Symbol:
Kif2a
Name:
kinesin family member 2A
RGD ID:
70974
Description:
Enables protein kinase binding activity. Involved in anterograde axonal transport. Predicted to be located in several cellular components, including microtubule cytoskeleton; nuclear lumen; and sperm principal piece. Predicted to be part of centriolar subdistal appendage and kinesin complex. Predicted to be active in GABA-ergic synapse; cytoplasm; and microtubule cytoskeleton. Human ortholog(s) of this gene implicated in complex cortical dysplasia with other brain malformations 3. Orthologous to human KIF2A (kinesin family member 2A); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; acrylamide; ammonium chloride.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
Kif2; kinesin heavy chain family, member 2; kinesin heavy chain member 2; kinesin heavy chain member 2A; kinesin-2; kinesin-like protein KIF2A
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
KIF2A (kinesin family member 2A) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):
Kif2a (kinesin family member 2A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Kif2a (kinesin family member 2A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
KIF2A (kinesin family member 2A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
KIF2A (kinesin family member 2A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Kif2a (kinesin family member 2A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
KIF2A (kinesin family member 2A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
KIF2A (kinesin family member 2A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Kif2a (kinesin family member 2A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
KIF2A (kinesin family member 2A)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Kif2a (kinesin family member 2A)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
zgc:103670
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
klp-7
Alliance
DIOPT (Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Klp10A
Alliance
DIOPT (Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Klp59C
Alliance
DIOPT (OMA|OrthoFinder|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
Klp59D
Alliance
DIOPT (OMA|OrthoFinder|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
kif2a
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 40,101,548 - 40,164,780 (-) NCBI GRCr8 mRatBN7.2 2 38,367,998 - 38,431,237 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 38,367,998 - 38,431,508 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 45,491,535 - 45,554,753 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 43,550,214 - 43,613,432 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 38,397,498 - 38,460,714 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 38,145,507 - 38,208,765 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 38,147,601 - 38,208,719 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 57,240,240 - 57,302,984 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 38,079,564 - 38,143,398 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 38,002,008 - 38,013,924 (-) NCBI Celera 2 34,235,756 - 34,298,829 (-) NCBI Celera Cytogenetic Map 2 q13 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Kif2a Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Kif2a (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of KIF2A mRNA CTD PMID:19770486 Kif2a Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of KIF2A mRNA CTD PMID:33387578 and PMID:34747641 Kif2a Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Kif2a (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of KIF2A mRNA CTD PMID:21570461 Kif2a Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Kif2a (Mus musculus) 6480464 Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to KIF2A promoter] CTD PMID:19654925 Kif2a Rat 2-methylcholine affects expression ISO KIF2A (Homo sapiens) 6480464 beta-methylcholine affects the expression of KIF2A mRNA CTD PMID:21179406 Kif2a Rat 4-hydroxyphenyl retinamide decreases expression ISO Kif2a (Mus musculus) 6480464 Fenretinide results in decreased expression of KIF2A mRNA CTD PMID:28973697 Kif2a Rat acrolein multiple interactions ISO KIF2A (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of KIF2A mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of KIF2A mRNA CTD PMID:32699268 Kif2a Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of KIF2A mRNA CTD PMID:28959563 Kif2a Rat acrylamide decreases expression ISO Kif2a (Mus musculus) 6480464 Acrylamide results in decreased