39,822,600 - 39,828,256 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	39,718,973 - 39,724,628 (-)	NCBI
Celera	3	40,696,717 - 40,702,373 (-)	NCBI		Celera
Cytogenetic Map	3	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autism spectrum disorder (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

2,3,7,8-tetrachlorodibenzodioxine (EXP)

6-propyl-2-thiouracil (EXP)

all-trans-retinoic acid (ISO)

amiodarone (ISO)

amitrole (EXP)

antirheumatic drug (ISO)

arsenite(3-) (ISO)

benzene (ISO)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

bisphenol A (EXP)

bisphenol F (ISO)

Brodifacoum (EXP)

carbon nanotube (ISO)

chrysene (ISO)

copper atom (EXP)

copper(0) (EXP)

copper(II) sulfate (ISO)

Cuprizon (EXP)

dorsomorphin (ISO)

fenvalerate (EXP)

gentamycin (EXP)

glycidol (EXP)

methylmercury chloride (ISO)

nickel atom (ISO)

ozone (ISO)

paracetamol (EXP)

SB 431542 (ISO)

tetraphene (ISO)

Theaflavin 3,3'-digallate (ISO)

trichloroethene (EXP)

valproic acid (ISO)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

actin filament organization (IBA,ISO)

morphogenesis of a branching structure (IBA,ISO)

regulation of cell projection organization (IBA,ISO)

regulation of cell shape (IBA,ISO)

Cellular Component

cell cortex (IBA,ISO)

cytoplasm (ISO)

cytoskeleton (IEA)

filopodium (IBA,ISO)

glial cell projection (ISO)

internode region of axon (IBA,ISO)

myelin sheath (IBA,ISO)

neuronal cell body (IBA,ISO)

paranode region of axon (IBA,ISO)

Molecular Function

actin filament binding (IBA,ISO)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:16051705	PMID:16421295	PMID:19056867	PMID:19332107	PMID:20610382	PMID:20934411	PMID:21221725	PMID:23198089

Genomics

Comparative Map Data

Ermn
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	63,037,001 - 63,042,657 (-)	NCBI		GRCr8
mRatBN7.2	3	42,628,160 - 42,633,816 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	42,626,309 - 42,633,744 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	45,959,546 - 45,965,202 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	54,555,965 - 54,561,629 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	52,335,697 - 52,341,346 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	44,080,350 - 44,086,006 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	44,068,057 - 44,086,022 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	49,193,350 - 49,199,006 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	39,822,600 - 39,828,256 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	39,718,973 - 39,724,628 (-)	NCBI
Celera	3	40,696,717 - 40,702,373 (-)	NCBI		Celera
Cytogenetic Map	3	q21	NCBI

ERMN
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	157,318,631 - 157,327,712 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	157,318,631 - 157,327,713 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	158,175,143 - 158,184,224 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	157,883,371 - 157,892,392 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	2	151,788,269 - 151,797,290 (-)	NCBI		Celera
Cytogenetic Map	2	q24.1	NCBI
HuRef	2	150,060,700 - 150,069,721 (-)	NCBI		HuRef
CHM1_1	2	158,181,143 - 158,190,164 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	2	157,771,771 - 157,780,852 (-)	NCBI		T2T-CHM13v2.0

Ermn
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	57,874,920 - 57,942,962 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	57,935,125 - 57,942,876 (-)	Ensembl		GRCm39 Ensembl
GRCm38	2	58,045,115 - 58,052,864 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	58,045,113 - 58,052,864 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	57,897,526 - 57,905,163 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	57,860,501 - 57,868,138 (-)	NCBI		MGSCv36	mm8
Celera	2	59,806,673 - 59,814,324 (-)	NCBI		Celera
Cytogenetic Map	2	C1.1	NCBI
cM Map	2	32.99	NCBI

Ermn
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955449	16,057,595 - 16,061,861 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955449	16,056,735 - 16,064,734 (+)	NCBI	ChiLan1.0	ChiLan1.0

ERMN
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	13	59,989,035 - 59,996,320 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2B	60,004,009 - 60,011,294 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2B	44,583,336 - 44,590,623 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2B	161,823,765 - 161,831,104 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2B	161,823,765 - 161,831,104 (-)	Ensembl	panpan1.1		panPan2

