Symbol:
Lrrc7
Name:
leucine rich repeat containing 7
RGD ID:
708527
Description:
Enables protein kinase binding activity. Involved in positive regulation of neuron projection development and response to toluene. Located in several cellular components, including axon initial segment; dendritic spine; and filopodium. Is active in glutamatergic synapse and postsynaptic density membrane. Human ortholog(s) of this gene implicated in cocaine dependence. Orthologous to human LRRC7 (leucine rich repeat containing 7); PARTICIPATES IN calcium/calmodulin dependent kinase 2 signaling pathway; INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
densin; densin 13T-16; densin 13T-17; densin 13T-23; densin 13T-29; densin 13T-41; densin 13T-43; densin 13T-57; densin 13T-57C; densin 13T-72; densin 13T-89; densin-180; leucine-rich repeat-containing protein 7; LOC117284
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Allele / Splice:
Lrrc7Tn(sb-T2/Bart3)2.253Mcwi
Genetic Models:
F344-Lrrc7Tn(sb-T2/Bart3)2.253Mcwi
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 249,792,441 - 250,294,267 (-) NCBI GRCr8 mRatBN7.2 2 247,146,616 - 247,634,945 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 247,147,752 - 247,634,547 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 254,879,113 - 255,357,086 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 252,772,486 - 253,250,577 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 247,741,203 - 248,227,243 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 264,910,594 - 265,300,860 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 264,910,594 - 265,300,868 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 283,549,882 - 283,934,360 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 256,228,792 - 256,644,029 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 256,243,398 - 256,458,663 (-) NCBI Celera 2 238,947,973 - 239,318,491 (-) NCBI Celera Cytogenetic Map 2 q45 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Lrrc7 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO LRRC7 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of LRRC7 mRNA CTD PMID:22079256 Lrrc7 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression EXP 6480464 2 more ... CTD PMID:21394737 Lrrc7 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of LRRC7 mRNA CTD PMID:32109520 Lrrc7 Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Lrrc7 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Lrrc7 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Lrrc7 Rat 4,4'-sulfonyldiphenol increases methylation ISO LRRC7 (Homo sapiens) 6480464 bisphenol S results in increased methylation of LRRC7 gene CTD PMID:31601247 Lrrc7 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of LRRC7 mRNA CTD PMID:24780913 and PMID:36843608 Lrrc7 Rat aflatoxin B1 decreases methylation ISO LRRC7 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of LRRC7 exon more ... CTD PMID:27153756 and PMID:30157460 Lrrc7 Rat Aflatoxin B2 alpha increases methylation ISO LRRC7 (Homo sapiens) 6480464 aflatoxin B2 results in increased methylation of LRRC7 intron CTD PMID:30157460 Lrrc7 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of LRRC7 mRNA CTD PMID:16483693 Lrrc7 Rat arsenous acid decreases expression ISO LRRC7 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of LRRC7 mRNA CTD PMID:26705709 Lrrc7 Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of LRRC7 gene CTD PMID:28931070 Lrrc7 Rat benzo[a]pyrene decreases methylation ISO LRRC7 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of LRRC7 promoter CTD PMID:27901495 Lrrc7 Rat benzo[e]pyrene decreases methylation ISO LRRC7 (Homo sapiens) 6480464 benzo(e)pyrene results in decreased methylation of LRRC7 intron CTD PMID:30157460 Lrrc7 Rat bis(2-ethylhexyl) phthalate multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in decreased expression of LRRC7 mRNA CTD PMID:25607892 Lrrc7 