Symbol:
Hnrnpab
Name:
heterogeneous nuclear ribonucleoprotein A/B
RGD ID:
69255
Description:
Enables sequence-specific double-stranded DNA binding activity. Involved in cellular response to amino acid stimulus and regulation of intracellular mRNA localization. Located in dendrite and neuronal ribonucleoprotein granule. Part of ribonucleoprotein complex. Used to study transient cerebral ischemia. Human ortholog(s) of this gene implicated in hepatocellular carcinoma. Orthologous to human HNRNPAB (heterogeneous nuclear ribonucleoprotein A/B); PARTICIPATES IN spliceosome pathway; INTERACTS WITH (S)-AMPA; 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane; 17alpha-ethynylestradiol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
A1F-C1; CArG-binding factor-A; CBF-A; Cgbf; Cgbfa; DBP40; heterogeneous nuclear ribonucleoprotein A/B-like; Hnrpab; LOC100910156; LOC103689931
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 36,358,004 - 36,363,898 (-) NCBI GRCr8 mRatBN7.2 10 35,857,040 - 35,862,935 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 35,857,041 - 35,863,344 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 40,551,497 - 40,557,391 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 40,041,789 - 40,047,683 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 35,545,198 - 35,551,092 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 34,955,713 - 34,961,662 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 37,049,677 - 37,055,282 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 34,955,716 - 34,961,608 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 36,821,682 - 36,827,630 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 37,117,285 - 37,123,177 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 12 27,570,905 - 27,583,441 (+) NCBI Celera 10 35,213,782 - 35,219,674 (-) NCBI Celera Cytogenetic Map 10 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Hnrnpab Rat (S)-AMPA increases expression EXP 6480464 alpha-Amino-3-hydroxy-5-methyl-4-isoxazolepropionic Acid results in increased expression of HNRNPAB protein CTD PMID:21471000 Hnrnpab Rat 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane increases expression ISO Hnrnpab (Mus musculus) 6480464 o and p'-DDT results in increased expression of HNRNPAB mRNA CTD PMID:24096037 Hnrnpab Rat 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane increases expression EXP 6480464 o and p'-DDT results in increased expression of HNRNPAB mRNA CTD PMID:24096037 Hnrnpab Rat 1,2-dimethylhydrazine multiple interactions ISO Hnrnpab (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of HNRNPAB mRNA CTD PMID:22206623 Hnrnpab Rat 1,2-dimethylhydrazine affects expression ISO Hnrnpab (Mus musculus) 6480464 1 and 2-Dimethylhydrazine affects the expression of HNRNPAB mRNA CTD PMID:22206623 Hnrnpab Rat 17alpha-ethynylestradiol affects expression ISO Hnrnpab (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of HNRNPAB mRNA CTD PMID:17555576 Hnrnpab Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of HNRNPAB mRNA CTD PMID:16174780 more ... Hnrnpab Rat 17alpha-ethynylestradiol increases expression ISO Hnrnpab (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of HNRNPAB mRNA CTD PMID:16174780 more ... Hnrnpab Rat 17alpha-ethynylestradiol multiple interactions ISO Hnrnpab (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of HNRNPAB mRNA CTD PMID:17942748 Hnrnpab Rat 17beta-estradiol increases expression ISO HNRNPAB (Homo sapiens) 6480464 Estradiol results in increased expression of HNRNPAB mRNA CTD PMID:14605097 and PMID:31614463 Hnrnpab Rat 17beta-estradiol increases expression ISO Hnrnpab (Mus musculus) 6480464 Estradiol results in increased expression of HNRNPAB mRNA CTD PMID:39298647 Hnrnpab Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of HNRNPAB mRNA CTD PMID:32145629 Hnrnpab Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Hnrnpab (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of HNRNPAB mRNA CTD PMID:24058054 Hnrnpab Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of HNRNPAB mRNA CTD PMID:32109520 and PMID:34747641 Hnrnpab Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Hnrnpab (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of HNRNPAB mRNA CTD PMID:17942748 Hnrnpab Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Hnrnpab (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of HNRNPAB mRNA CTD PMID:17942748 Hnrnpab Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Hnrnpab (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of HNRNPAB mRNA CTD PMID:21570461 Hnrnpab Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Hnrnpab Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether decreases expression EXP 6480464 2 more ... CTD PMID:19954255 Hnrnpab Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of HNRNPAB mRNA CTD PMID:21346803 Hnrnpab Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of HNRNPAB mRNA CTD PMID:21346803 Hnrnpab Rat 3',5'-cyclic UMP affects binding ISO