Advanced Search (OLGA)

Gene: Sult1b1 (sulfotransferase family 1B member 1) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Sult1b1

Name:

sulfotransferase family 1B member 1

RGD ID:

708534

Description:

Enables aryl sulfotransferase activity. Involved in sulfation and thyroid hormone metabolic process. Predicted to be active in cytoplasm. Orthologous to human SULT1B1 (sulfotransferase family 1B member 1); INTERACTS WITH (+)-schisandrin B; 17beta-estradiol; 2,2',4,4'-Tetrabromodiphenyl ether.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

dopa/tyrosine sulfotransferase; LOC64305; ST1B1; sulfotransferase 1B1; sulfotransferase family 1B, member 1; sulfotransferase family cytosolic 1B member 1; sulfotransferase family, cytosolic, 1B, member 1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	20,771,917 - 20,784,665 (+)	NCBI		GRCr8
mRatBN7.2	14	20,492,763 - 20,505,491 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	20,492,708 - 20,505,483 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	14	20,680,971 - 20,693,727 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	21,999,886 - 22,012,644 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	20,755,290 - 20,768,011 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	22,142,412 - 22,155,246 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	22,142,364 - 22,155,231 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	14	22,057,298 - 22,070,533 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	14	22,019,193 - 22,031,914 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	14	22,019,200 - 22,031,908 (+)	NCBI
Celera	14	19,895,061 - 19,907,795 (+)	NCBI		Celera
Cytogenetic Map	14	p21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Sult1b1	Rat	autism spectrum disorder		ISO	SULT1B1 (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:35663546