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of LRRC7 mRNA CTD PMID:25181051 and PMID:30816183 Lrrc7 Rat bisphenol A multiple interactions ISO LRRC7 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of LRRC7 gene CTD PMID:31601247 Lrrc7 Rat CGP 52608 multiple interactions ISO LRRC7 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to LRRC7 gene] CTD PMID:28238834 Lrrc7 Rat chlormequat chloride increases expression EXP 6480464 Chlormequat results in increased expression of LRRC7 protein CTD PMID:34958886 Lrrc7 Rat chromium(6+) affects expression ISO LRRC7 (Homo sapiens) 6480464 chromium hexavalent ion affects the expression of LRRC7 mRNA CTD PMID:30690063 Lrrc7 Rat cocaine affects response to substance ISO LRRC7 (Homo sapiens) 6480464 LRRC7 gene SNP affects the susceptibility to Cocaine CTD PMID:18438686 Lrrc7 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of LRRC7 mRNA CTD PMID:26577399 Lrrc7 Rat DDE multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in decreased expression of LRRC7 mRNA CTD PMID:25607892 Lrrc7 Rat diarsenic trioxide decreases expression ISO LRRC7 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of LRRC7 mRNA CTD PMID:26705709 Lrrc7 Rat dibutyl phthalate multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in decreased expression of LRRC7 mRNA CTD PMID:25607892 Lrrc7 Rat epoxiconazole multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in decreased expression of LRRC7 mRNA CTD PMID:25607892 Lrrc7 Rat fulvestrant multiple interactions ISO LRRC7 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of LRRC7 gene CTD PMID:31601247 Lrrc7 Rat linuron multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in decreased expression of LRRC7 mRNA CTD PMID:25607892 Lrrc7 Rat lipopolysaccharide multiple interactions ISO LRRC7 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Lrrc7 Rat maneb multiple interactions ISO Lrrc7 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in increased expression of LRRC7 mRNA CTD PMID:36117858 Lrrc7 Rat methapyrilene decreases methylation ISO LRRC7 (Homo sapiens) 6480464 Methapyrilene results in decreased methylation of LRRC7 intron CTD PMID:30157460 Lrrc7 Rat nitrofen decreases expression EXP 6480464 nitrofen results in decreased expression of LRRC7 mRNA CTD PMID:33484710 Lrrc7 Rat paraquat multiple interactions ISO Lrrc7 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in increased expression of LRRC7 mRNA CTD PMID:36117858 Lrrc7 Rat potassium chromate multiple interactions ISO LRRC7 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of LRRC7 mRNA CTD PMID:22079256 Lrrc7 Rat potassium chromate increases expression ISO LRRC7 (Homo sapiens) 6480464 potassium chromate(VI) results in increased expression of LRRC7 mRNA CTD PMID:22714537 Lrrc7 Rat potassium chromate decreases expression ISO LRRC7 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of LRRC7 mRNA CTD PMID:22079256 Lrrc7 Rat prochloraz multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in decreased expression of LRRC7 mRNA CTD PMID:25607892 Lrrc7 Rat procymidone multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in decreased expression of LRRC7 mRNA CTD PMID:25607892 Lrrc7 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO LRRC7 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Lrrc7 Rat S-nitrosoglutathione decreases expression ISO LRRC7 (Homo sapiens) 6480464 S-Nitrosoglutathione results in decreased expression of LRRC7 mRNA CTD PMID:38825487 Lrrc7 Rat sodium arsenite decreases expression ISO LRRC7 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of LRRC7 mRNA CTD PMID:34032870 Lrrc7 Rat thimerosal increases expression ISO LRRC7 (Homo sapiens) 6480464 Thimerosal results in increased expression of LRRC7 mRNA CTD PMID:27188386 Lrrc7 Rat titanium dioxide decreases methylation ISO Lrrc7 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of LRRC7 gene CTD PMID:35295148 Lrrc7 Rat triptonide increases