Symbol:
Sult1b1
Name:
sulfotransferase family 1B member 1
RGD ID:
708534
Description:
Enables aryl sulfotransferase activity. Involved in sulfation and thyroid hormone metabolic process. Predicted to be active in cytoplasm. Orthologous to human SULT1B1 (sulfotransferase family 1B member 1); INTERACTS WITH (+)-schisandrin B; 17beta-estradiol; 2,2',4,4'-Tetrabromodiphenyl ether.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
dopa/tyrosine sulfotransferase; LOC64305; ST1B1; sulfotransferase 1B1; sulfotransferase family 1B, member 1; sulfotransferase family cytosolic 1B member 1; sulfotransferase family, cytosolic, 1B, member 1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
SULT1B1 (sulfotransferase family 1B member 1)
HGNC
Ensembl, HomoloGene, Inparanoid, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Sult1b1 (sulfotransferase family 1B, member 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
LOC100973465 (sulfotransferase 1B1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
SULT1B1 (sulfotransferase family 1B member 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
LOC100624541 (sulfotransferase family cytosolic 1B member 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
SULT1B1 (sulfotransferase family 1B member 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Sult1b1 (sulfotransferase family 1B, member 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
SULT1B1 (sulfotransferase family 1B member 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
sult1st3 (sulfotransferase family 1, cytosolic sulfotransferase 3)
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER)
Danio rerio (zebrafish):
sult1st1 (sulfotransferase family 1, cytosolic sulfotransferase 1)
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER)
Danio rerio (zebrafish):
sult1st2 (sulfotransferase family 1, cytosolic sulfotransferase 2)
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER)
Danio rerio (zebrafish):
sult1st7 (sulfotransferase family 1, cytosolic sulfotransferase 7)
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER)
Danio rerio (zebrafish):
sult1st9 (sulfotransferase family 1, cytosolic sulfotransferase 9)
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER)
Danio rerio (zebrafish):
sult1st4 (sulfotransferase family 1, cytosolic sulfotransferase 4)
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER)
Drosophila melanogaster (fruit fly):
St1
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoInspector|SonicParanoid)
Caenorhabditis elegans (roundworm):
ssu-1
Alliance
DIOPT (InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
St2
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|OrthoInspector|SonicParanoid)
Drosophila melanogaster (fruit fly):
St4
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA)
Xenopus tropicalis (tropical clawed frog):
sult1b1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 20,771,917 - 20,784,665 (+) NCBI GRCr8 mRatBN7.2 14 20,492,763 - 20,505,491 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 20,492,708 - 20,505,483 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 20,680,971 - 20,693,727 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 21,999,886 - 22,012,644 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 20,755,290 - 20,768,011 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 22,142,412 - 22,155,246 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 22,142,364 - 22,155,231 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 22,057,298 - 22,070,533 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 22,019,193 - 22,031,914 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 14 22,019,200 - 22,031,908 (+) NCBI Celera 14 19,895,061 - 19,907,795 (+) NCBI Celera Cytogenetic Map 14 p21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Sult1b1 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of SULT1B1 mRNA] CTD PMID:31150632 Sult1b1 Rat 1,1-dichloroethene increases expression ISO RGD:733270 6480464 vinylidene chloride results in increased expression of SULT1B1 mRNA CTD PMID:26682919 Sult1b1 Rat 1,2-dichloroethane decreases expression ISO RGD:733270 6480464 ethylene dichloride results in decreased expression of SULT1B1 mRNA CTD PMID:28189721|PMID:28960355 Sult1b1 Rat 1,2-dimethylhydrazine decreases expression ISO RGD:733270 6480464 1,2-Dimethylhydrazine results in decreased expression of SULT1B1 mRNA CTD PMID:22206623 Sult1b1 Rat 1-Hydroxypyrene increases metabolic processing ISO RGD:1354463 6480464 SULT1B1 protein results in increased metabolism of 1-hydroxypyrene CTD PMID:24140465 Sult1b1 Rat 17alpha-ethynylestradiol increases metabolic processing ISO RGD:1354463 6480464 SULT1B1 protein results in increased metabolism of Ethinyl Estradiol CTD PMID:10623578 Sult1b1 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of SULT1B1 mRNA CTD PMID:32145629 Sult1b1 Rat 17beta-estradiol decreases expression ISO RGD:733270 6480464 Estradiol results in decreased expression of SULT1B1 mRNA CTD PMID:39298647 Sult1b1 Rat 1H-pyrazole decreases expression ISO RGD:733270 6480464 pyrazole results in decreased expression of SULT1B1 mRNA CTD PMID:17945193 Sult1b1 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO RGD:733270 6480464 [Tetrachlorodibenzodioxin co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with Diethylhexyl Phthalate co-treated with bisphenol A] results in decreased more ... CTD PMID:28433925 Sult1b1 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression EXP 6480464 2,2',4,4'-tetrabromodiphenyl ether results in increased expression of SULT1B1 mRNA CTD PMID:20056577 Sult1b1 Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO RGD:733270 6480464 2,2',4,4'-tetrabromodiphenyl ether