HNRNPAB (Homo sapiens) 6480464 HNRNPAB protein binds to cyclic 3' and 5'-uridine monophosphate CTD PMID:30528433 Hnrnpab Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO HNRNPAB (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of HNRNPAB mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of HNRNPAB mRNA CTD PMID:28628672 Hnrnpab Rat 4,4'-diaminodiphenylmethane decreases expression ISO Hnrnpab (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of HNRNPAB mRNA CTD PMID:18648102 Hnrnpab Rat 4,4'-sulfonyldiphenol increases expression ISO Hnrnpab (Mus musculus) 6480464 bisphenol S results in increased expression of HNRNPAB mRNA CTD PMID:39298647 Hnrnpab Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of HNRNPAB mRNA CTD PMID:24780913 and PMID:30047161 Hnrnpab Rat acrolein multiple interactions ISO HNRNPAB (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of and results in increased oxidation of HNRNPAB mRNA more ... CTD PMID:32699268 and PMID:32845096 Hnrnpab Rat afimoxifene multiple interactions ISO HNRNPAB (Homo sapiens) 6480464 afimoxifene inhibits the reaction [Estrogens results in increased expression of HNRNPAB mRNA] CTD PMID:21233418 Hnrnpab Rat aflatoxin B1 decreases expression ISO Hnrnpab (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of HNRNPAB mRNA CTD PMID:19770486 Hnrnpab Rat aflatoxin B1 increases expression ISO HNRNPAB (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of HNRNPAB mRNA CTD PMID:22100608 and PMID:27153756 Hnrnpab Rat all-trans-retinoic acid multiple interactions ISO HNRNPAB (Homo sapiens) 6480464 [Tretinoin co-treated with Tamoxifen] results in decreased expression of HNRNPAB protein CTD PMID:17098229 Hnrnpab Rat all-trans-retinoic acid decreases expression ISO HNRNPAB (Homo sapiens) 6480464 Tretinoin results in decreased expression of HNRNPAB protein CTD PMID:17098229 Hnrnpab Rat alpha-pinene multiple interactions ISO HNRNPAB (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of and results in increased oxidation of HNRNPAB mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in decreased expression of and results in increased oxidation of HNRNPAB mRNA CTD PMID:32699268 Hnrnpab Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of HNRNPAB mRNA CTD PMID:30047161 Hnrnpab Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of HNRNPAB mRNA CTD PMID:16483693 Hnrnpab Rat Aroclor 1254 decreases expression ISO Hnrnpab (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of HNRNPAB mRNA CTD PMID:23650126 Hnrnpab Rat benzo[a]pyrene increases expression ISO Hnrnpab (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of HNRNPAB mRNA CTD PMID:22228805 Hnrnpab Rat benzo[a]pyrene increases methylation ISO HNRNPAB (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of HNRNPAB promoter CTD PMID:27901495 Hnrnpab Rat benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of HNRNPAB mRNA CTD PMID:21839799 Hnrnpab Rat bis(2-chloroethyl) sulfide decreases expression ISO HNRNPAB (Homo sapiens) 6480464 Mustard Gas results in decreased expression of HNRNPAB mRNA CTD PMID:25102026 Hnrnpab Rat bis(2-ethylhexyl) phthalate decreases expression ISO Hnrnpab (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of HNRNPAB mRNA CTD PMID:33754040 Hnrnpab Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of HNRNPAB mRNA CTD PMID:25181051 more ... Hnrnpab Rat bisphenol A decreases expression ISO Hnrnpab (Mus musculus) 6480464 bisphenol A results in decreased expression of HNRNPAB mRNA CTD PMID:33221593 Hnrnpab Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of HNRNPAB protein CTD PMID:32145629 Hnrnpab Rat bisphenol A decreases expression ISO HNRNPAB (Homo sapiens) 6480464 bisphenol A results in decreased expression of HNRNPAB mRNA CTD PMID:29275510 Hnrnpab Rat bisphenol A multiple interactions ISO HNRNPAB (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of HNRNPAB mRNA CTD PMID:28628672 Hnrnpab Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Genistein] results in decreased methylation of HNRNPAB gene and [bisphenol A co-treated with Genistein] results in increased methylation of HNRNPAB gene CTD PMID:28505145 Hnrnpab Rat bisphenol A affects methylation ISO Hnrnpab (Mus musculus) 6480464 bisphenol A affects the methylation of HNRNPAB promoter CTD PMID:27334623 Hnrnpab Rat bisphenol AF increases expression ISO HNRNPAB (Homo sapiens) 6480464 bisphenol AF results in increased expression of HNRNPAB protein CTD PMID:34186270 Hnrnpab Rat bisphenol F multiple interactions ISO HNRNPAB (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of HNRNPAB mRNA CTD PMID:28628672 Hnrnpab Rat bleomycin A5 increases expression ISO HNRNPAB (Homo sapiens) 6480464 bleomycetin results in increased expression of HNRNPAB mRNA CTD PMID:21040473 Hnrnpab Rat cadmium atom multiple interactions ISO HNRNPAB (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of HNRNPAB mRNA CTD PMID:35301059 Hnrnpab Rat cadmium dichloride multiple interactions ISO HNRNPAB (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of