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Sult1b1	Rat	(+)-schisandrin B	multiple interactions	EXP		6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of SULT1B1 mRNA]	CTD	PMID:31150632
Sult1b1	Rat	1,1-dichloroethene	increases expression	ISO	Sult1b1 (Mus musculus)	6480464	vinylidene chloride results in increased expression of SULT1B1 mRNA	CTD	PMID:26682919
Sult1b1	Rat	1,2-dichloroethane	decreases expression	ISO	Sult1b1 (Mus musculus)	6480464	ethylene dichloride results in decreased expression of SULT1B1 mRNA	CTD	PMID:28189721 and PMID:28960355
Sult1b1	Rat	1,2-dimethylhydrazine	decreases expression	ISO	Sult1b1 (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in decreased expression of SULT1B1 mRNA	CTD	PMID:22206623
Sult1b1	Rat	1-Hydroxypyrene	increases metabolic processing	ISO	SULT1B1 (Homo sapiens)	6480464	SULT1B1 protein results in increased metabolism of 1-hydroxypyrene	CTD	PMID:24140465
Sult1b1	Rat	17alpha-ethynylestradiol	increases metabolic processing	ISO	SULT1B1 (Homo sapiens)	6480464	SULT1B1 protein results in increased metabolism of Ethinyl Estradiol	CTD	PMID:10623578
Sult1b1	Rat	17beta-estradiol	decreases expression	EXP		6480464	Estradiol results in decreased expression of SULT1B1 mRNA	CTD	PMID:32145629
Sult1b1	Rat	17beta-estradiol	decreases expression	ISO	Sult1b1 (Mus musculus)	6480464	Estradiol results in decreased expression of SULT1B1 mRNA	CTD	PMID:39298647
Sult1b1	Rat	1H-pyrazole	decreases expression	ISO	Sult1b1 (Mus musculus)	6480464	pyrazole results in decreased expression of SULT1B1 mRNA	CTD	PMID:17945193
Sult1b1	Rat	2,2',4,4',5,5'-hexachlorobiphenyl	multiple interactions	ISO	Sult1b1 (Mus musculus)	6480464	[Tetrachlorodibenzodioxin co-treated with 2 more ...	CTD	PMID:28433925
Sult1b1	Rat	2,2',4,4'-Tetrabromodiphenyl ether	increases expression	EXP		6480464	2 more ...	CTD	PMID:20056577
Sult1b1	Rat	2,2',4,4'-Tetrabromodiphenyl ether	affects expression	ISO	Sult1b1 (Mus musculus)	6480464	2 more ...	CTD	PMID:30294300
Sult1b1	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	SULT1B1 (Homo sapiens)	6480464	Tetrachlorodibenzodioxin results in increased expression of SULT1B1 mRNA	CTD	PMID:21296121
Sult1b1	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	Sult1b1 (Mus musculus)	6480464	[Tetrachlorodibenzodioxin co-treated with 2 more ...	CTD	PMID:28433925
Sult1b1	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of SULT1B1 mRNA	CTD	PMID:19692669 more ...
Sult1b1	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of SULT1B1 mRNA	CTD	PMID:22659317
Sult1b1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	EXP		6480464	Tetrachlorodibenzodioxin affects the expression of SULT1B1 mRNA	CTD	PMID:22298810
Sult1b1	Rat	2,4,6-trinitrotoluene	affects expression	EXP		6480464	Trinitrotoluene affects the expression of SULT1B1 mRNA	CTD	PMID:21346803
Sult1b1	Rat	2-Amino-3-methyl-9H-pyrido[2,3-b]indole	increases activity	ISO	SULT1B1 (Homo sapiens)	6480464	SULT1B1 protein results in increased activity of 2-amino-3-methyl-9H-pyrido(2 and 3-b)indole	CTD	PMID:14729582
Sult1b1	Rat	3,3',4,4',5-pentachlorobiphenyl	decreases expression	EXP		6480464	3 more ...	CTD	PMID:19692669
Sult1b1	Rat	3,4-dichloroaniline	increases expression	EXP		6480464	3 and 4-dichloroaniline results in increased expression of SULT1B1 mRNA	CTD	PMID:24172598
Sult1b1	Rat	3-methyl-3H-imidazo[4,5-f]quinolin-2-amine	increases expression	ISO	SULT1B1 (Homo sapiens)	6480464	2-amino-3-methylimidazo(4 and 5-f)quinoline results in increased expression of SULT1B1 mRNA	CTD	PMID:31542801
Sult1b1	Rat	4,4'-sulfonyldiphenol	decreases expression	ISO	Sult1b1 (Mus musculus)	6480464	bisphenol S results in decreased expression of SULT1B1 mRNA	CTD	PMID:39298647
Sult1b1	Rat	4-nitrophenol	increases metabolic processing	ISO	SULT1B1 (Homo sapiens)	6480464	SULT1B1 protein results in increased metabolism of 4-nitrophenol	CTD	PMID:10623578
Sult1b1	Rat	4-nonylphenol	increases metabolic processing	ISO	SULT1B1 (Homo sapiens)	6480464	SULT1B1 protein results in increased metabolism of 4-nonylphenol	CTD	PMID:10623578
Sult1b1	Rat	4-octylphenol	increases metabolic processing	ISO	SULT1B1 (Homo sapiens)	6480464	SULT1B1 protein results in increased metabolism of 4-octylphenol	CTD	PMID:10623578
Sult1b1	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of SULT1B1 mRNA	CTD	PMID:30047161
Sult1b1	Rat	aflatoxin B1	decreases expression	ISO	SULT1B1 (Homo sapiens)	6480464	Aflatoxin B1 results in decreased expression of SULT1B1 mRNA	CTD	PMID:22100608 and PMID:27153756
Sult1b1	Rat	aflatoxin B1	increases expression	ISO	SULT1B1 (Homo sapiens)	6480464	Aflatoxin B1 results in increased expression of SULT1B1 mRNA	CTD	PMID:31542801
Sult1b1	Rat	alpha-hexachlorocyclohexane	increases expression	EXP		6480464	alpha-hexachlorocyclohexane results in increased expression of SULT1B1 mRNA	CTD	PMID:16940010
Sult1b1	Rat	amitrole	increases expression	EXP		6480464	Amitrole results in increased expression of SULT1B1 mRNA	CTD	PMID:30047161
Sult1b1	Rat	ammonium chloride	affects expression	EXP		6480464	Ammonium Chloride affects the expression of SULT1B1 mRNA	CTD	PMID:16483693
Sult1b1	Rat	aristolochic acid A	multiple interactions	EXP		6480464	[aristolochic acid I co-treated with aristolochic acid II] results in increased expression of SULT1B1 mRNA	CTD	PMID:23912714
Sult1b1	Rat	Aroclor 1254	increases expression	EXP		6480464	Chlorodiphenyl (54% Chlorine) results in increased expression of SULT1B1 mRNA	CTD	PMID:22659317
Sult1b1	Rat	arsane	increases methylation	ISO	SULT1B1 (Homo sapiens)	6480464	Arsenic results in increased methylation of SULT1B1 gene	CTD	PMID:24525453
Sult1b1	Rat	arsenic atom	increases methylation	ISO	SULT1B1 (Homo sapiens)	6480464	Arsenic results in increased methylation of SULT1B1 gene	CTD	PMID:24525453
Sult1b1	Rat	Azoxymethane	multiple interactions	ISO	Sult1b1 (Mus musculus)	6480464	[titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of SULT1B1 mRNA	CTD	PMID:29950665
Sult1b1	Rat	benzo[a]pyrene	increases expression	ISO	Sult1b1 (Mus musculus)	6480464	Benzo(a)pyrene results in increased expression of SULT1B1 mRNA	CTD	PMID:19770486
Sult1b1	Rat	benzo[a]pyrene	decreases expression	ISO	SULT1B1 (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased expression of SULT1B1 mRNA	CTD	PMID:32234424
Sult1b1	Rat	benzo[a]pyrene	increases methylation	ISO	SULT1B1 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased methylation of SULT1B1 5' UTR	CTD	PMID:27901495
Sult1b1	Rat	benzo[a]pyrene	increases expression	ISO	SULT1B1 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased expression of SULT1B1 mRNA	CTD	PMID:22316170 and PMID:31542801
Sult1b1	Rat	benzyl alcohol	increases sulfation	ISO	SULT1B1 (Homo sapiens)	6480464	SULT1B1 protein results in increased sulfation of Benzyl Alcohol	CTD	PMID:26663444
Sult1b1	Rat	bexarotene	decreases expression	EXP		6480464	bexarotene results in decreased expression of SULT1B1 mRNA	CTD	PMID:16648578
Sult1b1	Rat	bis(2-ethylhexyl) phthalate	multiple interactions	ISO	Sult1b1 (Mus musculus)	6480464	[Tetrachlorodibenzodioxin co-treated with 2 more ...	CTD	PMID:28433925
Sult1b1	Rat	bisphenol A	decreases expression	ISO	SULT1B1 (Homo sapiens)	6480464	bisphenol A results in decreased expression of SULT1B1 mRNA	CTD	PMID:24214726
Sult1b1	Rat	bisphenol A	multiple interactions	ISO	SULT1B1 (Homo sapiens)	6480464	[bisphenol A co-treated with Fulvestrant] results in increased methylation of SULT1B1 gene	CTD	PMID:31601247
Sult1b1	Rat	bisphenol A	increases methylation	ISO	SULT1B1 (Homo sapiens)	6480464	bisphenol A results in increased methylation of SULT1B1 gene	CTD	PMID:31601247
Sult1b1	Rat	bisphenol A	increases expression	ISO	Sult1b1 (Mus musculus)	6480464	bisphenol A results in increased expression of SULT1B1 mRNA	CTD	PMID:38074096
Sult1b1	Rat	bisphenol A	affects expression	EXP		6480464	bisphenol A affects the expression of SULT1B1 mRNA	CTD	PMID:30903817
Sult1b1	Rat	bisphenol A	multiple interactions	ISO	Sult1b1 (Mus musculus)	6480464	[Tetrachlorodibenzodioxin co-treated with 2 more ...	CTD	PMID:28433925
Sult1b1	Rat	bisphenol A	increases metabolic processing	ISO	SULT1B1 (Homo sapiens)	6480464	SULT1B1 protein results in increased metabolism of bisphenol A	CTD	PMID:10623578
Sult1b1	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of SULT1B1 mRNA	CTD	PMID:25181051 and PMID:32145629
Sult1b1	Rat	bromobenzene	affects binding	EXP		6480464	bromobenzene metabolite binds to SULT1B1 protein	CTD	PMID:17305373
Sult1b1	Rat	cadmium dichloride	increases methylation	EXP		6480464	Cadmium Chloride results in increased methylation of SULT1B1 promoter	CTD	PMID:22457795
Sult1b1	Rat	calcitriol	decreases expression	ISO	SULT1B1 (Homo sapiens)	6480464	Calcitriol results in decreased expression of SULT1B1 mRNA	CTD	PMID:27107558
Sult1b1	Rat	captan	multiple interactions	ISO	Sult1b1 (Mus musculus)	6480464	[Dietary Fats co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Captan co-treated with Chlorpyrifos co-treated with thiacloprid co-treated with Thiophanate co-treated with Ziram] results in increased expression of SULT1B1 mRNA	CTD	PMID:32745781
Sult1b1	Rat	captan	increases expression	ISO	Sult1b1 (Mus musculus)	6480464	Captan results in increased expression of SULT1B1 mRNA	CTD	PMID:31558096
Sult1b1	Rat	carbon nanotube	increases expression	ISO	SULT1B1 (Homo sapiens)	6480464	Nanotubes and Carbon results in increased expression of SULT1B1 mRNA	CTD	PMID:25102311
Sult1b1	Rat	chenodeoxycholic acid	decreases expression	ISO	SULT1B1 (Homo sapiens)	6480464	Chenodeoxycholic Acid results in decreased expression of SULT1B1 mRNA	CTD	PMID:27174168
Sult1b1	Rat	chlorohydrocarbon	multiple interactions	EXP		6480464	[Hydrocarbons more ...	CTD	PMID:30744511
Sult1b1	Rat	chlorpyrifos	multiple interactions	ISO	Sult1b1 (Mus musculus)	6480464	[Dietary Fats co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Captan co-treated with Chlorpyrifos co-treated with thiacloprid co-treated with Thiophanate co-treated with Ziram] results in increased expression of SULT1B1 mRNA	CTD	PMID:32745781
Sult1b1	Rat	chromium(6+)	affects expression	ISO	Sult1b1 (Mus musculus)	6480464	chromium hexavalent ion affects the expression of SULT1B1 mRNA	CTD	PMID:28472532
Sult1b1	Rat	cisplatin	increases expression	EXP		6480464	Cisplatin results in increased expression of SULT1B1 mRNA	CTD	PMID:22023808
Sult1b1	Rat	clofibrate	decreases expression	ISO	Sult1b1 (Mus musculus)	6480464	Clofibrate results in decreased expression of SULT1B1 mRNA	CTD	PMID:17585979
Sult1b1	Rat	cobalt dichloride	decreases expression	ISO	SULT1B1 (Homo sapiens)	6480464	cobaltous chloride results in decreased expression of SULT1B1 mRNA	CTD	PMID:19320972
Sult1b1	Rat	copper atom	decreases expression	EXP		6480464	Copper deficiency results in decreased expression of SULT1B1 mRNA and Copper results in decreased expression of SULT1B1 mRNA	CTD	PMID:19821111 and PMID:22465980
Sult1b1	Rat	copper(0)	decreases expression	EXP		6480464	Copper deficiency results in decreased expression of SULT1B1 mRNA and Copper results in decreased expression of SULT1B1 mRNA	CTD	PMID:19821111 and PMID:22465980
Sult1b1	Rat	coumarin	affects expression	EXP		6480464	coumarin affects the expression of SULT1B1 mRNA	CTD	PMID:16963487
Sult1b1	Rat	crocidolite asbestos	increases expression	ISO	SULT1B1 (Homo sapiens)	6480464	Asbestos and Crocidolite results in increased expression of SULT1B1 mRNA	CTD	PMID:25351596
Sult1b1	Rat	cyclosporin A	decreases expression	ISO	Sult1b1 (Mus musculus)	6480464	Cyclosporine results in decreased expression of SULT1B1 mRNA	CTD	PMID:19770486
Sult1b1	Rat	cyclosporin A	decreases expression	ISO	SULT1B1 (Homo sapiens)	6480464	Cyclosporine results in decreased expression of SULT1B1 mRNA	CTD	PMID:27989131 and PMID:33631201
Sult1b1	Rat	cyproconazole	decreases expression	ISO	SULT1B1 (Homo sapiens)	6480464	cyproconazole results in decreased expression of SULT1B1 mRNA	CTD	PMID:29995386
Sult1b1	Rat	dexamethasone	increases expression	EXP		6480464	Dexamethasone results in increased expression of SULT1B1 mRNA	CTD	PMID:26739637
Sult1b1	Rat	dextran sulfate	multiple interactions	ISO	Sult1b1 (Mus musculus)	6480464	[titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of SULT1B1 mRNA	CTD	PMID:29950665
Sult1b1	Rat	dichlorine	multiple interactions	EXP		6480464	[Ozone co-treated with Chlorine] affects the expression of SULT1B1 mRNA	CTD	PMID:18636392
Sult1b1	Rat	dichlorine	decreases expression	EXP		6480464	Chlorine results in decreased expression of SULT1B1 mRNA	CTD	PMID:18636392
Sult1b1	Rat	diethyl hydrogen phosphate	decreases expression	EXP		6480464	diethyl phosphate results in decreased expression of SULT1B1 mRNA	CTD	PMID:31835022
Sult1b1	Rat	diethylstilbestrol	increases metabolic processing	ISO	SULT1B1 (Homo sapiens)	6480464	SULT1B1 protein results in increased metabolism of Diethylstilbestrol	CTD	PMID:10623578