expression ISO Lrrc7 (Mus musculus) 6480464 triptonide results in increased expression of LRRC7 mRNA CTD PMID:33045310 Lrrc7 Rat valproic acid decreases methylation ISO LRRC7 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of LRRC7 gene CTD PMID:29154799 Lrrc7 Rat valproic acid affects splicing EXP 6480464 Valproic Acid affects the splicing of LRRC7 mRNA CTD PMID:29427782 Lrrc7 Rat valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of LRRC7 mRNA CTD PMID:29427782 Lrrc7 Rat valproic acid increases expression ISO LRRC7 (Homo sapiens) 6480464 Valproic Acid results in increased expression of LRRC7 mRNA CTD PMID:23179753 and PMID:27188386 Lrrc7 Rat vinclozolin multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in decreased expression of LRRC7 mRNA CTD PMID:25607892 Lrrc7 Rat vinclozolin increases methylation EXP 6480464 vinclozolin results in increased methylation of LRRC7 gene CTD PMID:31682807 Lrrc7 Rat vorinostat decreases expression ISO LRRC7 (Homo sapiens) 6480464 vorinostat results in decreased expression of LRRC7 mRNA CTD PMID:27188386
(-)-epigallocatechin 3-gallate (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) ammonium chloride (EXP) arsenous acid (ISO) atrazine (EXP) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (EXP,ISO) CGP 52608 (ISO) chlormequat chloride (EXP) chromium(6+) (ISO) cocaine (ISO) Cuprizon (EXP) DDE (EXP) diarsenic trioxide (ISO) dibutyl phthalate (EXP) epoxiconazole (EXP) fulvestrant (ISO) linuron (EXP) lipopolysaccharide (ISO) maneb (ISO) methapyrilene (ISO) nitrofen (EXP) paraquat (ISO) potassium chromate (ISO) prochloraz (EXP) procymidone (EXP) S-(1,2-dichlorovinyl)-L-cysteine (ISO) S-nitrosoglutathione (ISO) sodium arsenite (ISO) thimerosal (ISO) titanium dioxide (ISO) triptonide (ISO) valproic acid (EXP,ISO) vinclozolin (EXP) vorinostat (ISO)
1.
Characterization of densin-180, a new brain-specific synaptic protein of the O-sialoglycoprotein family.
Apperson ML, etal., J Neurosci 1996 Nov 1;16(21):6839-52.
2.
CaMKII regulation in information processing and storage.
Coultrap SJ and Bayer KU, Trends Neurosci. 2012 Oct;35(10):607-18. doi: 10.1016/j.tins.2012.05.003. Epub 2012 Jun 19.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
5.
Developmentally regulated alternative splicing of densin modulates protein-protein interaction and subcellular localization.
Jiao Y, etal., J Neurochem. 2008 Jun;105(5):1746-60. Epub 2008 Feb 4.
6.
Repeated variable prenatal stress alters pre- and postsynaptic gene expression in the rat frontal pole.
Kinnunen AK, etal., J Neurochem. 2003 Aug;86(3):736-48.
7.
Toluene disrupts synaptogenesis in cultured hippocampal neurons.
Lin HM, etal., Toxicol Lett. 2009 Jan 30;184(2):90-6. Epub 2008 Nov 7.
8.
Densin-180, a synaptic protein, links to PSD-95 through its direct interaction with MAGUIN-1.
Ohtakara K, etal., Genes Cells. 2002 Nov;7(11):1149-60.
9.
Postsynaptic shank antagonizes dendrite branching induced by the leucine-rich repeat protein Densin-180.
Quitsch A, etal., J Neurosci. 2005 Jan 12;25(2):479-87.
10.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
12.
Multivalent interactions of calcium/calmodulin-dependent protein kinase II with the postsynaptic density proteins NR2B, densin-180, and alpha-actinin-2.
Robison AJ, etal., J Biol Chem. 2005 Oct 21;280(42):35329-36. Epub 2005 Aug 24.
13.
Association of calcium/calmodulin-dependent kinase II with developmentally regulated splice variants of the postsynaptic density protein densin-180.
Strack S, etal., J Biol Chem 2000 Aug 18;275(33):25061-4.
14.
Integral membrane proteins of the nuclear envelope are dispersed throughout the endoplasmic reticulum during mitosis.
Yang L, etal., J Cell Biol. 1997 Jun 16;137(6):1199-210.
15.
Substance dependence low-density whole genome association study in two distinct American populations.
Yu Y, etal., Hum Genet. 2008 Jun;123(5):495-506. doi: 10.1007/s00439-008-0501-0. Epub 2008 Apr 26.