ERMN
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	36	3,355,519 - 3,363,214 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	36	3,358,125 - 3,363,129 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	36	3,493,085 - 3,500,771 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	36	3,477,897 - 3,485,582 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	36	3,477,898 - 3,485,488 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	36	3,480,234 - 3,487,919 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	36	3,539,981 - 3,547,675 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	36	3,577,877 - 3,585,565 (-)	NCBI		UU_Cfam_GSD_1.0

Ermn
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	120,500,905 - 120,507,928 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936469	21,109,752 - 21,116,909 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936469	21,109,812 - 21,116,815 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ERMN
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	15	64,286,054 - 64,293,154 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	15	64,286,038 - 64,293,270 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	15	71,280,941 - 71,285,638 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ERMN
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	10	42,732,155 - 42,745,664 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	10	42,729,668 - 42,737,379 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666040	156,838,321 - 156,845,714 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ermn
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624732	8,486,421 - 8,491,118 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624732	8,486,514 - 8,493,085 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Ermn
13 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	1060
Count of miRNA genes:	328
Interacting mature miRNAs:	447
Transcripts:	ENSRNOT00000034449
Prediction methods:	Microtar, Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
10401810	Kidm53	Kidney mass QTL 53			kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	8227194	47233430	Rat
2298542	Neuinf11	Neuroinflammation QTL 11	3.9		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	3	15005422	76927699	Rat
1358362	Srcrt2	Stress Responsive Cort QTL 2	2.78		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	38192233	133483320	Rat
631832	Sach1	Saccharin preference QTL 1	2.7	0.02	consumption behavior trait (VT:0002069)	calculated saccharin drink intake volume (CMO:0001600)	3	27494621	44188411	Rat
737818	Hcar12	Hepatocarcinoma resistance QTL 12	2.6		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	3	29463235	118376539	Rat
9590286	Uminl1	Urine mineral level QTL 1	3.5	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	3	28249687	73249687	Rat
10450816	Scl75	Serum cholesterol level QTL 75	4.4	0.001	blood LDL cholesterol amount (VT:0000181)	blood low density lipoprotein cholesterol level (CMO:0000053)	3	38192233	50749747	Rat
2313093	Bmd77	Bone mineral density QTL 77	2.2	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	3	27494621	50302886	Rat
12879852	Cm93	Cardiac mass QTL 93		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	3	18311454	47233430	Rat
12879853	Am5	Aortic mass QTL 5		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	3	18311454	47233430	Rat
12879854	Kidm63	Kidney mass QTL 63		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	18311454	47233430	Rat
61356	Bp37	Blood pressure QTL 37	3		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	3	30684642	75684642	Rat
1358905	Hrtrt17	Heart rate QTL 17	5.9	0.000014	heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	10861912	89878372	Rat
12879849	Bw180	Body weight QTL 180		0.037	body mass (VT:0001259)	body weight (CMO:0000012)	3	18311454	47233430	Rat
70191	BpQTLcluster4	Blood pressure QTL cluster 4	3		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	3	10778704	50302886	Rat
12879850	Cm91	Cardiac mass QTL 91		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	3	18311454	47233430	Rat
2313101	Bmd76	Bone mineral density QTL 76	3.6	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	3	27494621	50302886	Rat
731172	Bp151	Blood pressure QTL 151		0.04	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	18311454	47233430	Rat
12879851	Cm92	Cardiac mass QTL 92		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	18311454	47233430	Rat
8694196	Abfw2	Abdominal fat weight QTL 2	16.58	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	3	28249687	73249687	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	41874578	155617519	Rat
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	41874578	155617519	Rat
2290452	Scl56	Serum cholesterol level QTL 56	2.26		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	3	1	91609953	Rat
12879868	Am6	Aortic mass QTL 6		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	3	31426403	70668733	Rat