expression of KIF2A mRNA CTD PMID:30807115 Kif2a Rat aflatoxin B1 affects expression ISO KIF2A (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of KIF2A protein CTD PMID:20106945 Kif2a Rat aflatoxin B1 increases expression ISO KIF2A (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of KIF2A mRNA CTD PMID:22100608 and PMID:27153756 Kif2a Rat all-trans-retinoic acid decreases expression ISO KIF2A (Homo sapiens) 6480464 Tretinoin results in decreased expression of KIF2A mRNA CTD PMID:15498508 and PMID:33167477 Kif2a Rat alpha-pinene multiple interactions ISO KIF2A (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of KIF2A mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of KIF2A mRNA CTD PMID:32699268 Kif2a Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of KIF2A mRNA CTD PMID:16483693 Kif2a Rat aristolochic acid A decreases expression ISO KIF2A (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of KIF2A mRNA CTD PMID:33212167 Kif2a Rat arsenite(3-) increases expression ISO Kif2a (Mus musculus) 6480464 arsenite results in increased expression of KIF2A protein CTD PMID:37955338 Kif2a Rat benzo[a]pyrene decreases methylation ISO KIF2A (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of KIF2A 3' UTR CTD PMID:27901495 Kif2a Rat benzo[a]pyrene increases expression ISO KIF2A (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of KIF2A mRNA CTD PMID:32234424 Kif2a Rat benzo[a]pyrene increases methylation ISO KIF2A (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of KIF2A promoter CTD PMID:27901495 Kif2a Rat benzo[a]pyrene diol epoxide I decreases expression ISO KIF2A (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 and PMID:20382639 Kif2a Rat bis(2-ethylhexyl) phthalate decreases expression ISO Kif2a (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of KIF2A mRNA CTD PMID:33754040 Kif2a Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of KIF2A mRNA CTD PMID:25181051 Kif2a Rat bisphenol A decreases expression ISO KIF2A (Homo sapiens) 6480464 bisphenol A results in decreased expression of KIF2A protein CTD PMID:37567409 Kif2a Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with tributyltin] results in decreased expression of KIF2A mRNA CTD PMID:31129395 Kif2a Rat bisphenol A affects localization ISO KIF2A (Homo sapiens) 6480464 bisphenol A affects the localization of KIF2A protein CTD PMID:30980863 Kif2a Rat bisphenol A decreases methylation ISO Kif2a (Mus musculus) 6480464 bisphenol A results in decreased methylation of KIF2A promoter CTD PMID:27312807 Kif2a Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of KIF2A mRNA CTD PMID:25181051 Kif2a Rat cadmium dichloride decreases expression ISO KIF2A (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of KIF2A mRNA CTD PMID:38568856 Kif2a Rat CGP 52608 multiple interactions ISO KIF2A (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to KIF2A gene] CTD PMID:28238834 Kif2a Rat clofibrate multiple interactions ISO Kif2a (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of KIF2A mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of KIF2A mRNA] CTD PMID:17585979 Kif2a Rat copper(II) sulfate increases expression ISO KIF2A (Homo sapiens) 6480464 Copper Sulfate results in increased expression of KIF2A mRNA CTD PMID:19549813 Kif2a Rat cyclosporin A increases expression ISO KIF2A (Homo sapiens) 6480464 Cyclosporine results in increased expression of KIF2A mRNA CTD PMID:20106945 and PMID:25562108 Kif2a Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of KIF2A mRNA CTD PMID:21266533 Kif2a Rat dibutyl phthalate affects expression EXP 6480464 Dibutyl Phthalate affects the expression of KIF2A mRNA CTD PMID:30934153 Kif2a Rat ethanol affects splicing ISO Kif2a (Mus musculus) 6480464 Ethanol affects the splicing of KIF2A mRNA CTD PMID:30319688 Kif2a Rat folic acid decreases expression ISO Kif2a (Mus musculus) 6480464 Folic Acid results in decreased expression of KIF2A mRNA CTD PMID:25629700 Kif2a Rat formaldehyde decreases expression ISO KIF2A (Homo sapiens) 6480464 Formaldehyde results in decreased expression of KIF2A mRNA CTD PMID:20655997 Kif2a Rat FR900359 affects phosphorylation ISO KIF2A (Homo sapiens) 6480464 FR900359 affects the phosphorylation of KIF2A protein CTD PMID:37730182 Kif2a Rat furan increases expression EXP 6480464 furan results in increased expression of KIF2A mRNA CTD PMID:26194646 Kif2a Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of KIF2A mRNA CTD PMID:22061828 Kif2a Rat hydrogen peroxide affects expression ISO KIF2A (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of