affects the expression of SULT1B1 mRNA CTD PMID:30294300 Sult1b1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1354463 6480464 Tetrachlorodibenzodioxin results in increased expression of SULT1B1 mRNA CTD PMID:21296121 Sult1b1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:733270 6480464 [Tetrachlorodibenzodioxin co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with Diethylhexyl Phthalate co-treated with bisphenol A] results in decreased more ... CTD PMID:28433925 Sult1b1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of SULT1B1 mRNA CTD PMID:19692669|PMID:21215274|PMID:21724226 Sult1b1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of SULT1B1 mRNA CTD PMID:22659317 Sult1b1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of SULT1B1 mRNA CTD PMID:22298810 Sult1b1 Rat 2,4,6-trinitrotoluene affects expression EXP 6480464 Trinitrotoluene affects the expression of SULT1B1 mRNA CTD PMID:21346803 Sult1b1 Rat 2-Amino-3-methyl-9H-pyrido[2,3-b]indole increases activity ISO RGD:1354463 6480464 SULT1B1 protein results in increased activity of 2-amino-3-methyl-9H-pyrido(2,3-b)indole CTD PMID:14729582 Sult1b1 Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression EXP 6480464 3,4,5,3',4'-pentachlorobiphenyl results in decreased expression of SULT1B1 mRNA CTD PMID:19692669 Sult1b1 Rat 3,4-dichloroaniline increases expression EXP 6480464 3,4-dichloroaniline results in increased expression of SULT1B1 mRNA CTD PMID:24172598 Sult1b1 Rat 3-methyl-3H-imidazo[4,5-f]quinolin-2-amine increases expression ISO RGD:1354463 6480464 2-amino-3-methylimidazo(4,5-f)quinoline results in increased expression of SULT1B1 mRNA CTD PMID:31542801 Sult1b1 Rat 4,4'-sulfonyldiphenol decreases expression ISO RGD:733270 6480464 bisphenol S results in decreased expression of SULT1B1 mRNA CTD PMID:39298647 Sult1b1 Rat 4-nitrophenol increases metabolic processing ISO RGD:1354463 6480464 SULT1B1 protein results in increased metabolism of 4-nitrophenol CTD PMID:10623578 Sult1b1 Rat 4-nonylphenol increases metabolic processing ISO RGD:1354463 6480464 SULT1B1 protein results in increased metabolism of 4-nonylphenol CTD PMID:10623578 Sult1b1 Rat 4-octylphenol increases metabolic processing ISO RGD:1354463 6480464 SULT1B1 protein results in increased metabolism of 4-octylphenol CTD PMID:10623578 Sult1b1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of SULT1B1 mRNA CTD PMID:30047161 Sult1b1 Rat aflatoxin B1 decreases expression ISO RGD:1354463 6480464 Aflatoxin B1 results in decreased expression of SULT1B1 mRNA CTD PMID:22100608|PMID:27153756 Sult1b1 Rat aflatoxin B1 increases expression ISO RGD:1354463 6480464 Aflatoxin B1 results in increased expression of SULT1B1 mRNA CTD PMID:31542801 Sult1b1 Rat alpha-hexachlorocyclohexane increases expression EXP 6480464 alpha-hexachlorocyclohexane results in increased expression of SULT1B1 mRNA CTD PMID:16940010 Sult1b1 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of SULT1B1 mRNA CTD PMID:30047161 Sult1b1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of SULT1B1 mRNA CTD PMID:16483693 Sult1b1 Rat aristolochic acid A multiple interactions EXP 6480464 [aristolochic acid I co-treated with aristolochic acid II] results in increased expression of SULT1B1 mRNA CTD PMID:23912714 Sult1b1 Rat Aroclor 1254 increases expression EXP 6480464 Chlorodiphenyl (54% Chlorine) results in increased expression of SULT1B1 mRNA CTD PMID:22659317 Sult1b1 Rat arsane increases methylation ISO RGD:1354463 6480464 Arsenic results in increased methylation of SULT1B1 gene CTD PMID:24525453 Sult1b1 Rat arsenic atom increases methylation ISO RGD:1354463 6480464 Arsenic results in increased methylation of SULT1B1 gene CTD PMID:24525453 Sult1b1 Rat Azoxymethane multiple interactions ISO RGD:733270 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of SULT1B1 more ... CTD PMID:29950665 Sult1b1 Rat benzo[a]pyrene increases expression ISO RGD:733270 6480464 Benzo(a)pyrene results in increased expression of SULT1B1 mRNA CTD PMID:19770486 Sult1b1 Rat benzo[a]pyrene decreases expression ISO RGD:1354463 6480464 Benzo(a)pyrene results in decreased expression of SULT1B1 mRNA CTD PMID:32234424 Sult1b1 Rat benzo[a]pyrene increases methylation ISO RGD:1354463 6480464 Benzo(a)pyrene results in increased methylation of SULT1B1 5' UTR CTD PMID:27901495 Sult1b1 Rat benzo[a]pyrene increases expression ISO RGD:1354463 6480464 Benzo(a)pyrene results in increased expression of SULT1B1 mRNA CTD PMID:22316170|PMID:31542801 Sult1b1 Rat benzyl alcohol increases sulfation ISO RGD:1354463 6480464 SULT1B1 protein results in increased sulfation of Benzyl Alcohol CTD PMID:26663444 Sult1b1 Rat bexarotene decreases expression EXP 6480464 bexarotene results in decreased expression of SULT1B1 mRNA CTD PMID:16648578 Sult1b1 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO RGD:733270 6480464 [Tetrachlorodibenzodioxin co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with Diethylhexyl Phthalate co-treated with bisphenol A] results in decreased more ... CTD PMID:28433925 Sult1b1 Rat bisphenol A decreases expression ISO RGD:1354463 6480464 bisphenol A results in decreased expression of SULT1B1 mRNA CTD PMID:24214726 Sult1b1 Rat bisphenol A multiple interactions ISO RGD:1354463 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of SULT1B1 gene CTD PMID:31601247 Sult1b1 Rat bisphenol A increases methylation ISO RGD:1354463 6480464 bisphenol A results in increased methylation of SULT1B1 gene CTD PMID:31601247 Sult1b1 Rat bisphenol A increases expression ISO RGD:733270 6480464 bisphenol A results in increased expression of SULT1B1 mRNA CTD PMID:38074096 Sult1b1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of SULT1B1 mRNA CTD