11565451	Bw177	Body weight QTL 177		0.002	body mass (VT:0001259)	body weight (CMO:0000012)	3	31426403	70668733	Rat
10450852	Stl33	Serum triglyceride level QTL 33	3.4	0.05	blood LDL triglyceride amount (VT:0010699)	blood lipoprotein triglyceride level (CMO:0002685)	3	38192233	50749747	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
11565452	Kidm57	Kidney mass QTL 57		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	31426403	70668733	Rat
4889975	Bmd81	Bone mineral density QTL 81	4.3		tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	3	38710365	50302886	Rat
12879866	Cm94	Cardiac mass QTL 94		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	31426403	70668733	Rat
12879867	Cm95	Cardiac mass QTL 95		0.047	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	3	31426403	70668733	Rat
2302055	Pia30	Pristane induced arthritis QTL 30	3.5	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111)	3	27936919	72936919	Rat
634317	Bw117	Body weight QTL 117	3.58		abdominal fat pad mass (VT:1000711)	abdominal fat pad weight to body weight ratio (CMO:0000095)	3	39454637	53296578	Rat
1331795	Rf30	Renal function QTL 30	3.708		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	3	39454637	89115240	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
1354589	Bw31	Body weight QTL 31	3.3		body mass (VT:0001259)	body weight (CMO:0000012)	3	33703347	78196190	Rat
2303593	Gluco46	Glucose level QTL 46	3		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	28468571	73468571	Rat
1354590	Despr11	Despair related QTL 11		0.000031	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	3	28468571	73468571	Rat
2313079	Bss73	Bone structure and strength QTL 73	1.5		tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	3	27494621	50302886	Rat
1331777	Bw24	Body weight QTL 24	3.503		body mass (VT:0001259)	body weight (CMO:0000012)	3	39454637	89115240	Rat
631647	Bp122	Blood pressure QTL 122	6.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	30684642	75684642	Rat
2313076	Bss74	Bone structure and strength QTL 74	2	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	3	27494621	50302886	Rat
1300169	Bp177	Blood pressure QTL 177	2.96		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	3	33703347	61017857	Rat
10450813	Scl74	Serum cholesterol level QTL 74	5.8	0.001	blood LDL cholesterol amount (VT:0000181)	blood low density lipoprotein cholesterol level (CMO:0000053)	3	38192233	50749747	Rat
2302276	Bw82	Body weight QTL 82	4.32		body mass (VT:0001259)	body weight (CMO:0000012)	3	39454637	62951183	Rat
738019	Anxrr10	Anxiety related response QTL 10	3.9		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	3	38517803	83517803	Rat
9590136	Scort3	Serum corticosterone level QTL 3	23.37	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	28249687	73249687	Rat
10450804	Scl70	Serum cholesterol level QTL 70	4.7	0.001	blood LDL cholesterol amount (VT:0000181)	blood low density lipoprotein cholesterol level (CMO:0000053)	3	20714090	65714090	Rat
61419	Cia11	Collagen induced arthritis QTL 11	5.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	3	30356773	98535386	Rat
1354597	Kidm13	Kidney mass QTL 13	2.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	3	41874578	104104347	Rat
8552950	Pigfal12	Plasma insulin-like growth factor 1 level QTL 12	7.3		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	3	28249687	73249687	Rat
631676	Cm8	Cardiac mass QTL 8	7.03	0.0001	aorta mass (VT:0002845)	aorta weight (CMO:0000076)	3	16954708	61954708	Rat
10450794	Scl69	Serum cholesterol level QTL 69	6.3	0.001	blood LDL cholesterol amount (VT:0000181)	blood low density lipoprotein cholesterol level (CMO:0000053)	3	20714090	65714090	Rat
8694386	Bw159	Body weight QTL 159	4.52	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	3	28249687	73249687	Rat
1354604	Bw36	Body weight QTL 36	2.9		body mass (VT:0001259)	body weight (CMO:0000012)	3	33703347	104104347	Rat
2313049	Bss72	Bone structure and strength QTL 72	2.6	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	3	27494621	50302886	Rat
2301400	Cm68	Cardiac mass QTL 68		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	3	31426403	70668733	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
8	8	8	106	35	38	13	15	13	6	71	36	93	6	26	25

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001008311	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC129417	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC086596	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473983	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ119821	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000034449 ⟹ ENSRNOP00000029247

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	42,626,309 - 42,633,744 (-)	Ensembl
Rnor_6.0 Ensembl	3	44,080,352 - 44,086,006 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000082604 ⟹ ENSRNOP00000074091