KIF2A mRNA CTD PMID:20044591 Kif2a Rat hydrogen sulfide decreases expression ISO Kif2a (Mus musculus) 6480464 Hydrogen Sulfide results in decreased expression of KIF2A protein CTD PMID:29932956 Kif2a Rat indole-3-methanol multiple interactions EXP 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine] results in increased expression of KIF2A mRNA CTD PMID:22129741 Kif2a Rat ivermectin decreases expression ISO KIF2A (Homo sapiens) 6480464 Ivermectin results in decreased expression of KIF2A protein CTD PMID:32959892 Kif2a Rat lead(0) affects splicing ISO KIF2A (Homo sapiens) 6480464 Lead affects the splicing of KIF2A mRNA CTD PMID:28903495 Kif2a Rat lycopene increases expression ISO KIF2A (Homo sapiens) 6480464 lycopene results in increased expression of KIF2A mRNA CTD PMID:16886892 Kif2a Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine] results in increased expression of KIF2A mRNA CTD PMID:22129741 Kif2a Rat nickel atom increases expression ISO KIF2A (Homo sapiens) 6480464 Nickel results in increased expression of KIF2A mRNA CTD PMID:25583101 Kif2a Rat nitrates multiple interactions ISO Kif2a (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of KIF2A mRNA CTD PMID:35964746 Kif2a Rat ozone multiple interactions ISO KIF2A (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of KIF2A mRNA more ... CTD PMID:32699268 Kif2a Rat paracetamol multiple interactions ISO Kif2a (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of KIF2A mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of KIF2A mRNA] CTD PMID:17585979 Kif2a Rat paracetamol affects expression ISO Kif2a (Mus musculus) 6480464 Acetaminophen affects the expression of KIF2A mRNA CTD PMID:17562736 Kif2a Rat phenobarbital affects expression ISO KIF2A (Homo sapiens) 6480464 Phenobarbital affects the expression of KIF2A mRNA CTD PMID:19159669 Kif2a Rat phenobarbital affects expression ISO Kif2a (Mus musculus) 6480464 Phenobarbital affects the expression of KIF2A mRNA CTD PMID:23091169 Kif2a Rat quercetin decreases expression ISO KIF2A (Homo sapiens) 6480464 Quercetin results in decreased expression of KIF2A mRNA CTD PMID:21632981 Kif2a Rat sodium arsenite decreases expression ISO KIF2A (Homo sapiens) 6480464 sodium arsenite results in decreased expression of KIF2A mRNA CTD PMID:22714537 Kif2a Rat sodium fluoride increases expression ISO Kif2a (Mus musculus) 6480464 Sodium Fluoride results in increased expression of KIF2A protein CTD PMID:28918527 Kif2a Rat tamibarotene decreases expression ISO KIF2A (Homo sapiens) 6480464 tamibarotene results in decreased expression of KIF2A mRNA CTD PMID:15498508 Kif2a Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of KIF2A mRNA CTD PMID:23411599 and PMID:34492290 Kif2a Rat toluene increases expression EXP 6480464 Toluene results in increased expression of KIF2A mRNA CTD PMID:22166486 Kif2a Rat toluene decreases expression EXP 6480464 Toluene results in decreased expression of KIF2A mRNA CTD PMID:22166486 Kif2a Rat tributylstannane multiple interactions EXP 6480464 [bisphenol A co-treated with tributyltin] results in decreased expression of KIF2A mRNA CTD PMID:31129395 Kif2a Rat triphenyl phosphate affects expression ISO KIF2A (Homo sapiens) 6480464 triphenyl phosphate affects the expression of KIF2A mRNA CTD PMID:37042841 Kif2a Rat triptonide increases expression ISO Kif2a (Mus musculus) 6480464 triptonide results in increased expression of KIF2A mRNA CTD PMID:33045310 Kif2a Rat tungsten decreases expression ISO Kif2a (Mus musculus) 6480464 Tungsten results in decreased expression of KIF2A mRNA CTD PMID:30912803 Kif2a Rat valproic acid decreases expression ISO KIF2A (Homo sapiens) 6480464 Valproic Acid results in decreased expression of KIF2A mRNA CTD PMID:23179753 Kif2a Rat valproic acid increases expression ISO KIF2A (Homo sapiens) 6480464 Valproic Acid results in increased expression of KIF2A mRNA CTD PMID:29154799 Kif2a Rat valproic acid affects expression ISO KIF2A (Homo sapiens) 6480464 Valproic Acid affects the expression of KIF2A mRNA CTD PMID:25979313
Cellular Component
axon cytoplasm (IEA) centriolar subdistal appendage (IEA,ISO) centriole (IEA,ISO) centrosome (IBA,IEA,ISO) ciliary basal body (IEA,ISO) cytoplasm (IBA,IEA,ISO) cytoskeleton (IEA) cytosol (IEA,ISO) dendrite (IEA) GABA-ergic synapse (ISO) kinesin complex (IBA) microtubule (IBA,IEA,ISO) mitotic spindle (IEA,ISO) nuclear body (IEA,ISO) nucleolus (IEA,ISO) nucleoplasm (IEA,ISO) sperm principal piece (ISO) spindle (IBA,IEA) spindle microtubule (IEA,ISO,ISS) spindle pole (IEA,ISO,ISS)
1.