Lrrc7 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 249,792,441 - 250,294,267 (-) NCBI GRCr8 mRatBN7.2 2 247,146,616 - 247,634,945 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 247,147,752 - 247,634,547 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 254,879,113 - 255,357,086 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 252,772,486 - 253,250,577 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 247,741,203 - 248,227,243 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 264,910,594 - 265,300,860 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 264,910,594 - 265,300,868 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 283,549,882 - 283,934,360 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 256,228,792 - 256,644,029 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 256,243,398 - 256,458,663 (-) NCBI Celera 2 238,947,973 - 239,318,491 (-) NCBI Celera Cytogenetic Map 2 q45 NCBI
LRRC7 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 69,567,922 - 70,144,364 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 69,567,922 - 70,151,945 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 70,033,605 - 70,610,047 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 69,998,446 - 70,361,759 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 69,937,878 - 70,299,947 NCBI Celera 1 68,515,739 - 68,879,117 (+) NCBI Celera Cytogenetic Map 1 p31.1 NCBI HuRef 1 68,336,211 - 68,700,364 (+) NCBI HuRef CHM1_1 1 70,341,207 - 70,704,575 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 69,444,558 - 70,022,853 (+) NCBI T2T-CHM13v2.0
Lrrc7 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 157,772,823 - 158,268,254 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 157,788,528 - 158,267,858 (-) Ensembl GRCm39 Ensembl GRCm39 Ensembl 3 157,772,823 - 157,781,749 (-) Ensembl GRCm39 Ensembl GRCm38 3 158,067,186 - 158,561,983 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 158,082,891 - 158,562,221 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 157,747,403 - 158,225,185 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 158,018,188 - 158,497,514 (-) NCBI MGSCv36 mm8 Celera 3 164,551,795 - 165,021,656 (-) NCBI Celera Cytogenetic Map 3 H4 NCBI cM Map 3 81.68 NCBI
Lrrc7 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955423 21,769,366 - 22,269,781 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955423 21,764,046 - 22,269,590 (-) NCBI ChiLan1.0 ChiLan1.0
LRRC7 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 156,729,554 - 157,306,887 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 155,889,299 - 156,466,539 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 68,802,557 - 69,359,159 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 70,792,893 - 71,345,038 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 70,794,254 - 71,343,917 (+) Ensembl panpan1.1 panPan2
LRRC7 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 6 75,578,651 - 75,964,171 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 6 75,580,515 - 75,964,156 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 6 78,192,058 - 78,683,655 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 6 76,172,143 - 76,670,419 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 6 76,170,136 - 76,671,316 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 6 75,723,968 - 76,216,099 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 6 75,619,437 - 76,117,489 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 6 76,120,686 - 76,612,920 (-) NCBI UU_Cfam_GSD_1.0
Lrrc7 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 82,071,931 - 82,603,512 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936591 1,900,334 - 2,416,912 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936591 1,905,434 - 2,417,053 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
LRRC7 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 142,735,890 - 143,274,231 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 142,735,676 - 143,273,992 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 132,308,495 - 132,436,571 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
LRRC7 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 63,016,441 - 63,567,809 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 63,018,105 - 63,565,817 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666033 54,048,609 - 54,605,591 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Lrrc7
.