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	3	44,068,057 - 44,086,022 (-)	Ensembl

RefSeq Acc Id:

NM_001008311 ⟹ NP_001008312

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	63,037,001 - 63,042,657 (-)	NCBI
mRatBN7.2	3	42,628,160 - 42,633,816 (-)	NCBI
Rnor_6.0	3	44,080,350 - 44,086,006 (-)	NCBI
Rnor_5.0	3	49,193,350 - 49,199,006 (-)	NCBI
RGSC_v3.4	3	39,822,600 - 39,828,256 (-)	RGD
Celera	3	40,696,717 - 40,702,373 (-)	RGD

Sequence:

show sequence

GTAAACCTTTAGAAAGAATCTTGCCATTGCATGTCAGGCTGAGAGTTTAAGGTTTGGTTTTAGA
ACTGTAGGAACCACAGCATTAGAGCTTATCAAATATTTGCTCCCATACTTTCTCTGTTGCTTCC
TTAACTCAGACCTAAGGGAACATCATGACAGATACTCCTGTGACACTGAGTGGCTCGGAGTGCA
ATGGGGACAGACCACCTGAGAATGGCCAACAGCCTAGCAGTCAAACCAGGAAGACAACTGATGC
AGATGAGACCCAGACATACTATGGGGTTGAACCCAGTCTTCAACATTTACCTGCAAAAGAAAAT
CAAGAAGAAAGTGGAAACAGTAAAGGGAACGTGCTGCCCAGAGGGTCGGAAGATGAGAAGATTC
TCAATGAAAACACAGAGGAGAACCTCTTTGTTGTTCACCAGGCCATCCAAGATCTGTCTCTCCA
AGAAACAAGTGCAGAAGACACAGTTTTCCAAGAAGGGCATCCATGGAAGAAGATCCCTCTGAAC
AGCCATAACCTGGACATGAGTAGACAGAAGGAAAGAATTGTCCACCAACATCTAGAGCAGAGAG
AAGATGAGAGCGCAGCCCACCAGGCAACTGAAATTGAATGGCTGGGGTTCCAGAAATCTAGTCA
AGTTGACATATTGCATTCTAAATGCGATGAGGAAGAAGAAGTTTGGAATGAAGAAATAAATGAG
GAAGATGTCGATGAGTGTGCTGAGGACGAAGGTGAAGATGAAGTTCGAGTAATAGAATTTAAGA
GAAAATACAGAGAAGGTTCTCCACTAAAAGAGGAAAGCCTTGCAAGGGAGGACTCCCCACTAAG
CAGCCCTAGTTCCCAGCCTGGGACCCCCGATGAGCAGCTGGTGTTAGGAAAGAAGGGAGATATC
GCCAGGAATTCTTATTCCAGATACAACACGATATCCTATCGGAAAATCAGGAAAGGTAACACCA
AACAGAGAATTGATGAGTTTGAGTCAATGATGCACTTATAAACTAACTGGGACTGAGAAATGTC
AGGAGCATTAAAGAGAAGCTAACTTCTAACTTCCTTCCACTGAGATATCTTCCACTGCCTTATT
TGCAAGATGTGCAAGCTTAGTATCTTTTTCACCATAAAGCAATGTGGAAATAACCATAGACCAA
ACACATTCTGGTAACTTCAAACCAACAAGCTTTAAATTCATTCCTGGGTTTTTGCTTTAAAAAA
CGCATAACTAATATAGGATCAGGTAAGCATTGTCCCAGAGCCTAGCCTGGTAGAATTTGTATTT
AAAAACAGTAATAGTAAGAGAGGCAGTCAAGGGAACGAGGATAGTAGACGTGATTCTCATAATT
CTTTTGGTGTCTTTCTTTCTTCAGGCCAATGAGAAGCCTAAAATTAAACCCCACCTCCATTAAA
CATGGTTTTATAGATCCTGTTTTTTTTCTTTTCTATTTATTATAAAAAAAATATTGTATCTTAA
GTAGGTTTCCTTGGCATCTACTGAGTAAAAATTCAGCAGATCTCCTTTCTAGCTGCAACTGTTC
AGTGAATTTCCTCACTAAAAGGTTAAGCAATTGTCAGTCAGAATTCTGTTTGCTGAGTGCTGGT
CCCAGCTTTATGCTTGCAACATGAATTAAACCCATTGCGAAGTTGATCCAGAGAGAGCCTAGAT
GACTGGTGAGCCACAGATTAGAGATTTGTATTGGATGGTTTTATTTTGTTACTGAAAACAAAGT
CTTGTCTAGCACAATGAAATCATTAAAAATAAAAATGGCAATTTTAGCACAAAAAAAAAAAAAA
AAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001008312	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH86596	(Get FASTA)	NCBI Sequence Viewer
	AAZ14038	(Get FASTA)	NCBI Sequence Viewer
	EDM00407	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000029247.3
	ENSRNOP00055001019
	ENSRNOP00060011722
	ENSRNOP00065027747
GenBank Protein	Q5RJL0	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001008312 ⟸ NM_001008311