PMID:30903817 Sult1b1 Rat bisphenol A multiple interactions ISO RGD:733270 6480464 [Tetrachlorodibenzodioxin co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with Diethylhexyl Phthalate co-treated with bisphenol A] results in decreased more ... CTD PMID:28433925 Sult1b1 Rat bisphenol A increases metabolic processing ISO RGD:1354463 6480464 SULT1B1 protein results in increased metabolism of bisphenol A CTD PMID:10623578 Sult1b1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of SULT1B1 mRNA CTD PMID:25181051|PMID:32145629 Sult1b1 Rat bromobenzene affects binding EXP 6480464 bromobenzene metabolite binds to SULT1B1 protein CTD PMID:17305373 Sult1b1 Rat cadmium dichloride increases methylation EXP 6480464 Cadmium Chloride results in increased methylation of SULT1B1 promoter CTD PMID:22457795 Sult1b1 Rat calcitriol decreases expression ISO RGD:1354463 6480464 Calcitriol results in decreased expression of SULT1B1 mRNA CTD PMID:27107558 Sult1b1 Rat captan multiple interactions ISO RGD:733270 6480464 [Dietary Fats co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Captan co-treated with Chlorpyrifos co-treated with thiacloprid co-treated more ... CTD PMID:32745781 Sult1b1 Rat captan increases expression ISO RGD:733270 6480464 Captan results in increased expression of SULT1B1 mRNA CTD PMID:31558096 Sult1b1 Rat carbon nanotube increases expression ISO RGD:1354463 6480464 Nanotubes, Carbon results in increased expression of SULT1B1 mRNA CTD PMID:25102311 Sult1b1 Rat chenodeoxycholic acid decreases expression ISO RGD:1354463 6480464 Chenodeoxycholic Acid results in decreased expression of SULT1B1 mRNA CTD PMID:27174168 Sult1b1 Rat chlorohydrocarbon multiple interactions EXP 6480464 [Hydrocarbons, Chlorinated co-treated with Polychlorinated Biphenyls co-treated with methylmercuric chloride co-treated with Dibenzofurans, Polychlorinated co-treated more ... CTD PMID:30744511 Sult1b1 Rat chlorpyrifos multiple interactions ISO RGD:733270 6480464 [Dietary Fats co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Captan co-treated with Chlorpyrifos co-treated with thiacloprid co-treated more ... CTD PMID:32745781 Sult1b1 Rat chromium(6+) affects expression ISO RGD:733270 6480464 chromium hexavalent ion affects the expression of SULT1B1 mRNA CTD PMID:28472532 Sult1b1 Rat cisplatin increases expression EXP 6480464 Cisplatin results in increased expression of SULT1B1 mRNA CTD PMID:22023808 Sult1b1 Rat clofibrate decreases expression ISO RGD:733270 6480464 Clofibrate results in decreased expression of SULT1B1 mRNA CTD PMID:17585979 Sult1b1 Rat cobalt dichloride decreases expression ISO RGD:1354463 6480464 cobaltous chloride results in decreased expression of SULT1B1 mRNA CTD PMID:19320972 Sult1b1 Rat copper atom decreases expression EXP 6480464 Copper deficiency results in decreased expression of SULT1B1 mRNA; Copper results in decreased expression of more ... CTD PMID:19821111|PMID:22465980 Sult1b1 Rat copper(0) decreases expression EXP 6480464 Copper deficiency results in decreased expression of SULT1B1 mRNA; Copper results in decreased expression of more ... CTD PMID:19821111|PMID:22465980 Sult1b1 Rat coumarin affects expression EXP 6480464 coumarin affects the expression of SULT1B1 mRNA CTD PMID:16963487 Sult1b1 Rat crocidolite asbestos increases expression ISO RGD:1354463 6480464 Asbestos, Crocidolite results in increased expression of SULT1B1 mRNA CTD PMID:25351596 Sult1b1 Rat cyclosporin A decreases expression ISO RGD:733270 6480464 Cyclosporine results in decreased expression of SULT1B1 mRNA CTD PMID:19770486 Sult1b1 Rat cyclosporin A decreases expression ISO RGD:1354463 6480464 Cyclosporine results in decreased expression of SULT1B1 mRNA CTD PMID:27989131|PMID:33631201 Sult1b1 Rat cyproconazole decreases expression ISO RGD:1354463 6480464 cyproconazole results in decreased expression of SULT1B1 mRNA CTD PMID:29995386 Sult1b1 Rat dexamethasone increases expression EXP 6480464 Dexamethasone results in increased expression of SULT1B1 mRNA CTD PMID:26739637 Sult1b1 Rat dextran sulfate multiple interactions ISO RGD:733270 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of SULT1B1 more ... CTD PMID:29950665 Sult1b1 Rat dichlorine multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] affects the expression of SULT1B1 mRNA CTD PMID:18636392 Sult1b1 Rat dichlorine decreases expression EXP 6480464 Chlorine results in decreased expression of SULT1B1 mRNA CTD PMID:18636392 Sult1b1 Rat diethyl hydrogen phosphate decreases expression EXP 6480464 diethyl phosphate results in decreased expression of SULT1B1 mRNA CTD PMID:31835022 Sult1b1 Rat diethylstilbestrol increases metabolic processing ISO RGD:1354463 6480464 SULT1B1 protein results in increased metabolism of Diethylstilbestrol CTD PMID:10623578 Sult1b1 Rat diethylstilbestrol increases expression EXP 6480464 Diethylstilbestrol results in increased expression of SULT1B1 mRNA CTD PMID:36653537 Sult1b1 Rat dimethylarsinic acid increases expression EXP 6480464 Cacodylic Acid results in increased expression of SULT1B1 mRNA CTD PMID:37567419 Sult1b1 Rat dimethylarsinous acid decreases expression ISO RGD:1354463 6480464 dimethylarsinous acid results in decreased expression of SULT1B1 mRNA CTD PMID:23876855 Sult1b1 Rat diuron increases expression EXP 6480464 Diuron metabolite results in increased expression of SULT1B1 mRNA CTD PMID:24172598 Sult1b1 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of SULT1B1 mRNA CTD PMID:29391264 Sult1b1 Rat enilconazole decreases expression ISO RGD:1354463 6480464 enilconazole results in decreased expression of SULT1B1 mRNA CTD PMID:32201337 Sult1b1 Rat fipronil increases expression EXP 6480464 fipronil results in increased expression