Predicted Target Of
Count of predictions: 461 Count of miRNA genes: 100 Interacting mature miRNAs: 103 Transcripts: ENSRNOT00000016073, ENSRNOT00000016453, ENSRNOT00000033502, ENSRNOT00000052190, ENSRNOT00000066024 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
7207484 Bss108 Bone structure and strength QTL 108 5.3 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 2 211744537 249053267 Rat 7411555 Bw132 Body weight QTL 132 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 2 223389739 249053267 Rat 631563 Hcuc3 Hepatic copper content QTL 3 3.87 liver copper amount (VT:0003065) liver copper weight to liver dry weight ratio (CMO:0001512) 2 229059610 249053267 Rat 9587428 Epfw6 Epididymal fat weight QTL 6 7.47 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 2 223389739 249053267 Rat 7207482 Bss107 Bone structure and strength QTL 107 7 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 2 211744537 249053267 Rat 1298075 Scl17 Serum cholesterol level QTL 17 3.4 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 2 211744537 249053267 Rat 1641891 Alcrsp17 Alcohol response QTL 17 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 149559561 249053267 Rat 1549836 Bss2 Bone structure and strength QTL 2 7.5 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 2 211744537 249053267 Rat 724534 Uae6 Urinary albumin excretion QTL 6 10 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 2 78665619 249053267 Rat 2317885 Alcrsp28 Alcohol response QTL 28 2.1 0.63 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 212828222 249053267 Rat 7207490 Bss111 Bone structure and strength QTL 111 6.4 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 2 211744537 249053267 Rat
This gene Lrrc7 is modified in the following models/strains:
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
7
6
49
107
56
59
31
19
31
6
138
84
91
10
58
28
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000016073 ⟹ ENSRNOP00000016073
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 247,211,159 - 247,533,340 (-) Ensembl Rnor_6.0 Ensembl 2 264,973,457 - 265,300,868 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000033502 ⟹ ENSRNOP00000034455
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 247,208,691 - 247,533,340 (-) Ensembl Rnor_6.0 Ensembl 2 264,973,457 - 265,300,868 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000066024 ⟹ ENSRNOP00000059517
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 247,147,752 - 247,533,340 (-) Ensembl Rnor_6.0 Ensembl 2 264,910,594 - 265,300,868 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000099468 ⟹ ENSRNOP00000082144
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 247,147,752 - 247,634,547 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000115389 ⟹ ENSRNOP00000082626
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 247,147,752 - 247,634,547 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000116114 ⟹ ENSRNOP00000093706
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 247,147,752 - 247,533,340 (-) Ensembl
RefSeq Acc Id:
NM_001393674 ⟹ NP_001380603
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 249,805,448 - 250,293,718 (-) NCBI mRatBN7.2 2 247,146,616 - 247,634,945 (-) NCBI
RefSeq Acc Id:
NM_057142 ⟹ NP_476483
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 249,805,448 - 250,293,718 (-) NCBI mRatBN7.2 2 247,146,616 - 247,634,945 (-) NCBI Rnor_6.0 2 264,910,594 - 265,300,860 (-) NCBI Rnor_5.0 2 283,549,882 - 283,934,360 (-) NCBI RGSC_v3.4 2 256,228,792 - 256,644,029 (-) RGD Celera 2 238,947,973 - 239,318,491 (-) RGD
Sequence:
TGCTTCTGCGATGATGGAGAACCTAATACGGGGAAGGAATCCCCCACAATATCAGAGAAGTCCTTGTAAGGAGGCCCGTGCAGCACTTCGGAAGAGGCCTGAAGAAGAGTGAGCCCGCTACATGAAAA
hide sequence
RefSeq Acc Id:
XM_063281181 ⟹ XP_063137251
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 249,792,441 - 250,294,261 (-) NCBI
RefSeq Acc Id:
XM_063281182 ⟹ XP_063137252
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 249,792,441 - 250,294,263 (-) NCBI
RefSeq Acc Id:
XM_063281183 ⟹ XP_063137253