Identification of a novel human kinesin-related gene (HK2) by the cDNA differential display technique.
Debernardi S, etal., Genomics 1997 May 15;42(1):67-73.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
4.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.
KIF2 is a new microtubule-based anterograde motor that transports membranous organelles distinct from those carried by kinesin heavy chain or KIF3A/B.
Noda Y, etal., J Cell Biol. 1995 Apr;129(1):157-67. doi: 10.1083/jcb.129.1.157.
6.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
7.
GOA pipeline
RGD automated data pipeline
8.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
10.
TTBK2 with EB1/3 regulates microtubule dynamics in migrating cells through KIF2A phosphorylation.
Watanabe T, etal., J Cell Biol. 2015 Aug 31;210(5):737-51. doi: 10.1083/jcb.201412075.
Kif2a Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 40,101,548 - 40,164,780 (-) NCBI GRCr8 mRatBN7.2 2 38,367,998 - 38,431,237 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 38,367,998 - 38,431,508 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 45,491,535 - 45,554,753 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 43,550,214 - 43,613,432 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 38,397,498 - 38,460,714 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 38,145,507 - 38,208,765 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 38,147,601 - 38,208,719 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 57,240,240 - 57,302,984 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 38,079,564 - 38,143,398 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 38,002,008 - 38,013,924 (-) NCBI Celera 2 34,235,756 - 34,298,829 (-) NCBI Celera Cytogenetic Map 2 q13 NCBI
KIF2A Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 5 62,306,206 - 62,391,025 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 5 62,306,162 - 62,391,025 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 5 61,602,033 - 61,686,852 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 5 61,637,746 - 61,717,967 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 5 61,678,712 - 61,717,967 NCBI Celera 5 58,597,901 - 58,678,136 (+) NCBI Celera Cytogenetic Map 5 q12.1 NCBI HuRef 5 58,558,087 - 58,639,465 (+) NCBI HuRef CHM1_1 5 61,601,610 - 61,682,674 (+) NCBI CHM1_1 T2T-CHM13v2.0 5 63,125,434 - 63,210,585 (+) NCBI T2T-CHM13v2.0
Kif2a Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 13 107,095,504 - 107,158,931 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 13 107,095,504 - 107,158,634 (-) Ensembl GRCm39 Ensembl GRCm38 13 106,958,996 - 107,022,355 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 13 106,958,996 - 107,022,126 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 13 107,750,665 - 107,812,194 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 13 108,081,645 - 108,142,499 (-) NCBI MGSCv36 mm8 Celera 13 111,296,434 - 111,357,980 (-) NCBI Celera Cytogenetic Map 13 D2.1 NCBI cM Map 13 58.06 NCBI
Kif2a Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955446 6,244,547 - 6,279,089 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955446 6,244,547 - 6,279,080 (-) NCBI ChiLan1.0 ChiLan1.0
KIF2A Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 4 51,526,263 - 51,606,649 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 5 49,679,897 - 49,760,283 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 5 51,605,954 - 51,690,921 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 5 53,251,415 - 53,332,218 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 5 53,251,415 - 53,332,218 (-) Ensembl panpan1.1 panPan2
KIF2A Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 2 48,642,961 - 48,715,605 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 2 48,645,380 - 48,714,025 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 2 45,653,412 - 45,726,282 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 2 49,120,201 - 49,193,369 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 2 49,123,873 - 49,194,809 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 2 46,189,037 - 46,262,137 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 2 46,976,421 - 47,049,092 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 2 47,832,428 - 47,905,530 (+) NCBI UU_Cfam_GSD_1.0
Kif2a Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024407213 197,386,873 - 197,421,209 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936480 6,324,216 - 6,357,741 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936480 6,324,214 - 6,357,696 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
KIF2A
KIF2A Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 4 58,486,642 - 58,566,732 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 4 58,486,723 - 58,565,117 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666049 7,016,680 - 7,100,358 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Kif2a
.