of SULT1B1 mRNA CTD PMID:22447239|PMID:23962444 Sult1b1 Rat fipronil multiple interactions ISO RGD:1354463 6480464 [fipronil co-treated with DEET] results in decreased expression of SULT1B1 mRNA CTD PMID:27091632 Sult1b1 Rat fipronil decreases expression ISO RGD:1354463 6480464 fipronil results in decreased expression of SULT1B1 mRNA CTD PMID:27091632 Sult1b1 Rat fipronil increases expression ISO RGD:733270 6480464 fipronil results in increased expression of SULT1B1 mRNA CTD PMID:23962444 Sult1b1 Rat fipronil-sulfone increases expression EXP 6480464 fipronil sulfone results in increased expression of SULT1B1 mRNA CTD PMID:22447239 Sult1b1 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of SULT1B1 mRNA CTD PMID:24793618 Sult1b1 Rat folpet increases expression ISO RGD:733270 6480464 folpet results in increased expression of SULT1B1 mRNA CTD PMID:31558096 Sult1b1 Rat fulvestrant multiple interactions ISO RGD:1354463 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of SULT1B1 gene CTD PMID:31601247 Sult1b1 Rat glafenine decreases expression EXP 6480464 Glafenine results in decreased expression of SULT1B1 mRNA CTD PMID:24136188 Sult1b1 Rat gliotoxin decreases expression EXP 6480464 Gliotoxin results in decreased expression of SULT1B1 mRNA CTD PMID:18346771 Sult1b1 Rat inulin multiple interactions ISO RGD:733270 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of SULT1B1 mRNA CTD PMID:36331819 Sult1b1 Rat isoprenaline decreases expression ISO RGD:733270 6480464 Isoproterenol results in decreased expression of SULT1B1 mRNA CTD PMID:21335049 Sult1b1 Rat kojic acid multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with kojic acid co-treated with Diethylnitrosamine] results in decreased expression of SULT1B1 mRNA; more ... CTD PMID:18544905 Sult1b1 Rat lidocaine increases sulfation ISO RGD:1354463 6480464 SULT1B1 protein results in increased sulfation of Lidocaine metabolite CTD PMID:10460806 Sult1b1 Rat lipopolysaccharide decreases expression ISO RGD:1354463 6480464 Lipopolysaccharides results in decreased expression of SULT1B1 mRNA CTD PMID:35811015 Sult1b1 Rat lipopolysaccharide multiple interactions ISO RGD:1354463 6480464 [S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of SULT1B1 mRNA; [S-(1,2-dichlorovinyl)cysteine more ... CTD PMID:35811015 Sult1b1 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of SULT1B1 mRNA CTD PMID:30047161 Sult1b1 Rat methylmercury chloride multiple interactions EXP 6480464 [Hydrocarbons, Chlorinated co-treated with Polychlorinated Biphenyls co-treated with methylmercuric chloride co-treated with Dibenzofurans, Polychlorinated co-treated more ... CTD PMID:30744511 Sult1b1 Rat microcystin-LR increases expression ISO RGD:733270 6480464 cyanoginosin LR results in increased expression of SULT1B1 protein CTD PMID:26984711 Sult1b1 Rat N,N-diethyl-m-toluamide multiple interactions ISO RGD:1354463 6480464 [fipronil co-treated with DEET] results in decreased expression of SULT1B1 mRNA CTD PMID:27091632 Sult1b1 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with kojic acid co-treated with Diethylnitrosamine] results in decreased expression of SULT1B1 mRNA; more ... CTD PMID:18544905 Sult1b1 Rat N-nitrosodiethylamine decreases expression ISO RGD:733270 6480464 Diethylnitrosamine results in decreased expression of SULT1B1 mRNA CTD PMID:24535843 Sult1b1 Rat N-nitrosomorpholine increases expression EXP 6480464 N-nitrosomorpholine results in increased expression of SULT1B1 protein CTD PMID:19716841 Sult1b1 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of SULT1B1 mRNA CTD PMID:24136188 Sult1b1 Rat nickel atom decreases expression ISO RGD:1354463 6480464 Nickel results in decreased expression of SULT1B1 mRNA CTD PMID:23195993 Sult1b1 Rat nickel dichloride affects expression EXP 6480464 nickel chloride affects the expression of SULT1B1 mRNA CTD PMID:22110744 Sult1b1 Rat O-methyleugenol decreases expression ISO RGD:1354463 6480464 methyleugenol results in decreased expression of SULT1B1 mRNA CTD PMID:32234424 Sult1b1 Rat okadaic acid decreases expression ISO RGD:1354463 6480464 Okadaic Acid results in decreased expression of SULT1B1 mRNA; Okadaic Acid results in decreased expression more ... CTD PMID:38832940 Sult1b1 Rat ozone multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] affects the expression of SULT1B1 mRNA CTD PMID:18636392 Sult1b1 Rat paracetamol affects expression ISO RGD:733270 6480464 Acetaminophen affects the expression of SULT1B1 mRNA CTD PMID:17562736 Sult1b1 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of SULT1B1 mRNA CTD PMID:32479839 Sult1b1 Rat paracetamol decreases expression ISO RGD:1354463 6480464 Acetaminophen results in decreased expression of SULT1B1 mRNA CTD PMID:29067470 Sult1b1 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of SULT1B1 mRNA CTD PMID:17126469|PMID:18346771|PMID:21807079 Sult1b1 Rat paracetamol multiple interactions EXP 6480464 [Acetaminophen co-treated with Uranium analog] results in decreased expression of SULT1B1 mRNA CTD PMID:17126469 Sult1b1 Rat perfluorobutanesulfonic acid increases expression ISO RGD:1354463 6480464 perfluorobutanesulfonic acid results in increased expression of SULT1B1 mRNA CTD PMID:33772556 Sult1b1 Rat perfluorooctane-1-sulfonic acid decreases expression ISO RGD:1354463 6480464 perfluorooctane sulfonic acid results in decreased expression of SULT1B1 mRNA CTD PMID:27153767 Sult1b1 Rat perfluorooctane-1-sulfonic acid increases expression ISO RGD:1354463 6480464 perfluorooctane sulfonic acid results in increased expression of SULT1B1 mRNA CTD PMID:33772556 Sult1b1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:733270 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of