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 249,792,441 - 250,294,257 (-) NCBI
RefSeq Acc Id:
XM_063281184 ⟹ XP_063137254
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 249,806,995 - 250,294,263 (-) NCBI
RefSeq Acc Id:
XM_063281185 ⟹ XP_063137255
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 249,792,441 - 250,294,261 (-) NCBI
RefSeq Acc Id:
XM_063281186 ⟹ XP_063137256
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 249,792,441 - 250,294,260 (-) NCBI
RefSeq Acc Id:
XM_063281187 ⟹ XP_063137257
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 249,792,441 - 250,294,258 (-) NCBI
RefSeq Acc Id:
XM_063281188 ⟹ XP_063137258
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 249,792,441 - 250,294,264 (-) NCBI
RefSeq Acc Id:
XM_063281189 ⟹ XP_063137259
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 249,792,441 - 250,294,260 (-) NCBI
RefSeq Acc Id:
XM_063281190 ⟹ XP_063137260
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 249,792,441 - 250,294,259 (-) NCBI
RefSeq Acc Id:
XM_063281191 ⟹ XP_063137261
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 249,792,441 - 249,972,996 (-) NCBI
RefSeq Acc Id:
XM_063281192 ⟹ XP_063137262
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 249,972,888 - 250,294,267 (-) NCBI
RefSeq Acc Id:
NP_476483 ⟸ NM_057142
- Peptide Label:
isoform 2
- UniProtKB:
Q9JI42 (UniProtKB/Swiss-Prot), P70587 (UniProtKB/Swiss-Prot), A6HWU2 (UniProtKB/TrEMBL)
- Sequence:
MQCLEMTTKRKLIGRLVPCRCFRGEEEIISVLDYSHCSLQQVPKEVFNFERTLEELYLDANQIEELPKQLFNCQALRKLSIPDNDLSSLPTSIASLVNLKELDISKNGVQEFPENIKCCKCLTIIEAS
hide sequence
Ensembl Acc Id:
ENSRNOP00000016073 ⟸ ENSRNOT00000016073
Ensembl Acc Id:
ENSRNOP00000034455 ⟸ ENSRNOT00000033502
Ensembl Acc Id:
ENSRNOP00000059517 ⟸ ENSRNOT00000066024
Ensembl Acc Id:
ENSRNOP00000093706 ⟸ ENSRNOT00000116114
Ensembl Acc Id:
ENSRNOP00000082144 ⟸ ENSRNOT00000099468
Ensembl Acc Id:
ENSRNOP00000082626 ⟸ ENSRNOT00000115389
RefSeq Acc Id:
NP_001380603 ⟸ NM_001393674
- Peptide Label:
isoform 1
- UniProtKB:
Q9JI42 (UniProtKB/Swiss-Prot), P70587 (UniProtKB/Swiss-Prot), F1M4K6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063137258 ⟸ XM_063281188
- Peptide Label:
isoform X8
- UniProtKB:
Q9JI42 (UniProtKB/Swiss-Prot), P70587 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063137252 ⟸ XM_063281182
- Peptide Label:
isoform X2
- UniProtKB:
Q9JI42 (UniProtKB/Swiss-Prot), P70587 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063137255 ⟸ XM_063281185
- Peptide Label:
isoform X5
- UniProtKB:
Q9JI42 (UniProtKB/Swiss-Prot), P70587 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063137251 ⟸ XM_063281181
- Peptide Label:
isoform X1
- UniProtKB:
Q9JI42 (UniProtKB/Swiss-Prot), P70587 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063137256 ⟸ XM_063281186
- Peptide Label:
isoform X6
- UniProtKB:
Q9JI42 (UniProtKB/Swiss-Prot), P70587 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063137259 ⟸ XM_063281189
- Peptide Label:
isoform X9
- UniProtKB:
Q9JI42 (UniProtKB/Swiss-Prot), P70587 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063137260 ⟸ XM_063281190
- Peptide Label:
isoform X10
- UniProtKB:
Q9JI42 (UniProtKB/Swiss-Prot), P70587 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063137257 ⟸ XM_063281187
- Peptide Label:
isoform X7
- UniProtKB:
Q9JI42 (UniProtKB/Swiss-Prot), P70587 (UniProtKB/Swiss-Prot), A0A8I5ZTY2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063137253 ⟸ XM_063281183
- Peptide Label:
isoform X3
- UniProtKB:
Q9JI42 (UniProtKB/Swiss-Prot), P70587 (UniProtKB/Swiss-Prot), A0A8I6G9P9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063137261 ⟸ XM_063281191
- Peptide Label:
isoform X11
RefSeq Acc Id:
XP_063137254 ⟸ XM_063281184
- Peptide Label:
isoform X4
- UniProtKB:
Q9JI42 (UniProtKB/Swiss-Prot), P70587 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063137262 ⟸ XM_063281192
- Peptide Label:
isoform X12
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2005-07-08
Lrrc7
leucine rich repeat containing 7
LOC117284
densin-180
Symbol and Name updated
1299863 APPROVED