Predicted Target Of
Count of predictions: 138 Count of miRNA genes: 67 Interacting mature miRNAs: 68 Transcripts: ENSRNOT00000019189, ENSRNOT00000019225 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
10755430 Coatc6 Coat color QTL 6 0.02576 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 2 11591100 56591100 Rat 7387318 Stl32 Serum triglyceride level QTL 32 3.2 0.0003 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 2 22384627 67384627 Rat 10755436 Coatc8 Coat color QTL 8 0.02431 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 2 35023117 80023117 Rat 10755434 Coatc7 Coat color QTL 7 0.04794 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 2 30648065 75648065 Rat 10755499 Bp389 Blood pressure QTL 389 2.61 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 18960362 228801039 Rat 738010 Lnnr3 Liver neoplastic nodule remodeling QTL 3 2.94 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number (CMO:0001461) 2 1 41244106 Rat 1358917 Cm42 Cardiac mass QTL 42 2.82 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 1300160 Hrtrt3 Heart rate QTL 3 3.62 heart pumping trait (VT:2000009) absolute change in heart rate (CMO:0000534) 2 29971593 51729300 Rat 731167 Glom4 Glomerulus QTL 4 2.4 0.0082 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 2 20304672 65304672 Rat 1358913 Cm41 Cardiac mass QTL 41 2.73 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 738012 Anxrr3 Anxiety related response QTL 3 3.8 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 2 9023519 54023519 Rat 1302794 Stl27 Serum triglyceride level QTL 27 4.4 0.0001 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 2 25413423 143657569 Rat 10402051 Gdil2 Gastrointestinal dilation QTL 2 enteric ganglion morphology trait (VT:0001045) length of intestine affected by colonic aganglionosis to total length of colon ratio (CMO:0001836) 2 24903853 74786777 Rat 9590095 Sffal3 Serum free fatty acids level QTL 3 6.78 0.001 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 2 27157160 72157160 Rat 1331764 Bp205 Blood pressure QTL 205 3.476 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 26999571 43154682 Rat 731179 Mamtr3 Mammary tumor resistance QTL 3 0.0001 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 2 32373770 43665178 Rat 1358901 Cm38 Cardiac mass QTL 38 2 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 157142209 Rat 1600379 Mcs18 Mammary carcinoma susceptibility QTL 18 2.6 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 2 7887772 42804738 Rat 1358899 Kidm23 Kidney mass QTL 23 3.88 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1643006 Pain1 Pain QTL 1 3.63 0.005 mechanical nociception trait (VT:0002734) self mutilation severity score (CMO:0002145) 2 26999571 48268661 Rat 1358908 Bw49 Body weight QTL 49 3.36 body mass (VT:0001259) body weight (CMO:0000012) 2 25413652 157142078 Rat 1358910 Kidm27 Kidney mass QTL 27 5.77 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 61355 Bp36 Blood pressure QTL 36 2.9 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 2 5873687 102844969 Rat 2300168 Bmd47 Bone mineral density QTL 47 6.6 0.0001 femur mineral mass (VT:0010011) bone mineral density (CMO:0001226) 2 20662448 65662448 Rat 1358911 Kidm28 Kidney mass QTL 28 5.42 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1358904 Cm39 Cardiac mass QTL 39 2.26 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 157142209 Rat 1354617 Bp240 Blood pressure QTL 240 4 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 26917817 81754745 Rat 1578664 Bmd9 Bone mineral QTL density 9 5 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 2 11852062 49003364 Rat 1357990 Ael1 Aortic elastin QTL 1 3.1 0.00091 aorta elastin amount (VT:0003905) aortic elastin 2 19076825 64076825 Rat 1358887 Bw50 Body weight QTL 50 2.39 body mass (VT:0001259) body weight (CMO:0000012) 2 25413652 157142078 Rat 2290453 Scl55 Serum cholesterol level QTL 55 2.83 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 2 26917817 136917119 