Sult1b1	Rat	diethylstilbestrol	increases expression	EXP		6480464	Diethylstilbestrol results in increased expression of SULT1B1 mRNA	CTD	PMID:36653537
Sult1b1	Rat	dimethylarsinic acid	increases expression	EXP		6480464	Cacodylic Acid results in increased expression of SULT1B1 mRNA	CTD	PMID:37567419
Sult1b1	Rat	dimethylarsinous acid	decreases expression	ISO	SULT1B1 (Homo sapiens)	6480464	dimethylarsinous acid results in decreased expression of SULT1B1 mRNA	CTD	PMID:23876855
Sult1b1	Rat	diuron	increases expression	EXP		6480464	Diuron metabolite results in increased expression of SULT1B1 mRNA	CTD	PMID:24172598
Sult1b1	Rat	endosulfan	decreases expression	EXP		6480464	Endosulfan results in decreased expression of SULT1B1 mRNA	CTD	PMID:29391264
Sult1b1	Rat	enilconazole	decreases expression	ISO	SULT1B1 (Homo sapiens)	6480464	enilconazole results in decreased expression of SULT1B1 mRNA	CTD	PMID:32201337
Sult1b1	Rat	fipronil	increases expression	EXP		6480464	fipronil results in increased expression of SULT1B1 mRNA	CTD	PMID:22447239 and PMID:23962444
Sult1b1	Rat	fipronil	multiple interactions	ISO	SULT1B1 (Homo sapiens)	6480464	[fipronil co-treated with DEET] results in decreased expression of SULT1B1 mRNA	CTD	PMID:27091632
Sult1b1	Rat	fipronil	decreases expression	ISO	SULT1B1 (Homo sapiens)	6480464	fipronil results in decreased expression of SULT1B1 mRNA	CTD	PMID:27091632
Sult1b1	Rat	fipronil	increases expression	ISO	Sult1b1 (Mus musculus)	6480464	fipronil results in increased expression of SULT1B1 mRNA	CTD	PMID:23962444
Sult1b1	Rat	fipronil-sulfone	increases expression	EXP		6480464	fipronil sulfone results in increased expression of SULT1B1 mRNA	CTD	PMID:22447239
Sult1b1	Rat	flutamide	decreases expression	EXP		6480464	Flutamide results in decreased expression of SULT1B1 mRNA	CTD	PMID:24793618
Sult1b1	Rat	folpet	increases expression	ISO	Sult1b1 (Mus musculus)	6480464	folpet results in increased expression of SULT1B1 mRNA	CTD	PMID:31558096
Sult1b1	Rat	fulvestrant	multiple interactions	ISO	SULT1B1 (Homo sapiens)	6480464	[bisphenol A co-treated with Fulvestrant] results in increased methylation of SULT1B1 gene	CTD	PMID:31601247
Sult1b1	Rat	glafenine	decreases expression	EXP		6480464	Glafenine results in decreased expression of SULT1B1 mRNA	CTD	PMID:24136188
Sult1b1	Rat	gliotoxin	decreases expression	EXP		6480464	Gliotoxin results in decreased expression of SULT1B1 mRNA	CTD	PMID:18346771
Sult1b1	Rat	inulin	multiple interactions	ISO	Sult1b1 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of SULT1B1 mRNA	CTD	PMID:36331819
Sult1b1	Rat	isoprenaline	decreases expression	ISO	Sult1b1 (Mus musculus)	6480464	Isoproterenol results in decreased expression of SULT1B1 mRNA	CTD	PMID:21335049
Sult1b1	Rat	kojic acid	multiple interactions	EXP		6480464	[Diethylnitrosamine co-treated with kojic acid co-treated with Diethylnitrosamine] results in decreased expression of SULT1B1 mRNA and [Diethylnitrosamine co-treated with kojic acid] results in increased expression of SULT1B1 mRNA	CTD	PMID:18544905
Sult1b1	Rat	lidocaine	increases sulfation	ISO	SULT1B1 (Homo sapiens)	6480464	SULT1B1 protein results in increased sulfation of Lidocaine metabolite	CTD	PMID:10460806
Sult1b1	Rat	lipopolysaccharide	decreases expression	ISO	SULT1B1 (Homo sapiens)	6480464	Lipopolysaccharides results in decreased expression of SULT1B1 mRNA	CTD	PMID:35811015
Sult1b1	Rat	lipopolysaccharide	multiple interactions	ISO	SULT1B1 (Homo sapiens)	6480464	[S-(1 more ...	CTD	PMID:35811015
Sult1b1	Rat	methimazole	increases expression	EXP		6480464	Methimazole results in increased expression of SULT1B1 mRNA	CTD	PMID:30047161
Sult1b1	Rat	methylmercury chloride	multiple interactions	EXP		6480464	[Hydrocarbons more ...	CTD	PMID:30744511
Sult1b1	Rat	microcystin-LR	increases expression	ISO	Sult1b1 (Mus musculus)	6480464	cyanoginosin LR results in increased expression of SULT1B1 protein	CTD	PMID:26984711
Sult1b1	Rat	N,N-diethyl-m-toluamide	multiple interactions	ISO	SULT1B1 (Homo sapiens)	6480464	[fipronil co-treated with DEET] results in decreased expression of SULT1B1 mRNA	CTD	PMID:27091632
Sult1b1	Rat	N-nitrosodiethylamine	multiple interactions	EXP		6480464	[Diethylnitrosamine co-treated with kojic acid co-treated with Diethylnitrosamine] results in decreased expression of SULT1B1 mRNA and [Diethylnitrosamine co-treated with kojic acid] results in increased expression of SULT1B1 mRNA	CTD	PMID:18544905
Sult1b1	Rat	N-nitrosodiethylamine	decreases expression	ISO	Sult1b1 (Mus musculus)	6480464	Diethylnitrosamine results in decreased expression of SULT1B1 mRNA	CTD	PMID:24535843
Sult1b1	Rat	N-nitrosomorpholine	increases expression	EXP		6480464	N-nitrosomorpholine results in increased expression of SULT1B1 protein	CTD	PMID:19716841
Sult1b1	Rat	nefazodone	increases expression	EXP		6480464	nefazodone results in increased expression of SULT1B1 mRNA	CTD	PMID:24136188
Sult1b1	Rat	nickel atom	decreases expression	ISO	SULT1B1 (Homo sapiens)	6480464	Nickel results in decreased expression of SULT1B1 mRNA	CTD	PMID:23195993
Sult1b1	Rat	nickel dichloride	affects expression	EXP		6480464	nickel chloride affects the expression of SULT1B1 mRNA	CTD	PMID:22110744
Sult1b1	Rat	O-methyleugenol	decreases expression	ISO	SULT1B1 (Homo sapiens)	6480464	methyleugenol results in decreased expression of SULT1B1 mRNA	CTD	PMID:32234424
Sult1b1	Rat	ozone	multiple interactions	EXP		6480464	[Ozone co-treated with Chlorine] affects the expression of SULT1B1 mRNA	CTD	PMID:18636392
Sult1b1	Rat	paracetamol	affects expression	ISO	Sult1b1 (Mus musculus)	6480464	Acetaminophen affects the expression of SULT1B1 mRNA	CTD	PMID:17562736
Sult1b1	Rat	paracetamol	increases expression	EXP		6480464	Acetaminophen results in increased expression of SULT1B1 mRNA	CTD	PMID:32479839
Sult1b1	Rat	paracetamol	decreases expression	ISO	SULT1B1 (Homo sapiens)	6480464	Acetaminophen results in decreased expression of SULT1B1 mRNA	CTD	PMID:29067470
Sult1b1	Rat	paracetamol	decreases expression	EXP		6480464	Acetaminophen results in decreased expression of SULT1B1 mRNA	CTD	PMID:17126469 more ...
Sult1b1	Rat	paracetamol	multiple interactions	EXP		6480464	[Acetaminophen co-treated with Uranium analog] results in decreased expression of SULT1B1 mRNA	CTD	PMID:17126469
Sult1b1	Rat	perfluorobutanesulfonic acid	increases expression	ISO	SULT1B1 (Homo sapiens)	6480464	perfluorobutanesulfonic acid results in increased expression of SULT1B1 mRNA	CTD	PMID:33772556
Sult1b1	Rat	perfluorooctane-1-sulfonic acid	decreases expression	ISO	SULT1B1 (Homo sapiens)	6480464	perfluorooctane sulfonic acid results in decreased expression of SULT1B1 mRNA	CTD	PMID:27153767
Sult1b1	Rat	perfluorooctane-1-sulfonic acid	increases expression	ISO	SULT1B1 (Homo sapiens)	6480464	perfluorooctane sulfonic acid results in increased expression of SULT1B1 mRNA	CTD	PMID:33772556
Sult1b1	Rat	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	Sult1b1 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of SULT1B1 mRNA	CTD	PMID:36331819
Sult1b1	Rat	perfluorooctanoic acid	increases expression	ISO	SULT1B1 (Homo sapiens)	6480464	perfluorooctanoic acid results in increased expression of SULT1B1 mRNA	CTD	PMID:32588087 and PMID:33772556
Sult1b1	Rat	phenobarbital	decreases expression	ISO	SULT1B1 (Homo sapiens)	6480464	Phenobarbital results in decreased expression of SULT1B1 mRNA	CTD	PMID:22258563
Sult1b1	Rat	PhIP	increases expression	ISO	SULT1B1 (Homo sapiens)	6480464	2-amino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine results in increased expression of SULT1B1 mRNA	CTD	PMID:31542801
Sult1b1	Rat	pirinixic acid	multiple interactions	ISO	SULT1B1 (Homo sapiens)	6480464	[pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of SULT1B1 mRNA	CTD	PMID:19710929
Sult1b1	Rat	pirinixic acid	decreases expression	ISO	Sult1b1 (Mus musculus)	6480464	pirinixic acid results in decreased expression of SULT1B1 mRNA	CTD	PMID:16221962 more ...
Sult1b1	Rat	pirinixic acid	multiple interactions	ISO	Sult1b1 (Mus musculus)	6480464	PPARA protein promotes the reaction [pirinixic acid results in decreased expression of SULT1B1 mRNA]	CTD	PMID:20059764
Sult1b1	Rat	pregnenolone 16alpha-carbonitrile	increases expression	EXP		6480464	Pregnenolone Carbonitrile results in increased expression of SULT1B1 mRNA	CTD	PMID:19162173 and PMID:22659317
Sult1b1	Rat	procymidone	increases expression	EXP		6480464	procymidone results in increased expression of SULT1B1 mRNA	CTD	PMID:15686871
Sult1b1	Rat	quercetin	affects expression	ISO	Sult1b1 (Mus musculus)	6480464	Quercetin affects the expression of SULT1B1 mRNA	CTD	PMID:19270413
Sult1b1	Rat	Rebamipide	increases expression	EXP		6480464	rebamipide results in increased expression of SULT1B1 mRNA	CTD	PMID:18299717
Sult1b1	Rat	rotenone	increases expression	EXP		6480464	Rotenone results in increased expression of SULT1B1 mRNA	CTD	PMID:28374803
Sult1b1	Rat	S-(1,2-dichlorovinyl)-L-cysteine	multiple interactions	ISO	SULT1B1 (Homo sapiens)	6480464	[S-(1 more ...	CTD	PMID:35811015
Sult1b1	Rat	sodium arsenite	decreases expression	ISO	SULT1B1 (Homo sapiens)	6480464	sodium arsenite results in decreased expression of SULT1B1 mRNA	CTD	PMID:20371982 and PMID:23876855
Sult1b1	Rat	sulfadimethoxine	increases expression	EXP		6480464	Sulfadimethoxine results in increased expression of SULT1B1 mRNA	CTD	PMID:30047161
Sult1b1	Rat	sulindac	multiple interactions	EXP		6480464	[Sulindac co-treated with lipopolysaccharide and E coli O55-B5] affects the expression of SULT1B1 mRNA	CTD	PMID:20371263
Sult1b1	Rat	tauroursodeoxycholic acid	decreases expression	EXP		6480464	ursodoxicoltaurine results in decreased expression of SULT1B1 mRNA	CTD	PMID:15885361
Sult1b1	Rat	testosterone	multiple interactions	ISO	Sult1b1 (Mus musculus)	6480464	[ABCC1 gene mutant form results in increased susceptibility to Testosterone deficiency] which results in increased expression of SULT1B1 mRNA	CTD	PMID:22522787
Sult1b1	Rat	tetrachloromethane	decreases expression	EXP		6480464	Carbon Tetrachloride results in decreased expression of SULT1B1 mRNA	CTD	PMID:18346771 and PMID:31150632
Sult1b1	Rat	tetrachloromethane	multiple interactions	EXP		6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of SULT1B1 mRNA]	CTD	PMID:31150632
Sult1b1	Rat	tetrachloromethane	decreases expression	ISO	Sult1b1 (Mus musculus)	6480464	Carbon Tetrachloride results in decreased expression of SULT1B1 mRNA	CTD	PMID:27339419 and PMID:31919559
Sult1b1	Rat	thiacloprid	multiple interactions	ISO	Sult1b1 (Mus musculus)	6480464	[Dietary Fats co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Captan co-treated with Chlorpyrifos co-treated with thiacloprid co-treated with Thiophanate co-treated with Ziram] results in increased expression of SULT1B1 mRNA	CTD	PMID:32745781
Sult1b1	Rat	thiophanate-methyl	multiple interactions	ISO	Sult1b1 (Mus musculus)	6480464	[Dietary Fats co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Captan co-treated with Chlorpyrifos co-treated with thiacloprid co-treated with Thiophanate co-treated with Ziram] results in increased expression of SULT1B1 mRNA	CTD	PMID:32745781
Sult1b1	Rat	titanium dioxide	multiple interactions	ISO	Sult1b1 (Mus musculus)	6480464	[titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of SULT1B1 mRNA	CTD	PMID:29950665
Sult1b1	Rat	triclosan	increases sulfation	ISO	SULT1B1 (Homo sapiens)	6480464	SULT1B1 protein results in increased sulfation of Triclosan	CTD	PMID:30776358
Sult1b1	Rat	tunicamycin	decreases expression	ISO	Sult1b1 (Mus musculus)	6480464	Tunicamycin results in decreased expression of SULT1B1 mRNA	CTD	PMID:17127020
Sult1b1	Rat	uranium atom	multiple interactions	EXP		6480464	[Acetaminophen co-treated with Uranium analog] results in decreased expression of SULT1B1 mRNA	CTD	PMID:17126469
Sult1b1	Rat	ursodeoxycholic acid	decreases expression	EXP		6480464	Ursodeoxycholic Acid results in decreased expression of SULT1B1 mRNA	CTD	PMID:15885361
Sult1b1	Rat	valproic acid	decreases expression	ISO	SULT1B1 (Homo sapiens)	6480464	Valproic Acid results in decreased expression of SULT1B1 mRNA	CTD	PMID:29154799
Sult1b1	Rat	vinclozolin	increases expression	EXP		6480464	vinclozolin results in increased expression of SULT1B1 mRNA	CTD	PMID:15686871
Sult1b1	Rat	vinclozolin	increases methylation	EXP		6480464	vinclozolin results in increased methylation of SULT1B1 gene	CTD	PMID:31682807
Sult1b1	Rat	ziram	multiple interactions	ISO	Sult1b1 (Mus musculus)	6480464	[Dietary Fats co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Captan co-treated with Chlorpyrifos co-treated with thiacloprid co-treated with Thiophanate co-treated with Ziram] results in increased expression of SULT1B1 mRNA	CTD	PMID:32745781