HNRNPAB mRNA CTD PMID:35301059 Hnrnpab Rat caffeine decreases phosphorylation ISO HNRNPAB (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of HNRNPAB protein CTD PMID:35688186 Hnrnpab Rat carbon nanotube increases expression ISO Hnrnpab (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Hnrnpab Rat chloropicrin affects expression ISO HNRNPAB (Homo sapiens) 6480464 chloropicrin affects the expression of HNRNPAB mRNA CTD PMID:26352163 Hnrnpab Rat chlorpyrifos decreases expression ISO Hnrnpab (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of HNRNPAB mRNA CTD PMID:37019170 Hnrnpab Rat chromium(6+) affects expression ISO Hnrnpab (Mus musculus) 6480464 chromium hexavalent ion affects the expression of HNRNPAB mRNA CTD PMID:28472532 Hnrnpab Rat chromium(6+) multiple interactions ISO HNRNPAB (Homo sapiens) 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in decreased expression of HNRNPAB mRNA CTD PMID:38479592 Hnrnpab Rat chrysene increases expression ISO Hnrnpab (Mus musculus) 6480464 chrysene results in increased expression of HNRNPAB mRNA CTD PMID:26377693 Hnrnpab Rat cisplatin decreases expression EXP 6480464 Cisplatin results in decreased expression of HNRNPAB protein CTD PMID:22023808 Hnrnpab Rat cobalt dichloride decreases expression ISO HNRNPAB (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of HNRNPAB mRNA CTD PMID:19320972 Hnrnpab Rat copper atom decreases expression ISO Hnrnpab (Mus musculus) 6480464 Copper results in decreased expression of HNRNPAB protein CTD PMID:21146535 Hnrnpab Rat copper(0) decreases expression ISO Hnrnpab (Mus musculus) 6480464 Copper results in decreased expression of HNRNPAB protein CTD PMID:21146535 Hnrnpab Rat crocidolite asbestos decreases expression ISO Hnrnpab (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of HNRNPAB mRNA CTD PMID:29279043 Hnrnpab Rat cyclosporin A decreases expression ISO HNRNPAB (Homo sapiens) 6480464 Cyclosporine results in decreased expression of HNRNPAB mRNA CTD PMID:21163907 Hnrnpab Rat DDE increases expression ISO HNRNPAB (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of HNRNPAB mRNA CTD PMID:38568856 Hnrnpab Rat decabromodiphenyl ether increases expression ISO Hnrnpab (Mus musculus) 6480464 decabromobiphenyl ether results in increased expression of HNRNPAB mRNA CTD PMID:29699156 Hnrnpab Rat dexamethasone multiple interactions ISO HNRNPAB (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of HNRNPAB mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of HNRNPAB mRNA CTD PMID:28628672 Hnrnpab Rat Dibutyl phosphate affects expression ISO HNRNPAB (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of HNRNPAB mRNA CTD PMID:37042841 Hnrnpab Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of HNRNPAB mRNA CTD PMID:17379624 Hnrnpab Rat dibutyl phthalate decreases expression ISO Hnrnpab (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of HNRNPAB mRNA CTD PMID:21266533 Hnrnpab Rat dioxygen decreases expression ISO HNRNPAB (Homo sapiens) 6480464 Oxygen deficiency results in decreased expression of HNRNPAB mRNA CTD PMID:26516004 Hnrnpab Rat dioxygen multiple interactions EXP 6480464 [Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in increased expression of HNRNPAB mRNA CTD PMID:33729688 Hnrnpab Rat enzyme inhibitor multiple interactions ISO HNRNPAB (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of HNRNPAB protein CTD PMID:23301498 Hnrnpab Rat flavonoids increases expression EXP 6480464 Flavonoids results in increased expression of HNRNPAB mRNA CTD PMID:18035473 Hnrnpab Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of HNRNPAB mRNA CTD PMID:24136188 Hnrnpab Rat folic acid multiple interactions ISO Hnrnpab (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of HNRNPAB mRNA CTD PMID:22206623 Hnrnpab Rat FR900359 affects phosphorylation ISO HNRNPAB (Homo sapiens) 6480464 FR900359 affects the phosphorylation of HNRNPAB protein CTD PMID:37730182 Hnrnpab Rat genistein decreases methylation EXP 6480464 Genistein results in decreased methylation of HNRNPAB gene CTD PMID:28505145 Hnrnpab Rat genistein multiple interactions EXP 6480464 [bisphenol A co-treated with Genistein] results in decreased methylation of HNRNPAB gene and [bisphenol A co-treated with Genistein] results in increased methylation of HNRNPAB gene CTD PMID:28505145 Hnrnpab Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of HNRNPAB mRNA CTD PMID:22061828 Hnrnpab Rat geraniol decreases expression ISO HNRNPAB (Homo sapiens) 6480464 geraniol results in decreased expression of HNRNPAB mRNA CTD PMID:27683099 Hnrnpab Rat hydrogen cyanide increases expression ISO Hnrnpab (Mus musculus) 6480464 Hydrogen Cyanide results in increased expression of HNRNPAB mRNA CTD PMID:33914522 Hnrnpab Rat hydrogen peroxide affects expression ISO HNRNPAB (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of HNRNPAB mRNA CTD PMID:20044591 Hnrnpab Rat indometacin multiple interactions ISO HNRNPAB (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of