Rat 152025206 Hrtrt23 Heart rate QTL 23 5.98 heart pumping trait (VT:2000009) 2 28484589 169504100 Rat 1358894 Kidm24 Kidney mass QTL 24 4.03 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 731184 Mamtr4 Mammary tumor resistance QTL 4 0.0003 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 2 16491740 61491740 Rat 152025204 Hrtrt22 Heart rate QTL 22 5.6 heart pumping trait (VT:2000009) 2 28484589 169504100 Rat 61371 Edpm1 Estrogen-dependent pituitary mass QTL 1 4 0.05 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 2 35134841 88029593 Rat 1354603 Bp243 Blood pressure QTL 243 3.9 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 26917817 127469484 Rat
RH132232
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 38,368,260 - 38,368,452 (+) MAPPER mRatBN7.2 Rnor_6.0 2 38,145,770 - 38,145,961 NCBI Rnor6.0 Rnor_5.0 2 57,240,503 - 57,240,694 UniSTS Rnor5.0 RGSC_v3.4 2 38,079,827 - 38,080,018 UniSTS RGSC3.4 Celera 2 34,236,019 - 34,236,210 UniSTS RH 3.4 Map 2 177.2 UniSTS Cytogenetic Map 2 q14 UniSTS
RH139596
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 38,367,968 - 38,368,164 (+) MAPPER mRatBN7.2 Rnor_6.0 2 38,145,478 - 38,145,673 NCBI Rnor6.0 Rnor_5.0 2 57,240,211 - 57,240,406 UniSTS Rnor5.0 RGSC_v3.4 2 38,079,535 - 38,079,730 UniSTS RGSC3.4 Celera 2 34,235,727 - 34,235,922 UniSTS RH 3.4 Map 2 177.4 UniSTS Cytogenetic Map 2 q14 UniSTS
RH140326
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 38,369,417 - 38,369,665 (+) MAPPER mRatBN7.2 Rnor_6.0 2 38,146,927 - 38,147,174 NCBI Rnor6.0 Rnor_5.0 2 57,241,660 - 57,241,907 UniSTS Rnor5.0 RGSC_v3.4 2 38,080,984 - 38,081,231 UniSTS RGSC3.4 Celera 2 34,237,176 - 34,237,423 UniSTS RH 3.4 Map 2 179.4 UniSTS Cytogenetic Map 2 q14 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000019189 ⟹ ENSRNOP00000019189
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 38,367,998 - 38,431,508 (-) Ensembl Rnor_6.0 Ensembl 2 38,147,601 - 38,208,719 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000093988 ⟹ ENSRNOP00000095843
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 38,367,998 - 38,402,893 (-) Ensembl
RefSeq Acc Id:
NM_053376 ⟹ NP_445828
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 40,101,548 - 40,164,780 (-) NCBI mRatBN7.2 2 38,367,998 - 38,431,237 (-) NCBI Rnor_6.0 2 38,145,507 - 38,208,765 (-) NCBI Rnor_5.0 2 57,240,240 - 57,302,984 (-) NCBI Celera 2 34,235,756 - 34,298,829 (-) NCBI
Sequence:
TCCCCGTCTGTTTCGCCCGCCCGCCGCCGCCGCTCCGGATGAGGTGATGGCAACGGCTAACTTCGGCAAGATCCAGATCGGGATTTACGTGGAAATCAAGCGCAGCGATGGCCGAATACACCAGGCAA
hide sequence
RefSeq Acc Id:
NP_445828 ⟸ NM_053376
- UniProtKB:
Q9WV63 (UniProtKB/Swiss-Prot), Q5BJW1 (UniProtKB/Swiss-Prot), A6I5H9 (UniProtKB/TrEMBL)
- Sequence:
MATANFGKIQIGIYVEIKRSDGRIHQAMVTSLNEDNESVTVEWIENGDTKGKEIDLESIFSLNPDLVPDEDIEPSPEIPPPSSSSKVNKIVKNRRTVASIKNDPPPRDNRVVGSARARPSQLPEQSSS
hide sequence
Ensembl Acc Id:
ENSRNOP00000019189 ⟸ ENSRNOT00000019189
Ensembl Acc Id:
ENSRNOP00000095843 ⟸ ENSRNOT00000093988
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-06-22
Kif2a
kinesin family member 2A
Kif2a
kinesin heavy chain member 2A
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2013-01-29
Kif2a
kinesin heavy chain member 2A
Kif2a
kinesin family member 2A
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-02-18
Kif2a
kinesin family member 2A
Kif2
kinesin heavy chain family, member 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-11-17
Kif2
kinesin heavy chain family, member 2
kinesin heavy chain member 2
Name updated
1299863 APPROVED
2002-07-09
Kif2
kinesin heavy chain member 2
Symbol and Name updated to reflect Human and Mouse nomenclature
70877 APPROVED
Note Type
Note
Reference
gene_function
essential for the bipolarity of spindle assembly in cultured non-neuronal human, frog and hamster cells during mitosis
1358126
gene_function
in mouse brain, involved in suppression of collateral branch extension during neuronal development, possibly by depolymerizing microtubules at the growth cone edge
1358127