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Sult1b1	Rat	3'-phosphoadenosine 5'-phosphosulfate metabolic process	involved_in	ISO	SULT1B1 (Homo sapiens)	1624291	PMID:23207770	RGD	PMID:23207770
Sult1b1	Rat	epithelial cell differentiation	involved_in	ISO	SULT1B1 (Homo sapiens)	1624291	PMID:21492153	RGD	PMID:21492153
Sult1b1	Rat	ethanol catabolic process	involved_in	ISO	SULT1B1 (Homo sapiens)	1624291	PMID:23207770	RGD	PMID:23207770
Sult1b1	Rat	flavonoid metabolic process	involved_in	ISO	SULT1B1 (Homo sapiens)	1624291	PMID:20056724	RGD	PMID:20056724
Sult1b1	Rat	phenol-containing compound metabolic process	involved_in	ISO	SULT1B1 (Homo sapiens)	1624291	PMID:9463486	RGD	PMID:9463486
Sult1b1	Rat	sulfation	acts_upstream_of_or_within	ISO	SULT1B1 (Homo sapiens)	1624291	PMID:19548878	RGD	PMID:19548878
Sult1b1	Rat	sulfation	acts_upstream_of_or_within	ISO	Sult1b1 (Mus musculus)	1624291	PMID:19548878	RGD	PMID:19548878
Sult1b1	Rat	sulfation	involved_in	IBA	FB:FBgn0033887 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Sult1b1	Rat	sulfation	involved_in	IDA		1299515	PMID:8530477	UniProt
Sult1b1	Rat	sulfation	involved_in	ISO	Sult1b1 (Mus musculus)	1624291	PMID:9644246	RGD	PMID:9644246
Sult1b1	Rat	sulfation	involved_in	ISO	SULT1B1 (Canis lupus familiaris)	1624291	PMID:11368519	RGD	PMID:11368519
Sult1b1	Rat	sulfation	involved_in	ISO	SULT1B1 (Homo sapiens)	1624291	PMID:20056724 more ...	RGD	PMID:20056724 more ...
Sult1b1	Rat	thyroid hormone metabolic process	involved_in	ISO	SULT1B1 (Canis lupus familiaris)	1624291	PMID:11368519	RGD	PMID:11368519
Sult1b1	Rat	thyroid hormone metabolic process	involved_in	ISO	Sult1b1 (Mus musculus)	1624291	PMID:9644246	RGD	PMID:9644246
Sult1b1	Rat	thyroid hormone metabolic process	involved_in	IDA		1299515	PMID:8530477	UniProt
Sult1b1	Rat	thyroid hormone metabolic process	involved_in	ISO	SULT1B1 (Homo sapiens)	1624291	PMID:9443824 and PMID:9463486	RGD	PMID:9443824 and PMID:9463486
Sult1b1	Rat	xenobiotic metabolic process	involved_in	ISO	SULT1B1 (Homo sapiens)	1624291	PMID:20056724	RGD	PMID:20056724

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Sult1b1	Rat	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Sult1b1	Rat	cytoplasm	located_in	IEA	UniProtKB-SubCell:SL-0086	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Sult1b1	Rat	cytoplasm	is_active_in	IBA	MGI:102928 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Sult1b1	Rat	aryl sulfotransferase activity		IDA		1299515		RGD
Sult1b1	Rat	aryl sulfotransferase activity	enables	ISO	Sult1b1 (Mus musculus)	1624291	PMID:9644246	RGD	PMID:9644246
Sult1b1	Rat	aryl sulfotransferase activity	enables	IBA	MGI:102928 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Sult1b1	Rat	aryl sulfotransferase activity	enables	IEA	RHEA:12164	1600115	GO_REF:0000116	RHEA	GO_REF:0000116
Sult1b1	Rat	aryl sulfotransferase activity	enables	IDA		1299515	PMID:8530477	UniProt
Sult1b1	Rat	aryl sulfotransferase activity	enables	ISO	SULT1B1 (Canis lupus familiaris)	1624291	PMID:11368519	RGD	PMID:11368519
Sult1b1	Rat	aryl sulfotransferase activity	enables	ISO	SULT1B1 (Homo sapiens)	1624291	PMID:23207770 and PMID:9443824	RGD	PMID:23207770 and PMID:9443824
Sult1b1	Rat	protein binding	enables	ISO	SULT1B1 (Homo sapiens)	1624291	UniProtKB:O00204 more ...	RGD	PMID:21044950 more ...
Sult1b1	Rat	sulfotransferase activity	enables	ISO	SULT1B1 (Homo sapiens)	1624291	PMID:19548878 more ...	RGD	PMID:19548878 more ...
Sult1b1	Rat	sulfotransferase activity	enables	IEA	InterPro:IPR000863	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Sult1b1	Rat	sulfotransferase activity	enables	ISO	Sult1b1 (Mus musculus)	1624291	PMID:19548878	RGD	PMID:19548878
Sult1b1	Rat	transferase activity	enables	IEA	UniProtKB-KW:KW-0808	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