HNRNPAB mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of HNRNPAB mRNA CTD PMID:28628672 Hnrnpab Rat ivermectin decreases expression ISO HNRNPAB (Homo sapiens) 6480464 Ivermectin results in decreased expression of HNRNPAB protein CTD PMID:32959892 Hnrnpab Rat lipopolysaccharide multiple interactions ISO HNRNPAB (Homo sapiens) 6480464 [NAT10 protein affects the susceptibility to Lipopolysaccharides] which affects the expression of HNRNPAB mRNA CTD PMID:35877022 Hnrnpab Rat lovastatin increases expression ISO Hnrnpab (Mus musculus) 6480464 Lovastatin results in increased expression of HNRNPAB mRNA CTD PMID:20493250 Hnrnpab Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of HNRNPAB mRNA CTD PMID:30047161 Hnrnpab Rat methotrexate decreases expression ISO HNRNPAB (Homo sapiens) 6480464 Methotrexate results in decreased expression of HNRNPAB mRNA CTD PMID:24449571 Hnrnpab Rat methylseleninic acid decreases expression ISO HNRNPAB (Homo sapiens) 6480464 methylselenic acid results in decreased expression of HNRNPAB mRNA CTD PMID:18548127 Hnrnpab Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of HNRNPAB mRNA CTD PMID:24136188 Hnrnpab Rat nitrates multiple interactions ISO Hnrnpab (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of HNRNPAB mRNA CTD PMID:35964746 Hnrnpab Rat oxycodone increases expression EXP 6480464 Oxycodone results in increased expression of HNRNPAB mRNA CTD PMID:23439660 Hnrnpab Rat ozone multiple interactions ISO HNRNPAB (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of and results in increased oxidation of HNRNPAB mRNA more ... CTD PMID:32699268 and PMID:32845096 Hnrnpab Rat paclitaxel decreases expression ISO HNRNPAB (Homo sapiens) 6480464 Paclitaxel results in decreased expression of HNRNPAB mRNA CTD PMID:15000894 Hnrnpab Rat paracetamol increases expression ISO HNRNPAB (Homo sapiens) 6480464 Acetaminophen results in increased expression of HNRNPAB protein CTD PMID:22230336 Hnrnpab Rat paracetamol affects expression ISO Hnrnpab (Mus musculus) 6480464 Acetaminophen affects the expression of HNRNPAB mRNA CTD PMID:17562736 Hnrnpab Rat paracetamol decreases expression ISO HNRNPAB (Homo sapiens) 6480464 Acetaminophen results in decreased expression of HNRNPAB protein CTD PMID:22230336 Hnrnpab Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of HNRNPAB mRNA CTD PMID:32680482 Hnrnpab Rat perfluorooctanoic acid increases expression EXP 6480464 perfluorooctanoic acid results in increased expression of HNRNPAB mRNA CTD PMID:19162173 Hnrnpab Rat phenobarbital affects expression ISO Hnrnpab (Mus musculus) 6480464 Phenobarbital affects the expression of HNRNPAB mRNA CTD PMID:23091169 Hnrnpab Rat potassium cyanide increases expression ISO Hnrnpab (Mus musculus) 6480464 Potassium Cyanide results in increased expression of HNRNPAB mRNA CTD PMID:33914522 Hnrnpab Rat pregnenolone 16alpha-carbonitrile increases expression EXP 6480464 Pregnenolone Carbonitrile results in increased expression of HNRNPAB mRNA CTD PMID:30047161 Hnrnpab Rat progesterone decreases expression EXP 6480464 Progesterone results in decreased expression of HNRNPAB mRNA CTD PMID:20726854 Hnrnpab Rat propiconazole increases expression EXP 6480464 propiconazole results in increased expression of HNRNPAB mRNA CTD PMID:30047161 Hnrnpab Rat quartz increases expression ISO HNRNPAB (Homo sapiens) 6480464 Quartz results in increased expression of HNRNPAB protein CTD PMID:27917503 Hnrnpab Rat resveratrol decreases expression ISO Hnrnpab (Mus musculus) 6480464 resveratrol results in decreased expression of HNRNPAB protein CTD PMID:25505154 Hnrnpab Rat resveratrol multiple interactions ISO HNRNPAB (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of HNRNPAB mRNA CTD PMID:23557933 Hnrnpab Rat SB 431542 multiple interactions ISO HNRNPAB (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in decreased expression of HNRNPAB protein CTD PMID:37664457 Hnrnpab Rat silicon dioxide decreases expression ISO HNRNPAB (Homo sapiens) 6480464 Silicon Dioxide results in decreased expression of HNRNPAB protein CTD PMID:27917503 Hnrnpab Rat sodium arsenite increases expression ISO HNRNPAB (Homo sapiens) 6480464 sodium arsenite results in increased expression of HNRNPAB mRNA CTD PMID:28595984 and PMID:34032870 Hnrnpab Rat sodium arsenite decreases expression ISO HNRNPAB (Homo sapiens) 6480464 sodium arsenite results in decreased expression of HNRNPAB mRNA CTD PMID:38568856 Hnrnpab Rat sodium dodecyl sulfate decreases expression ISO HNRNPAB (Homo sapiens) 6480464 Sodium Dodecyl Sulfate results in decreased expression of HNRNPAB protein CTD PMID:21469165 Hnrnpab Rat sodium fluoride increases expression ISO Hnrnpab (Mus musculus) 6480464 Sodium Fluoride results in increased expression of HNRNPAB mRNA CTD PMID:27862939 Hnrnpab Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of HNRNPAB mRNA CTD PMID:30047161 Hnrnpab Rat T-2 toxin affects expression EXP 6480464 T-2 Toxin affects the expression of HNRNPAB protein CTD PMID:26141394 Hnrnpab