SULT1B1 mRNA CTD PMID:36331819 Sult1b1 Rat perfluorooctanoic acid increases expression ISO RGD:1354463 6480464 perfluorooctanoic acid results in increased expression of SULT1B1 mRNA CTD PMID:32588087|PMID:33772556 Sult1b1 Rat phenobarbital decreases expression ISO RGD:1354463 6480464 Phenobarbital results in decreased expression of SULT1B1 mRNA CTD PMID:22258563 Sult1b1 Rat PhIP increases expression ISO RGD:1354463 6480464 2-amino-1-methyl-6-phenylimidazo(4,5-b)pyridine results in increased expression of SULT1B1 mRNA CTD PMID:31542801 Sult1b1 Rat pirinixic acid multiple interactions ISO RGD:1354463 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in more ... CTD PMID:19710929 Sult1b1 Rat pirinixic acid decreases expression ISO RGD:733270 6480464 pirinixic acid results in decreased expression of SULT1B1 mRNA CTD PMID:16221962|PMID:20059764|PMID:20813756|PMID:23811191 Sult1b1 Rat pirinixic acid multiple interactions ISO RGD:733270 6480464 PPARA protein promotes the reaction [pirinixic acid results in decreased expression of SULT1B1 mRNA] CTD PMID:20059764 Sult1b1 Rat pregnenolone 16alpha-carbonitrile increases expression EXP 6480464 Pregnenolone Carbonitrile results in increased expression of SULT1B1 mRNA CTD PMID:19162173|PMID:22659317 Sult1b1 Rat procymidone increases expression EXP 6480464 procymidone results in increased expression of SULT1B1 mRNA CTD PMID:15686871 Sult1b1 Rat quercetin affects expression ISO RGD:733270 6480464 Quercetin affects the expression of SULT1B1 mRNA CTD PMID:19270413 Sult1b1 Rat Rebamipide increases expression EXP 6480464 rebamipide results in increased expression of SULT1B1 mRNA CTD PMID:18299717 Sult1b1 Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of SULT1B1 mRNA CTD PMID:28374803 Sult1b1 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO RGD:1354463 6480464 [S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of SULT1B1 mRNA; [S-(1,2-dichlorovinyl)cysteine more ... CTD PMID:35811015 Sult1b1 Rat sodium arsenite decreases expression ISO RGD:1354463 6480464 sodium arsenite results in decreased expression of SULT1B1 mRNA CTD PMID:20371982|PMID:23876855 Sult1b1 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of SULT1B1 mRNA CTD PMID:30047161 Sult1b1 Rat sulindac multiple interactions EXP 6480464 [Sulindac co-treated with lipopolysaccharide, E coli O55-B5] affects the expression of SULT1B1 mRNA CTD PMID:20371263 Sult1b1 Rat tauroursodeoxycholic acid decreases expression EXP 6480464 ursodoxicoltaurine results in decreased expression of SULT1B1 mRNA CTD PMID:15885361 Sult1b1 Rat testosterone multiple interactions ISO RGD:733270 6480464 [ABCC1 gene mutant form results in increased susceptibility to Testosterone deficiency] which results in increased more ... CTD PMID:22522787 Sult1b1 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of SULT1B1 mRNA CTD PMID:18346771|PMID:31150632 Sult1b1 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of SULT1B1 mRNA] CTD PMID:31150632 Sult1b1 Rat tetrachloromethane decreases expression ISO RGD:733270 6480464 Carbon Tetrachloride results in decreased expression of SULT1B1 mRNA CTD PMID:27339419|PMID:31919559 Sult1b1 Rat thiacloprid multiple interactions ISO RGD:733270 6480464 [Dietary Fats co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Captan co-treated with Chlorpyrifos co-treated with thiacloprid co-treated more ... CTD PMID:32745781 Sult1b1 Rat thiophanate-methyl multiple interactions ISO RGD:733270 6480464 [Dietary Fats co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Captan co-treated with Chlorpyrifos co-treated with thiacloprid co-treated more ... CTD PMID:32745781 Sult1b1 Rat titanium dioxide multiple interactions ISO RGD:733270 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of SULT1B1 more ... CTD PMID:29950665 Sult1b1 Rat triclosan increases sulfation ISO RGD:1354463 6480464 SULT1B1 protein results in increased sulfation of Triclosan CTD PMID:30776358 Sult1b1 Rat tunicamycin decreases expression ISO RGD:733270 6480464 Tunicamycin results in decreased expression of SULT1B1 mRNA CTD PMID:17127020 Sult1b1 Rat uranium atom multiple interactions EXP 6480464 [Acetaminophen co-treated with Uranium analog] results in decreased expression of SULT1B1 mRNA CTD PMID:17126469 Sult1b1 Rat ursodeoxycholic acid decreases expression EXP 6480464 Ursodeoxycholic Acid results in decreased expression of SULT1B1 mRNA CTD PMID:15885361 Sult1b1 Rat valproic acid decreases expression ISO RGD:1354463 6480464 Valproic Acid results in decreased expression of SULT1B1 mRNA CTD PMID:29154799 Sult1b1 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of SULT1B1 mRNA CTD PMID:15686871 Sult1b1 Rat vinclozolin increases methylation EXP 6480464 vinclozolin results in increased methylation of SULT1B1 gene CTD PMID:31682807 Sult1b1 Rat ziram multiple interactions ISO RGD:733270 6480464 [Dietary Fats co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Captan co-treated with Chlorpyrifos co-treated with thiacloprid co-treated more ... CTD PMID:32745781