#	Reference Title	Reference Citation
1.	Molecular cloning and characterization of rat ST1B1 and human ST1B2 cDNAs, encoding thyroid hormone sulfotransferases.	Fujita K, etal., J Biochem (Tokyo) 1997 Nov;122(5):1052-61.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	GOA pipeline	RGD automated data pipeline
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	Purification, characterization, and molecular cloning of a novel rat liver Dopa/tyrosine sulfotransferase.	Sakakibara Y, etal., J Biol Chem 1995 Dec 22;270(51):30470-8.

PMID:8033246	PMID:9463486	PMID:9644246	PMID:12419836	PMID:12773305	PMID:19548878	PMID:20056724	PMID:21492153	PMID:22447239	PMID:23207770

Sult1b1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	20,771,917 - 20,784,665 (+)	NCBI		GRCr8
mRatBN7.2	14	20,492,763 - 20,505,491 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	20,492,708 - 20,505,483 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	14	20,680,971 - 20,693,727 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	21,999,886 - 22,012,644 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	20,755,290 - 20,768,011 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	22,142,412 - 22,155,246 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	22,142,364 - 22,155,231 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	14	22,057,298 - 22,070,533 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	14	22,019,193 - 22,031,914 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	14	22,019,200 - 22,031,908 (+)	NCBI
Celera	14	19,895,061 - 19,907,795 (+)	NCBI		Celera
Cytogenetic Map	14	p21	NCBI

SULT1B1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	69,721,167 - 69,760,620 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	4	69,721,167 - 69,787,961 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	4	70,586,885 - 70,626,338 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	70,627,275 - 70,661,019 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	4	70,773,445 - 70,807,190	NCBI
Celera	4	67,945,644 - 67,979,390 (-)	NCBI		Celera
Cytogenetic Map	4	q13.3	NCBI
HuRef	4	66,390,559 - 66,424,315 (-)	NCBI		HuRef
CHM1_1	4	70,628,526 - 70,662,267 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	4	73,055,983 - 73,095,434 (-)	NCBI		T2T-CHM13v2.0

Sult1b1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	87,661,186 - 87,686,054 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	87,661,198 - 87,686,054 (-)	Ensembl		GRCm39 Ensembl
GRCm38	5	87,513,327 - 87,538,195 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	87,513,339 - 87,538,195 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	87,942,364 - 87,967,220 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	88,587,900 - 88,612,756 (-)	NCBI		MGSCv36	mm8
Celera	5	84,729,631 - 84,754,508 (-)	NCBI		Celera
Cytogenetic Map	5	E1	NCBI
cM Map	5	43.56	NCBI

LOC100973465
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	3	60,331,725 - 60,367,494 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	4	60,534,736 - 60,574,285 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	4	54,478,985 - 54,513,877 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	4	60,815,561 - 60,849,516 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	4	60,815,445 - 60,849,516 (+)	Ensembl	panpan1.1		panPan2

SULT1B1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	13	59,229,514 - 59,244,387 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	13	59,229,514 - 59,244,434 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	13	58,959,285 - 58,973,676 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	13	60,025,805 - 60,044,924 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	13	60,025,805 - 60,045,241 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	13	59,640,713 - 59,655,150 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	13	59,101,015 - 59,115,204 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	13	60,245,960 - 60,260,405 (-)	NCBI		UU_Cfam_GSD_1.0

LOC100624541
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	8	66,728,191 - 66,743,873 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	8	66,727,047 - 66,748,761 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	8	71,065,063 - 71,084,460 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SULT1B1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	7	18,202,215 - 18,239,443 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	7	18,203,827 - 18,238,794 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666084	4,686,346 - 4,725,069 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants in Sult1b1
65 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	157
Count of miRNA genes:	121
Interacting mature miRNAs:	128
Transcripts:	ENSRNOT00000002699
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300114	Srn2	Serum renin concentration QTL 2	3.27		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	14	3813074	21217635	Rat
1581500	Renag1	Renal agenesis QTL 1			kidney development trait (VT:0000527)	percentage of study population developing unilateral renal agenesis during a period of time (CMO:0000940)	14	8170668	68298175	Rat
731183	Pia20	Pristane induced arthritis QTL 20	3.55		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	14	9088978	39057237	Rat
631212	Bw5	Body weight QTL5	5.43		retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	14	11030812	30320092	Rat
2302277	Gluco38	Glucose level QTL 38	5.8		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	11030622	28035204	Rat
10755459	Coatc15	Coat color QTL 15		0.01681	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	14	19836944	64836944	Rat
1331740	Bw26	Body weight QTL 26	3.028		body mass (VT:0001259)	body weight (CMO:0000012)	14	3813074	30767156	Rat
619619	Rf4	Renal disease susceptibility QTL 4	4.1	0.002	urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	14	1	32754612	Rat
1358296	Ael3	Aortic elastin QTL 3	3.7	0.00051	aorta elastin amount (VT:0003905)	aortic elastin	14	8267090	53267090	Rat
71117	Niddm17	Non-insulin dependent diabetes mellitus QTL 17	2.35		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	14	17593761	42336881	Rat
61420	Pia6	Pristane induced arthritis QTL 6	4.9		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	14	18631345	42337007	Rat
70195	Mcs8	Mammary carcinoma susceptibility QTL 8	4.28		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	14	3813074	24531477	Rat
2300183	Bmd60	Bone mineral density QTL 60	5.7	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	14	1	26541967	Rat
631839	Niddm37	Non-insulin dependent diabetes mellitus QTL 37	3.37		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	11030622	95876975	Rat
2313397	Coatc1	Coat color QTL1			coat/hair pigmentation trait (VT:0010463)	coat/hair color measurement (CMO:0001808)	14	18541332	63541332	Rat
631262	Tcas4	Tongue tumor susceptibility QTL 4	7.29		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	14	17622561	42337007	Rat
634352	Apr6	Acute phase response QTL 6	3.7		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	14	1	41131407	Rat
2300159	Bmd61	Bone mineral density QTL 61	5.3	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	14	1	26541967	Rat
2302045	Pia39	Pristane induced arthritis QTL 39	4.9	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G2a level (CMO:0002116)	14	8267090	53267090	Rat
1300140	Srn3	Serum renin concentration QTL 3	3.19		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	14	14875168	30883947	Rat

RH138641

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	14	20,505,211 - 20,505,355 (+)	MAPPER	mRatBN7.2
Rnor_6.0	14	22,154,967 - 22,155,110	NCBI	Rnor6.0
Rnor_5.0	14	22,070,256 - 22,070,399	UniSTS	Rnor5.0
RGSC_v3.4	14	22,031,637 - 22,031,780	UniSTS	RGSC3.4
Celera	14	19,907,518 - 19,907,661	UniSTS
RH 3.4 Map	14	305.29	UniSTS
Cytogenetic Map	14	p21	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	9	13	53	89	89	59	24	59	6	174	57	33	41	48	30


RefSeq Transcripts	NM_022513	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008770056	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH474125	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D89375	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ209476	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ209486	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ209579	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ210801	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212608	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213902	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218295	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219146	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000014	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U38419	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000002699 ⟹ ENSRNOP00000002699

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	14	20,492,708 - 20,505,483 (+)	Ensembl
Rnor_6.0 Ensembl	14	22,142,364 - 22,155,231 (+)	Ensembl

RefSeq Acc Id:

NM_022513 ⟹ NP_071958

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	14	20,771,917 - 20,784,665 (+)	NCBI
mRatBN7.2	14	20,492,763 - 20,505,489 (+)	NCBI
Rnor_6.0	14	22,142,412 - 22,155,244 (+)	NCBI
Rnor_5.0	14	22,057,298 - 22,070,533 (+)	NCBI
RGSC_v3.4	14	22,019,193 - 22,031,914 (+)	RGD
Celera	14	19,895,061 - 19,907,795 (+)	RGD

Sequence:

show sequence

TTCCTGGCCCTTCTGCTCCTTCTCTTTCCCCATAGTTTTAACTGGCAACCGGTAGCTTCTTCAGCATCCGTACAGCCTGCTACAAAAATGGGTACTGCAGAAGATGTTTTTAGAAAAGATCTGAAGAT
CATTCATGGCTACCCCATGGTCTATGCTTTTGCACTGGGTTGGGAAAAAATCGAAGAGTTCCAGAGCAGACCATGTGACATTGTAATACCCACTTACCCTAAATCAGGTACTACTTGGCTTAGTGAAA
TTGTGGACATGGTTCTAAATGATGGAAATGTTGGAAAATGTAAGCGAGATGTTATTACCTCTAAAGTTCCAATGTTGGAACAAAATGTTCCTGGAGCAAGAAGATCAGGTGTTGAACTCTTGAAGAAA
ACTCCATCACCTCGAATTATAAAGACACATCTTCCAATTGATCTACTCCCAAAATCCTTCTGGGATAACAAGTGCAAGATGATTTACCTTGCTAGAAATGGCAAGGATGTTGCTGTGTCCTATTATCA
TTTTGATCTAATGAATAATATTCAGCCTCTTCCTGGCACCTGGGAAGAATATCTGGAGAAATTCCTCGCTGGAAATGTGGCCTATGGCTCATGGTTCGATCATGTTAAGAGTTGGTGGGAAAAGAGGG
AAGGGCATCCCATACTTTTCTTATACTATGAAGACTTGAAAAAGAACCCGAAGAAAGAAATCAAGAAGATTGCCAACTTTCTAGACAAGACCTTGGATGAACATACCTTGGAAAGGATCGTCCATCAC
ACCTCCTTTGAAGTGATGAAGGATAACCCCCTGGTCAATTACACCCATCTGCCCACAGAAATAATGGATCACAGCAAGTCCCCATTCATGAGAAAAGGTGTTGTTGGTGACTGGAAAAATTACTTCAC
AATGACCCAAAGTGAGAAATTTGATGCCATATATAAGAAGAAATTGTCTGGAACAACACTTGAGTTCTGCACAGATATTCAGAGTGCCTAAACTTCAACTTGAATATATGATTTCTTGAAATAGTAGT
TTGACAGGGAAATCAGATGGATTTGTGAGGGAGAAATAAATGTGCTTTTAAAACACTGATTAAATATGCCCTGCACATCCCTCAGCAGGAATTATTAATAATTCCGAATTATCTAGGGCCAAGGTCTT
TTGTGATCTTAGTTTTCAAAGGGTATGTCTTCAGATTCCAAGGTGACTACTGAATTAAATAAATAAGTTTTGTGAGTTTTGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_008770056 ⟹ XP_008768278