Rat tamoxifen decreases expression ISO HNRNPAB (Homo sapiens) 6480464 Tamoxifen results in decreased expression of HNRNPAB protein CTD PMID:17098229 Hnrnpab Rat tamoxifen increases expression EXP 6480464 Tamoxifen results in increased expression of HNRNPAB mRNA CTD PMID:19400957 Hnrnpab Rat tamoxifen increases expression ISO Hnrnpab (Mus musculus) 6480464 Tamoxifen results in increased expression of HNRNPAB mRNA CTD PMID:19400957 Hnrnpab Rat tamoxifen affects expression ISO Hnrnpab (Mus musculus) 6480464 Tamoxifen affects the expression of HNRNPAB mRNA CTD PMID:17555576 Hnrnpab Rat tamoxifen multiple interactions ISO HNRNPAB (Homo sapiens) 6480464 [Tretinoin co-treated with Tamoxifen] results in decreased expression of HNRNPAB protein CTD PMID:17098229 Hnrnpab Rat temozolomide increases expression ISO HNRNPAB (Homo sapiens) 6480464 Temozolomide results in increased expression of HNRNPAB mRNA CTD PMID:31758290 Hnrnpab Rat tetrachloromethane increases expression ISO Hnrnpab (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of HNRNPAB mRNA CTD PMID:27339419 and PMID:31919559 Hnrnpab Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of HNRNPAB mRNA CTD PMID:31150632 Hnrnpab Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of HNRNPAB mRNA CTD PMID:34492290 Hnrnpab Rat trichloroethene increases expression ISO Hnrnpab (Mus musculus) 6480464 Trichloroethylene results in increased expression of HNRNPAB mRNA CTD PMID:19448997 Hnrnpab Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of HNRNPAB mRNA CTD PMID:33387578 Hnrnpab Rat trichloroethene increases methylation EXP 6480464 Trichloroethylene results in increased methylation of HNRNPAB gene CTD PMID:27618143 Hnrnpab Rat trichostatin A affects expression ISO HNRNPAB (Homo sapiens) 6480464 trichostatin A affects the expression of HNRNPAB mRNA CTD PMID:28542535 Hnrnpab Rat trimellitic anhydride increases expression ISO Hnrnpab (Mus musculus) 6480464 trimellitic anhydride results in increased expression of HNRNPAB mRNA CTD PMID:19042947 Hnrnpab Rat valproic acid decreases expression ISO HNRNPAB (Homo sapiens) 6480464 Valproic Acid results in decreased expression of HNRNPAB mRNA CTD PMID:29154799 Hnrnpab Rat valproic acid affects expression ISO Hnrnpab (Mus musculus) 6480464 Valproic Acid affects the expression of HNRNPAB mRNA CTD PMID:17292431 Hnrnpab Rat warfarin increases expression ISO Hnrnpab (Mus musculus) 6480464 Warfarin results in increased expression of HNRNPAB mRNA CTD PMID:20493250
(S)-AMPA (EXP) 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (EXP,ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 3',5'-cyclic UMP (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) acrolein (ISO) afimoxifene (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) alpha-pinene (ISO) amitrole (EXP) ammonium chloride (EXP) Aroclor 1254 (ISO) benzo[a]pyrene (EXP,ISO) bis(2-chloroethyl) sulfide (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) bisphenol F (ISO) bleomycin A5 (ISO) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (ISO) carbon nanotube (ISO) chloropicrin (ISO) chlorpyrifos (ISO) chromium(6+) (ISO) chrysene (ISO) cisplatin (EXP) cobalt dichloride (ISO) copper atom (ISO) copper(0) (ISO) crocidolite asbestos (ISO) cyclosporin A (ISO) DDE (ISO) decabromodiphenyl ether (ISO) dexamethasone (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP,ISO) dioxygen (EXP,ISO) enzyme inhibitor (ISO) flavonoids (EXP) flutamide (EXP) folic acid (ISO) FR900359 (ISO) genistein (EXP) gentamycin (EXP) geraniol (ISO) hydrogen cyanide (ISO) hydrogen peroxide (ISO) indometacin (ISO) ivermectin (ISO) lipopolysaccharide (ISO) lovastatin (ISO) methimazole (EXP) methotrexate (ISO) methylseleninic acid (ISO) nefazodone (EXP) nitrates (ISO) oxycodone (EXP) ozone (ISO) paclitaxel (ISO) paracetamol (ISO) paraquat (EXP) perfluorooctanoic acid (EXP) phenobarbital (ISO) potassium cyanide (ISO) pregnenolone 16alpha-carbonitrile (EXP) progesterone (EXP) propiconazole (EXP) quartz (ISO) resveratrol (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sodium dodecyl sulfate (ISO) sodium fluoride (ISO) sulfadimethoxine (EXP) T-2 toxin (EXP) tamoxifen (EXP,ISO) temozolomide (ISO) tetrachloromethane (EXP,ISO) thioacetamide (EXP) trichloroethene (EXP,ISO) trichostatin A (ISO) trimellitic anhydride (ISO) valproic acid (ISO) warfarin (ISO)
1.
Proteomic analysis of in vivo-assembled pre-mRNA splicing complexes expands the catalog of participating factors.
Chen YI, etal., Nucleic Acids Res. 2007;35(12):3928-44. Epub 2007 May 30.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
4.
Purification and cloning of type A/B hnRNP proteins involved in transcriptional activation from the Rat spi 2 gene GAGA box.
Leverrier S, etal., Biol Chem. 2000 Nov;381(11):1031-40.
5.
CArG binding factor A (CBF-A) is involved in transcriptional regulation of the rat Ha-ras promoter.
Mikheev AM, etal., Nucleic Acids Res 2000 Oct 1;28(19):3762-70.
6.
Landscape of the hnRNP K protein-protein interactome.