(+)-schisandrin B (EXP) 1,1-dichloroethene (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 1-Hydroxypyrene (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 1H-pyrazole (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-trinitrotoluene (EXP) 2-Amino-3-methyl-9H-pyrido[2,3-b]indole (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3,4-dichloroaniline (EXP) 3-methyl-3H-imidazo[4,5-f]quinolin-2-amine (ISO) 4,4'-sulfonyldiphenol (ISO) 4-nitrophenol (ISO) 4-nonylphenol (ISO) 4-octylphenol (ISO) 6-propyl-2-thiouracil (EXP) aflatoxin B1 (ISO) alpha-hexachlorocyclohexane (EXP) amitrole (EXP) ammonium chloride (EXP) aristolochic acid A (EXP) Aroclor 1254 (EXP) arsane (ISO) arsenic atom (ISO) Azoxymethane (ISO) benzo[a]pyrene (ISO) benzyl alcohol (ISO) bexarotene (EXP) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bromobenzene (EXP) cadmium dichloride (EXP) calcitriol (ISO) captan (ISO) carbon nanotube (ISO) chenodeoxycholic acid (ISO) chlorohydrocarbon (EXP) chlorpyrifos (ISO) chromium(6+) (ISO) cisplatin (EXP) clofibrate (ISO) cobalt dichloride (ISO) copper atom (EXP) copper(0) (EXP) coumarin (EXP) crocidolite asbestos (ISO) cyclosporin A (ISO) cyproconazole (ISO) dexamethasone (EXP) dextran sulfate (ISO) dichlorine (EXP) diethyl hydrogen phosphate (EXP) diethylstilbestrol (EXP,ISO) dimethylarsinic acid (EXP) dimethylarsinous acid (ISO) diuron (EXP) endosulfan (EXP) enilconazole (ISO) fipronil (EXP,ISO) fipronil-sulfone (EXP) flutamide (EXP) folpet (ISO) fulvestrant (ISO) glafenine (EXP) gliotoxin (EXP) inulin (ISO) isoprenaline (ISO) kojic acid (EXP) lidocaine (ISO) lipopolysaccharide (ISO) methimazole (EXP) methylmercury chloride (EXP) microcystin-LR (ISO) N,N-diethyl-m-toluamide (ISO) N-nitrosodiethylamine (EXP,ISO) N-nitrosomorpholine (EXP) nefazodone (EXP) nickel atom (ISO) nickel dichloride (EXP) O-methyleugenol (ISO) okadaic acid (ISO) ozone (EXP) paracetamol (EXP,ISO) perfluorobutanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenobarbital (ISO) PhIP (ISO) pirinixic acid (ISO) pregnenolone 16alpha-carbonitrile (EXP) procymidone (EXP) quercetin (ISO) Rebamipide (EXP) rotenone (EXP) S-(1,2-dichlorovinyl)-L-cysteine (ISO) sodium arsenite (ISO) sulfadimethoxine (EXP) sulindac (EXP) tauroursodeoxycholic acid (EXP) testosterone (ISO) tetrachloromethane (EXP,ISO) thiacloprid (ISO) thiophanate-methyl (ISO) titanium dioxide (ISO) triclosan (ISO) tunicamycin (ISO) uranium atom (EXP) ursodeoxycholic acid (EXP) valproic acid (ISO) vinclozolin (EXP) ziram (ISO)
Sult1b1 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 20,771,917 - 20,784,665 (+) NCBI GRCr8 mRatBN7.2 14 20,492,763 - 20,505,491 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 20,492,708 - 20,505,483 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 20,680,971 - 20,693,727 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 21,999,886 - 22,012,644 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 20,755,290 - 20,768,011 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 22,142,412 - 22,155,246 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 22,142,364 - 22,155,231 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 22,057,298 - 22,070,533 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 22,019,193 - 22,031,914 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 14 22,019,200 - 22,031,908 (+) NCBI Celera 14 19,895,061 - 19,907,795 (+) NCBI Celera Cytogenetic Map 14 p21 NCBI
SULT1B1 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 4 69,721,167 - 69,760,620 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 4 69,721,167 - 69,787,961 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 4 70,586,885 - 70,626,338 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 4 70,627,275 - 70,661,019 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 4 70,773,445 - 70,807,190 NCBI Celera 4 67,945,644 - 67,979,390 (-) NCBI Celera Cytogenetic Map 4 q13.3 NCBI HuRef 4 66,390,559 - 66,424,315 (-) NCBI HuRef CHM1_1 4 70,628,526 - 70,662,267 (-) NCBI CHM1_1 T2T-CHM13v2.0 4 73,055,983 - 73,095,434 (-) NCBI T2T-CHM13v2.0
Sult1b1 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 87,661,186 - 87,686,054 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 87,661,198 - 87,686,054 (-) Ensembl GRCm39 Ensembl GRCm38 5 87,513,327 - 87,538,195 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 87,513,339 - 87,538,195 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 87,942,364 - 87,967,220 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 88,587,900 - 88,612,756 (-) NCBI MGSCv36 mm8 Celera 5 84,729,631 - 84,754,508 (-) NCBI Celera Cytogenetic Map 5 E1 NCBI cM Map 5 43.56 NCBI
LOC100973465 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 3 60,331,725 - 60,367,494 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 4 60,534,736 - 60,574,285 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 4 54,478,985 - 54,513,877 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 4 60,815,561 - 60,849,516 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 4 60,815,445 - 60,849,516 (+) Ensembl panpan1.1 panPan2
SULT1B1 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 13 59,229,514 - 59,244,387 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 13 59,229,514 - 59,244,434 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 13 58,959,285 - 58,973,676 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 13 60,025,805 - 60,044,924 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 13 60,025,805 - 60,045,241 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 13 59,640,713 - 59,655,150 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 13 59,101,015 - 59,115,204 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 13 60,245,960 - 60,260,405 (-) NCBI UU_Cfam_GSD_1.0
LOC100624541 (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 8 66,728,191 - 66,743,873 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 8 66,727,047 - 66,748,761 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 8 71,065,063 - 71,084,460 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SULT1B1 (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 7 18,202,215 - 18,239,443 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 7 18,203,827 - 18,238,794 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666084 4,686,346 - 4,725,069 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
.