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	14	20,772,180 - 20,784,665 (+)	NCBI
mRatBN7.2	14	20,493,020 - 20,505,491 (+)	NCBI
Rnor_6.0	14	22,142,707 - 22,155,246 (+)	NCBI

Sequence:

show sequence

TTACATCTTTCTTTTATTCATGTGTATGTGTAGTTGTTTGTATGTGGGAAACGTGTACGTGTATGAGTGGCCACAGAAGTGAAATGAATCCTATCTTCAGAGCAGGTACTACTTGGCTTAGTGAAATT
GTGGACATGGTTCTAAATGATGGAAATGTTGAAAAATGTAAGCGAGATGTTATTACCTCTAAAGTTCCAATGTTGGAACAAAATGTTCCTGGAGCAAGAAGATCAGGTGTTGAACTCTTGAAGAAAAC
TCCATCACCTCGAATTATAAAGACACATCTTCCAATTGATCTACTCCCAAAATCCTTCTGGGATAACAAGTGCAAGATGATTTACCTTGCTAGAAATGGCAAGGATGTTGCTGTGTCCTATTATCATT
TTGATCTAATGAATAATATTCAGCCTCTTCCTGGCACCTGGGAAGAATATCTGGAGAAATTCCTCGCTGGAAATGTGGCCTATGGCTCATGGTTCGATCATGTTAAGAGTTGGTGGGAAAAGAGGGAA
GGGCATCCCATACTTTTCTTATACTATGAAGACTTGAAAAAGAACCCGAAGAAAGAAATCAAGAAGATTGCCAACTTTCTAGACAAGACCTTGGATGAACATACCTTGGAAAGGATCGTCCATCACAC
CTCCTTTGAAGTGATGAAGGATAACCCCCTGGTCAATTACACCCATCTGCCCACAGAAATAATGGATCACAGCAAGTCCCCATTCATGAGAAAAGGTGTTGTTGGTGACTGGAAAAATTACTTCACAA
TGACCCAAAGTGAGAAATTTGATGCCATATATAAGAAGAAATTGTCTGGAACAACACTTGAGTTCTGCACAGATATTCAGAGTGCCTAAACTTCAACTTGAATATATGATTTCTTGAAATAGTAGTTT
GACAGGGAAATCAGATGGATTTGTGAGGGAGAAATAAATGTGCTTTTAAAACACTGATTAAATATGCCCTGCACATCCCTCAGCAGGAATTATTAATAATTCCGAATTATCTAGGGACAAGGTCTTTT
GTGATCTTAGTTTTCAAAGGGTATGTCTTCAGATTCCAAAGTGACTACTGAATTAAATAAATAAGTTTTGTGAGTTTTGAAAAAATA

hide sequence


Protein RefSeqs	NP_071958	(Get FASTA)	NCBI Sequence Viewer
	XP_008768278	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAC52387	(Get FASTA)	NCBI Sequence Viewer
	BAA24546	(Get FASTA)	NCBI Sequence Viewer
	EDL83153	(Get FASTA)	NCBI Sequence Viewer
	EDL83154	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000002699
	ENSRNOP00000002699.2
	ENSRNOP00000101178
GenBank Protein	P52847	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_071958 ⟸ NM_022513

- UniProtKB:

P52847 (UniProtKB/Swiss-Prot), A6KU26 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MGTAEDVFRKDLKIIHGYPMVYAFALGWEKIEEFQSRPCDIVIPTYPKSGTTWLSEIVDMVLNDGNVGKCKRDVITSKVPMLEQNVPGARRSGVELLKKTPSPRIIKTHLPIDLLPKSFWDNKCKMIY
LARNGKDVAVSYYHFDLMNNIQPLPGTWEEYLEKFLAGNVAYGSWFDHVKSWWEKREGHPILFLYYEDLKKNPKKEIKKIANFLDKTLDEHTLERIVHHTSFEVMKDNPLVNYTHLPTEIMDHSKSPF
MRKGVVGDWKNYFTMTQSEKFDAIYKKKLSGTTLEFCTDIQSA

hide sequence

RefSeq Acc Id:	XP_008768278 ⟸ XM_008770056
- Peptide Label:	isoform X1
- UniProtKB:	P52847 (UniProtKB/Swiss-Prot), A6KU26 (UniProtKB/TrEMBL)
- Sequence:	show sequence MWETCTCMSGHRSEMNPIFRAGTTWLSEIVDMVLNDGNVEKCKRDVITSKVPMLEQNVPGARRS GVELLKKTPSPRIIKTHLPIDLLPKSFWDNKCKMIYLARNGKDVAVSYYHFDLMNNIQPLPGTWEEYLEKFLAGNVAYGSWFDHVKSWWEKREGHPILFLYYEDLKKNPKKEIKKIANFLDKTLDEHT LERIVHHTSFEVMKDNPLVNYTHLPTEIMDHSKSPFMRKGVVGDWKNYFTMTQSEKFDAIYKKKLSGTTLEFCTDIQSA hide sequence

Ensembl Acc Id:

ENSRNOP00000002699 ⟸ ENSRNOT00000002699

Protein Domains

Sulfotransferase

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P52847-F1-model_v2	AlphaFold	P52847	1-299	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13699250

Promoter ID:

EPDNEW_R9775

Type:

initiation region

Name:

Sult1b1_1

Description:

sulfotransferase family 1B member 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	14	22,142,370 - 22,142,430	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-16119	BioCyc
Ensembl Genes	ENSRNOG00000001967	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000002699	ENTREZGENE
	ENSRNOT00000002699.6	UniProtKB/Swiss-Prot
	ENSRNOT00000134618	ENTREZGENE
Gene3D-CATH	3.40.50.300	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	P-loop_NTPase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Sulfotransferase_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:64305	UniProtKB/Swiss-Prot
NCBI Gene	64305	ENTREZGENE
PANTHER	SULFOTRANSFERASE SULT	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Sulfotransfer_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Sult1b1	PhenoGen
RatGTEx	ENSRNOG00000001967	RatGTEx
Superfamily-SCOP	P-loop containing nucleoside triphosphate hydrolases	UniProtKB/TrEMBL, UniProtKB/Swiss-Prot
UniProt	A6KU26	ENTREZGENE, UniProtKB/TrEMBL
	P52847	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-11-12	Sult1b1	sulfotransferase family 1B member 1	Sult1b1	sulfotransferase family, cytosolic, 1B, member 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-10-23	Sult1b1	sulfotransferase family, cytosolic, 1B, member 1	Sult1b1	sulfotransferase family 1B, member 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-12-14	Sult1b1	sulfotransferase family 1B, member 1	LOC64305	dopa/tyrosine sulfotransferase	Symbol and Name updated	1299863	APPROVED

Note Type	Note	Reference

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - CTD