Mikula M, etal., Proteomics. 2006 Apr;6(8):2395-406.
7.
Microarray analysis of the global gene expression profile following hypothermia and transient focal cerebral ischemia.
Nagel S, etal., Neuroscience. 2012 Apr 19;208:109-22. doi: 10.1016/j.neuroscience.2012.01.048. Epub 2012 Feb 10.
8.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.
Nuclear actin is associated with a specific subset of hnRNP A/B-type proteins.
Percipalle P, etal., Nucleic Acids Res. 2002 Apr 15;30(8):1725-34.
10.
In neurons, activity-dependent association of dendritically transported mRNA transcripts with the transacting factor CBF-A is mediated by A2RE/RTS elements.
Raju CS, etal., Mol Biol Cell. 2011 Jun 1;22(11):1864-77. doi: 10.1091/mbc.E10-11-0904. Epub 2011 Apr 6.
11.
GOA pipeline
RGD automated data pipeline
12.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
13.
Functional domains involved in the interaction between Orc1 and transcriptional repressor AlF-C that bind to an origin/promoter of the rat aldolase B gene.
Saitoh Y, etal., Nucleic Acids Res 2002 Dec 1;30(23):5205-12.
14.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
15.
A novel growth-related nuclear protein binds and inhibits rat aldolase B gene promoter.
Yabuki T, etal., Gene 2001 Feb 7;264(1):123-9.
16.
HNRNPAB induces epithelial-mesenchymal transition and promotes metastasis of hepatocellular carcinoma by transcriptionally activating SNAIL.
Zhou ZJ, etal., Cancer Res. 2014 May 15;74(10):2750-62. doi: 10.1158/0008-5472.CAN-13-2509. Epub 2014 Mar 17.
Hnrnpab Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 36,358,004 - 36,363,898 (-) NCBI GRCr8 mRatBN7.2 10 35,857,040 - 35,862,935 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 35,857,041 - 35,863,344 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 40,551,497 - 40,557,391 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 40,041,789 - 40,047,683 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 35,545,198 - 35,551,092 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 34,955,713 - 34,961,662 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 37,049,677 - 37,055,282 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 34,955,716 - 34,961,608 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 36,821,682 - 36,827,630 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 37,117,285 - 37,123,177 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 12 27,570,905 - 27,583,441 (+) NCBI Celera 10 35,213,782 - 35,219,674 (-) NCBI Celera Cytogenetic Map 10 q22 NCBI
HNRNPAB Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 5 178,204,533 - 178,211,163 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 5 178,204,533 - 178,211,163 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 5 177,631,534 - 177,638,164 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 5 177,564,114 - 177,570,790 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 5 177,564,113 - 177,570,789 NCBI Celera 5 173,258,497 - 173,265,171 (+) NCBI Celera Cytogenetic Map 5 q35.3 NCBI HuRef 5 172,357,799 - 172,364,473 (+) NCBI HuRef CHM1_1 5 177,063,918 - 177,070,606 (+) NCBI CHM1_1 T2T-CHM13v2.0 5 178,754,824 - 178,761,448 (+) NCBI T2T-CHM13v2.0
Hnrnpab Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 51,490,927 - 51,497,708 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 51,490,927 - 51,497,674 (-) Ensembl GRCm39 Ensembl GRCm38 11 51,600,100 - 51,606,881 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 51,600,100 - 51,606,847 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 51,413,602 - 51,420,383 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 51,443,523 - 51,450,270 (-) NCBI MGSCv36 mm8 Celera 11 56,171,430 - 56,178,210 (-) NCBI Celera Cytogenetic Map 11 B1.3 NCBI cM Map 11 31.11 NCBI
Hnrnpab Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955408 2,060,829 - 2,065,416 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955408 2,060,288 - 2,064,998 (-) NCBI ChiLan1.0 ChiLan1.0
HNRNPAB Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 4 173,146,592 - 173,153,282 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 5 171,286,162 - 171,292,839 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 5 173,364,301 - 173,370,974 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 5 180,622,362 - 180,628,209 (+) NCBI panpan1.1 PanPan1.1 panPan2
HNRNPAB Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 11 3,355,051 - 3,360,376 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 11 3,355,050 - 3,360,258 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 11 3,498,638 - 3,505,066 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 11 3,331,321 - 3,337,750 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 11 3,331,325 - 3,337,599 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 11 3,301,752 - 3,308,179 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 11 3,383,069 - 3,389,498 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 11 3,621,655 - 3,628,090 (-) NCBI UU_Cfam_GSD_1.0
Hnrnpab
HNRNPAB
HNRNPAB
Hnrnpab
.
Predicted Target Of
Count of predictions: 500 Count of miRNA genes: 206 Interacting mature miRNAs: 242 Transcripts: ENSRNOT00000004885, ENSRNOT00000033056, ENSRNOT00000065584 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
61441 Btemp1 Thermal response to stress QTL 1 4 body temperature trait (VT:0005535) core body temperature (CMO:0001036) 10 35392457 63642539 Rat 9589136 Insul27 Insulin level QTL 27 10.46 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 10 11474010 56474010 Rat 152025229 Scl83 Serum cholesterol level QTL 83 4.33 blood cholesterol amount (VT:0000180) 10 35710580 68663659 Rat 1578779 Tcas10 Tongue tumor susceptibility QTL 10 3.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 10 31297439 76297439 Rat 631564 Apr3 Acute phase response QTL 3 3.9 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 10 15275955 60275955 Rat 1298069 Bp168 Blood pressure QTL 168 5.5 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 10 26521957 98003205 Rat 631554 Bp133 Blood pressure QTL 133 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 743364 63851208 Rat 631557 Bp136 Blood pressure QTL 136 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 30632053 75632053 Rat 61325 Aia5 Adjuvant induced arthritis QTL 5 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1578761 Stresp21 Stress response QTL 21 3.3 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 10 6375746 51375746 Rat 2298544 Neuinf9 Neuroinflammation QTL 9 4.6 nervous system integrity trait (VT:0010566) spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126) 10 5801990 62146030 Rat 61332 Eau3 Experimental allergic uveoretinitis QTL 3 0.004 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 10 34490559 45579777 Rat 10401803 Kidm50 Kidney mass QTL 50 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 10 418344 45418344 Rat 1554317 Bmd4 Bone mineral density QTL 4 9.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 19816042 99406971 Rat 1598852 Anxrr19 Anxiety related response QTL 19 5.07 body movement coordination trait (VT:0005424) number of rearing movements in an experimental apparatus (CMO:0001752) 10 18167841 63167841 Rat 1581497 Esta1 Estrogen-induced thymic atrophy QTL 1 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 10 21329805 61345413 Rat 2313095 Bss62 Bone structure and strength QTL 62 1.5 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 10 5387014 50387014 Rat 724527 Bp148 Blood pressure QTL 148 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 28453136 73453136 Rat 1358897 Stresp6 Stress response QTL 6 4.17 0.022 blood norepinephrine amount (VT:0005663) plasma norepinephrine level (CMO:0001010) 10 35392267 64155584 Rat 1331762 Rf40 Renal function QTL 40 3.873 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 10 29299504 64155584 Rat 2300171 Bmd58 Bone mineral density QTL 58 4.9 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 26944628 71944628 Rat 61354 Pia10 Pristane induced arthritis QTL 10 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2301967 Cm73 Cardiac mass QTL 73 4.55 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 10 14487011 89062041 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 2313104 Bss61 Bone structure and strength QTL 61 0.9 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 10 5387014 50387014 Rat 9590310 Scort19 Serum corticosterone level QTL 19 6.3 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 10402859 Bp381 Blood pressure QTL 381 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 6893352 Bw100 Body weight QTL 100 0.33 0.6 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 724556 Pur2 Proteinuria QTL 2 5.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 22427500 90627625 Rat 8662860 Vetf10 Vascular elastic tissue fragility QTL 10 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 10 6154182 73453136 Rat 2313066 Bss63 Bone structure and strength QTL 63 1.4 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 10 5387014 50387014 Rat 2313064 Bmd71 Bone mineral density QTL 71 0.9 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 10 5387014 50387014 Rat 70223 Bp57 Blood pressure QTL 57 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 1 80676123 Rat 1354587 Kidm21 Kidney mass QTL 21 3.3 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 10 15028513 60430477 Rat 6893350 Bw99 Body weight QTL 99 0.87 0.16 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 70224 Eae3 Experimental allergic encephalomyelitis QTL 3 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 10 26521957 61345413 Rat 2313081 Bss64 Bone structure and strength QTL 64 1.3 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 10 5387014 50387014 Rat 1331791 Cm31 Cardiac mass QTL 31 3.84606 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 29299504 107211142 Rat 2313087 Bmd80 Bone mineral density QTL 80 3.2 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 10 19606483 64606483 Rat 634327 Hc4 Hypercalciuria QTL 4 2.4 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 10 1 38328221 Rat 631531 Iresp2 Immunoglobin response QTL2 6.3 blood immunoglobulin E amount (VT:0002492) serum immunoglobulin E level (CMO:0002101) 10 22918268 36400810 Rat 1354614 Hpcl1 Hepatic cholesterol level QTL 1 3.3 liver cholesterol amount (VT:0010498) liver cholesterol level (CMO:0001597) 10 35392267 51793994 Rat 631532 Cm50 Cardiac mass QTL 50 6.6 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 10 17907113 51786432 Rat 1576319 Cia29 Collagen induced arthritis QTL 29 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 33973921 78973921 Rat 7411611 Foco17 Food consumption QTL 17 18.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 10 1 42315980 Rat 631267 Cia20 Collagen induced arthritis QTL 20 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1600371 Mcs21 Mammary carcinoma susceptibility QTL 21 3 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 28875650 52200160 Rat 631268 Cia21 Collagen induced arthritis QTL 21 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 14487011 104060283 Rat 9590268 Scort13 Serum corticosterone level QTL 13 3.26 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 1576311 Pia26 Pristane induced arthritis QTL 26 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 31224026 75632053 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 2292441 Bp308 Blood pressure QTL 308 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2313055 Bw96 Body weight QTL 96 3.6 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 10 19606483 64606483 Rat 631542 Bp82 Blood pressure QTL 82 6.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 26521957 98952741 Rat
RH138480
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 35,856,612 - 35,856,776 (+) MAPPER mRatBN7.2 Rnor_6.0 10 37,048,973 - 37,049,136 NCBI Rnor6.0 Rnor_6.0 10 34,955,287 - 34,955,450 NCBI Rnor6.0 Rnor_5.0 10 36,821,255 - 36,821,418 UniSTS Rnor5.0 Rnor_5.0 10 34,727,633 - 34,727,796 UniSTS Rnor5.0 RGSC_v3.4 10 37,116,856 - 37,117,019 UniSTS RGSC3.4 Celera 10 35,213,353 - 35,213,516 UniSTS RH 3.4 Map 10 386.5 UniSTS Cytogenetic Map 10 q22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
3
11
43
82
57
60
41
19
41
160
73
74
35
41
19
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000004885 ⟹ ENSRNOP00000004885
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 35,857,055 - 35,862,827 (-) Ensembl Rnor_6.0 Ensembl 10 34,956,052 - 34,961,349 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000033056 ⟹ ENSRNOP00000038183
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 35,857,041 - 35,862,935 (-) Ensembl Rnor_6.0 Ensembl 10 34,955,716 - 34,961,608 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000065584 ⟹ ENSRNOP00000062597
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 35,857,042 - 35,863,344 (-) Ensembl Rnor_6.0 Ensembl 10 37,049,677 - 37,055,282 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000086193 ⟹ ENSRNOP00000069174
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 10 37,049,677 - 37,055,282 (-) Ensembl
RefSeq Acc Id:
NM_031330 ⟹ NP_112620
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 36,358,006 - 36,363,898 (-) NCBI mRatBN7.2 10 35,857,042 - 35,862,935 (-) NCBI Rnor_6.0 10 34,955,716 - 34,961,608 (-) NCBI Rnor_5.0 10 36,821,682 - 36,827,630 (-) NCBI RGSC_v3.4 10 37,117,285 - 37,123,177 (-) RGD Celera 10 35,213,782 - 35,219,674 (-) RGD
Sequence:
TGGCACCGCGCGGGACGGAGCTGAGGTCTTCCTTCTCGATAGCGTACGGCGGCTGCCGAGTAGAGCGATAGGGTCTGTGGACCCGGACAAGCCCTAGGGGGGTCCGAGTGTGACCGCGGCCAAGCCCG
hide sequence
RefSeq Acc Id:
XM_063269960 ⟹ XP_063126030
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 36,358,004 - 36,363,616 (-) NCBI
RefSeq Acc Id:
NP_112620 ⟸ NM_031330
- UniProtKB:
Q9QX80 (UniProtKB/TrEMBL), E9PTS0 (UniProtKB/TrEMBL), Q6NYB6 (UniProtKB/TrEMBL), O88311 (UniProtKB/TrEMBL)
- Sequence:
MSDAAEEQPMETTGATENGHEAAPEGEAPVEPSPGAAAPATPAGSGGGTTAAPSGNQNGAEGDQINASKNEEDAGKMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDSSS
hide sequence
Ensembl Acc Id:
ENSRNOP00000062597 ⟸ ENSRNOT00000065584
Ensembl Acc Id:
ENSRNOP00000038183 ⟸ ENSRNOT00000033056
Ensembl Acc Id:
ENSRNOP00000069174 ⟸ ENSRNOT00000086193
Ensembl Acc Id:
ENSRNOP00000004885 ⟸ ENSRNOT00000004885
RefSeq Acc Id:
XP_063126030 ⟸ XM_063269960
- Peptide Label:
isoform X1
- UniProtKB:
A6HE59 (UniProtKB/TrEMBL), F7F9X0 (UniProtKB/TrEMBL), Q9QX81 (UniProtKB/TrEMBL), O88311 (UniProtKB/TrEMBL)
RGD ID: 13697140 Promoter ID: EPDNEW_R7665 Type: single initiation site Name: LOC103689931_1 Description: heterogeneous nuclear ribonucleoprotein A/B SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 10 34,961,614 - 34,961,674 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2021-03-09
Hnrnpab
heterogeneous nuclear ribonucleoprotein A/B
LOC103689931
heterogeneous nuclear ribonucleoprotein A/B
Data merged from RGD:9343685
737654 PROVISIONAL
2015-08-11
Hnrnpab
heterogeneous nuclear ribonucleoprotein A/B
LOC100910156
heterogeneous nuclear ribonucleoprotein A/B-like
Data merged from RGD:6499693
737654 APPROVED
2014-08-25
LOC103689931
heterogeneous nuclear ribonucleoprotein A/B
Symbol and Name status set to provisional
70820 PROVISIONAL
2012-07-05
LOC100910156
heterogeneous nuclear ribonucleoprotein A/B-like
Symbol and Name status set to provisional
70820 PROVISIONAL
2008-05-19
Hnrnpab
heterogeneous nuclear ribonucleoprotein A/B
Hnrpab
heterogeneous nuclear ribonucleoprotein A/B
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-06-10
Hnrpab
heterogeneous nuclear ribonucleoprotein A/B
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_domains
contains separate domains to bind DNA sequence-specifically and to repress transcription
628366
gene_expression
enriched in fetal livers and regenerating livers
68198
gene_function
binds to the rat aldolase B promoter
68198
gene_process
may be involved in in repression of the Aldob gene
68198
gene_process
binds directly to Orc1, a subunit of the origin recognition complex (ORC) and may mediate recruiting ORC to regulate replication initiation and/or transcription repression
628366
gene_product
member of the hnRNP family containing two RNA-binding domains (RRM or RBD)
628366