Predicted Target Of
Count of predictions: 157 Count of miRNA genes: 121 Interacting mature miRNAs: 128 Transcripts: ENSRNOT00000002699 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1300114 Srn2 Serum renin concentration QTL 2 3.27 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 14 3813074 21217635 Rat 1581500 Renag1 Renal agenesis QTL 1 kidney development trait (VT:0000527) percentage of study population developing unilateral renal agenesis during a period of time (CMO:0000940) 14 8170668 68298175 Rat 731183 Pia20 Pristane induced arthritis QTL 20 3.55 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 14 9088978 39057237 Rat 631212 Bw5 Body weight QTL5 5.43 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 14 11030812 30320092 Rat 2302277 Gluco38 Glucose level QTL 38 5.8 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 14 11030622 28035204 Rat 10755459 Coatc15 Coat color QTL 15 0.01681 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 14 19836944 64836944 Rat 1331740 Bw26 Body weight QTL 26 3.028 body mass (VT:0001259) body weight (CMO:0000012) 14 3813074 30767156 Rat 619619 Rf4 Renal disease susceptibility QTL 4 4.1 0.002 urine total protein amount (VT:0000032) urine protein excretion rate to body weight ratio (CMO:0001099) 14 1 32754612 Rat 1358296 Ael3 Aortic elastin QTL 3 3.7 0.00051 aorta elastin amount (VT:0003905) aortic elastin 14 8267090 53267090 Rat 71117 Niddm17 Non-insulin dependent diabetes mellitus QTL 17 2.35 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 14 17593761 42336881 Rat 61420 Pia6 Pristane induced arthritis QTL 6 4.9 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 14 18631345 42337007 Rat 70195 Mcs8 Mammary carcinoma susceptibility QTL 8 4.28 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 14 3813074 24531477 Rat 2300183 Bmd60 Bone mineral density QTL 60 5.7 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 14 1 26541967 Rat 631839 Niddm37 Non-insulin dependent diabetes mellitus QTL 37 3.37 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 14 11030622 95876975 Rat 2313397 Coatc1 Coat color QTL1 coat/hair pigmentation trait (VT:0010463) coat/hair color measurement (CMO:0001808) 14 18541332 63541332 Rat 631262 Tcas4 Tongue tumor susceptibility QTL 4 7.29 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 14 17622561 42337007 Rat 634352 Apr6 Acute phase response QTL 6 3.7 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 14 1 41131407 Rat 2300159 Bmd61 Bone mineral density QTL 61 5.3 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 14 1 26541967 Rat 2302045 Pia39 Pristane induced arthritis QTL 39 4.9 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G2a level (CMO:0002116) 14 8267090 53267090 Rat 1300140 Srn3 Serum renin concentration QTL 3 3.19 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 14 14875168 30883947 Rat
RH138641
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 14 20,505,211 - 20,505,355 (+) MAPPER mRatBN7.2 Rnor_6.0 14 22,154,967 - 22,155,110 NCBI Rnor6.0 Rnor_5.0 14 22,070,256 - 22,070,399 UniSTS Rnor5.0 RGSC_v3.4 14 22,031,637 - 22,031,780 UniSTS RGSC3.4 Celera 14 19,907,518 - 19,907,661 UniSTS RH 3.4 Map 14 305.29 UniSTS Cytogenetic Map 14 p21 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
9
13
53
89
89
59
24
59
6
174
57
33
41
48
30
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000002699 ⟹ ENSRNOP00000002699
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 20,492,708 - 20,505,483 (+) Ensembl Rnor_6.0 Ensembl 14 22,142,364 - 22,155,231 (+) Ensembl
RefSeq Acc Id:
NM_022513 ⟹ NP_071958
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 20,771,917 - 20,784,665 (+) NCBI mRatBN7.2 14 20,492,763 - 20,505,489 (+) NCBI Rnor_6.0 14 22,142,412 - 22,155,244 (+) NCBI Rnor_5.0 14 22,057,298 - 22,070,533 (+) NCBI RGSC_v3.4 14 22,019,193 - 22,031,914 (+) RGD Celera 14 19,895,061 - 19,907,795 (+) RGD
Sequence:
TTCCTGGCCCTTCTGCTCCTTCTCTTTCCCCATAGTTTTAACTGGCAACCGGTAGCTTCTTCAGCATCCGTACAGCCTGCTACAAAAATGGGTACTGCAGAAGATGTTTTTAGAAAAGATCTGAAGAT CATTCATGGCTACCCCATGGTCTATGCTTTTGCACTGGGTTGGGAAAAAATCGAAGAGTTCCAGAGCAGACCATGTGACATTGTAATACCCACTTACCCTAAATCAGGTACTACTTGGCTTAGTGAAA TTGTGGACATGGTTCTAAATGATGGAAATGTTGGAAAATGTAAGCGAGATGTTATTACCTCTAAAGTTCCAATGTTGGAACAAAATGTTCCTGGAGCAAGAAGATCAGGTGTTGAACTCTTGAAGAAA ACTCCATCACCTCGAATTATAAAGACACATCTTCCAATTGATCTACTCCCAAAATCCTTCTGGGATAACAAGTGCAAGATGATTTACCTTGCTAGAAATGGCAAGGATGTTGCTGTGTCCTATTATCA TTTTGATCTAATGAATAATATTCAGCCTCTTCCTGGCACCTGGGAAGAATATCTGGAGAAATTCCTCGCTGGAAATGTGGCCTATGGCTCATGGTTCGATCATGTTAAGAGTTGGTGGGAAAAGAGGG AAGGGCATCCCATACTTTTCTTATACTATGAAGACTTGAAAAAGAACCCGAAGAAAGAAATCAAGAAGATTGCCAACTTTCTAGACAAGACCTTGGATGAACATACCTTGGAAAGGATCGTCCATCAC ACCTCCTTTGAAGTGATGAAGGATAACCCCCTGGTCAATTACACCCATCTGCCCACAGAAATAATGGATCACAGCAAGTCCCCATTCATGAGAAAAGGTGTTGTTGGTGACTGGAAAAATTACTTCAC AATGACCCAAAGTGAGAAATTTGATGCCATATATAAGAAGAAATTGTCTGGAACAACACTTGAGTTCTGCACAGATATTCAGAGTGCCTAAACTTCAACTTGAATATATGATTTCTTGAAATAGTAGT TTGACAGGGAAATCAGATGGATTTGTGAGGGAGAAATAAATGTGCTTTTAAAACACTGATTAAATATGCCCTGCACATCCCTCAGCAGGAATTATTAATAATTCCGAATTATCTAGGGCCAAGGTCTT TTGTGATCTTAGTTTTCAAAGGGTATGTCTTCAGATTCCAAGGTGACTACTGAATTAAATAAATAAGTTTTGTGAGTTTTGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
hide sequence
RefSeq Acc Id:
XM_008770056 ⟹ XP_008768278
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 20,772,180 - 20,784,665 (+) NCBI mRatBN7.2 14 20,493,020 - 20,505,491 (+) NCBI Rnor_6.0 14 22,142,707 - 22,155,246 (+) NCBI
Sequence:
TTACATCTTTCTTTTATTCATGTGTATGTGTAGTTGTTTGTATGTGGGAAACGTGTACGTGTATGAGTGGCCACAGAAGTGAAATGAATCCTATCTTCAGAGCAGGTACTACTTGGCTTAGTGAAATT GTGGACATGGTTCTAAATGATGGAAATGTTGAAAAATGTAAGCGAGATGTTATTACCTCTAAAGTTCCAATGTTGGAACAAAATGTTCCTGGAGCAAGAAGATCAGGTGTTGAACTCTTGAAGAAAAC TCCATCACCTCGAATTATAAAGACACATCTTCCAATTGATCTACTCCCAAAATCCTTCTGGGATAACAAGTGCAAGATGATTTACCTTGCTAGAAATGGCAAGGATGTTGCTGTGTCCTATTATCATT TTGATCTAATGAATAATATTCAGCCTCTTCCTGGCACCTGGGAAGAATATCTGGAGAAATTCCTCGCTGGAAATGTGGCCTATGGCTCATGGTTCGATCATGTTAAGAGTTGGTGGGAAAAGAGGGAA GGGCATCCCATACTTTTCTTATACTATGAAGACTTGAAAAAGAACCCGAAGAAAGAAATCAAGAAGATTGCCAACTTTCTAGACAAGACCTTGGATGAACATACCTTGGAAAGGATCGTCCATCACAC CTCCTTTGAAGTGATGAAGGATAACCCCCTGGTCAATTACACCCATCTGCCCACAGAAATAATGGATCACAGCAAGTCCCCATTCATGAGAAAAGGTGTTGTTGGTGACTGGAAAAATTACTTCACAA TGACCCAAAGTGAGAAATTTGATGCCATATATAAGAAGAAATTGTCTGGAACAACACTTGAGTTCTGCACAGATATTCAGAGTGCCTAAACTTCAACTTGAATATATGATTTCTTGAAATAGTAGTTT GACAGGGAAATCAGATGGATTTGTGAGGGAGAAATAAATGTGCTTTTAAAACACTGATTAAATATGCCCTGCACATCCCTCAGCAGGAATTATTAATAATTCCGAATTATCTAGGGACAAGGTCTTTT GTGATCTTAGTTTTCAAAGGGTATGTCTTCAGATTCCAAAGTGACTACTGAATTAAATAAATAAGTTTTGTGAGTTTTGAAAAAATA
hide sequence
RefSeq Acc Id:
NP_071958 ⟸ NM_022513
- UniProtKB:
P52847 (UniProtKB/Swiss-Prot), A6KU26 (UniProtKB/TrEMBL)
- Sequence:
MGTAEDVFRKDLKIIHGYPMVYAFALGWEKIEEFQSRPCDIVIPTYPKSGTTWLSEIVDMVLNDGNVGKCKRDVITSKVPMLEQNVPGARRSGVELLKKTPSPRIIKTHLPIDLLPKSFWDNKCKMIY LARNGKDVAVSYYHFDLMNNIQPLPGTWEEYLEKFLAGNVAYGSWFDHVKSWWEKREGHPILFLYYEDLKKNPKKEIKKIANFLDKTLDEHTLERIVHHTSFEVMKDNPLVNYTHLPTEIMDHSKSPF MRKGVVGDWKNYFTMTQSEKFDAIYKKKLSGTTLEFCTDIQSA
hide sequence
RefSeq Acc Id:
XP_008768278 ⟸ XM_008770056
- Peptide Label:
isoform X1
- UniProtKB:
P52847 (UniProtKB/Swiss-Prot), A6KU26 (UniProtKB/TrEMBL)
- Sequence:
MWETCTCMSGHRSEMNPIFRAGTTWLSEIVDMVLNDGNVEKCKRDVITSKVPMLEQNVPGARRS GVELLKKTPSPRIIKTHLPIDLLPKSFWDNKCKMIYLARNGKDVAVSYYHFDLMNNIQPLPGTWEEYLEKFLAGNVAYGSWFDHVKSWWEKREGHPILFLYYEDLKKNPKKEIKKIANFLDKTLDEHT LERIVHHTSFEVMKDNPLVNYTHLPTEIMDHSKSPFMRKGVVGDWKNYFTMTQSEKFDAIYKKKLSGTTLEFCTDIQSA
hide sequence
Ensembl Acc Id:
ENSRNOP00000002699 ⟸ ENSRNOT00000002699
RGD ID: 13699250
Promoter ID: EPDNEW_R9775
Type: initiation region
Name: Sult1b1_1
Description: sulfotransferase family 1B member 1
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 14 22,142,370 - 22,142,430 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-11-12
Sult1b1
sulfotransferase family 1B member 1
Sult1b1
sulfotransferase family, cytosolic, 1B, member 1
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2008-10-23
Sult1b1
sulfotransferase family, cytosolic, 1B, member 1
Sult1b1
sulfotransferase family 1B, member 1
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2004-12-14
Sult1b1
sulfotransferase family 1B, member 1
LOC64305
dopa/tyrosine sulfotransferase
Symbol and Name updated
1299863
APPROVED