- UniProtKB:

Q5RJL0 (UniProtKB/Swiss-Prot), A6JF53 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MTDTPVTLSGSECNGDRPPENGQQPSSQTRKTTDADETQTYYGVEPSLQHLPAKENQEESGNSK
GNVLPRGSEDEKILNENTEENLFVVHQAIQDLSLQETSAEDTVFQEGHPWKKIPLNSHNLDMSR
QKERIVHQHLEQREDESAAHQATEIEWLGFQKSSQVDILHSKCDEEEEVWNEEINEEDVDECAE
DEGEDEVRVIEFKRKYREGSPLKEESLAREDSPLSSPSSQPGTPDEQLVLGKKGDIARNSYSRY
NTISYRKIRKGNTKQRIDEFESMMHL

hide sequence

Ensembl Acc Id:

ENSRNOP00000074091 ⟸ ENSRNOT00000082604

Ensembl Acc Id:

ENSRNOP00000029247 ⟸ ENSRNOT00000034449

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5RJL0-F1-model_v2	AlphaFold	Q5RJL0	1-282	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692083

Promoter ID:

EPDNEW_R2608

Type:

single initiation site

Name:

Ermn_1

Description:

ermin

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	44,086,018 - 44,086,078	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1308367	AgrOrtholog
BioCyc Gene	G2FUF-49662	BioCyc
Ensembl Genes	ENSRNOG00000021472	Ensembl, UniProtKB/Swiss-Prot
	ENSRNOG00055000738	UniProtKB/Swiss-Prot
	ENSRNOG00060009014	UniProtKB/Swiss-Prot
	ENSRNOG00065020472	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000034449.5	UniProtKB/Swiss-Prot
	ENSRNOT00055001269	UniProtKB/Swiss-Prot
	ENSRNOT00060015097	UniProtKB/Swiss-Prot
	ENSRNOT00065034602	UniProtKB/Swiss-Prot
Gene3D-CATH	6.10.360.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7311836	IMAGE-MGC_LOAD
InterPro	Ermin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Moesin_tail_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:295619	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:105579	IMAGE-MGC_LOAD
NCBI Gene	295619	ENTREZGENE
PANTHER	ERMIN	UniProtKB/Swiss-Prot
	ERMIN	UniProtKB/TrEMBL
	ERMIN	UniProtKB/TrEMBL
	PTHR47137	UniProtKB/Swiss-Prot
Pfam	Ermin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Ermn	PhenoGen
RatGTEx	ENSRNOG00000021472	RatGTEx
	ENSRNOG00055000738	RatGTEx
	ENSRNOG00060009014	RatGTEx
	ENSRNOG00065020472	RatGTEx
Superfamily-SCOP	Moesin tail domain	UniProtKB/TrEMBL, UniProtKB/Swiss-Prot
UniProt	A6JF53	ENTREZGENE, UniProtKB/TrEMBL
	ERMIN_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-11-12	Ermn	ermin	Ermn	ermin, ERM-like protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-11	Ermn	ermin, ERM-like protein	RGD1308367	similar to KIAA1189 protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	RGD1308367	similar to KIAA1189 protein	RGD1308367_predicted	similar to KIAA1189 protein (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-20	RGD1308367_predicted	similar to KIAA1189 protein (predicted)	LOC295619_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC295619_predicted	similar to KIAA1189 protein (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar