Advanced Search (OLGA)

Gene: Hnrnpab (heterogeneous nuclear ribonucleoprotein A/B) Rattus norvegicus

Analyze

Symbol:

Hnrnpab

Name:

heterogeneous nuclear ribonucleoprotein A/B

RGD ID:

69255

Description:

Enables sequence-specific double-stranded DNA binding activity. Involved in cellular response to amino acid stimulus and regulation of intracellular mRNA localization. Located in dendrite and neuronal ribonucleoprotein granule. Part of ribonucleoprotein complex. Used to study transient cerebral ischemia. Human ortholog(s) of this gene implicated in hepatocellular carcinoma. Orthologous to human HNRNPAB (heterogeneous nuclear ribonucleoprotein A/B); PARTICIPATES IN spliceosome pathway; INTERACTS WITH (S)-AMPA; 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane; 17alpha-ethynylestradiol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

A1F-C1; CArG-binding factor-A; CBF-A; Cgbf; Cgbfa; DBP40; heterogeneous nuclear ribonucleoprotein A/B-like; Hnrpab; LOC100910156; LOC103689931

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	HNRNPAB (heterogeneous nuclear ribonucleoprotein A/B)	HGNC	HomoloGene, Inparanoid, OrthoDB, OrthoMCL, PhylomeDB, Treefam
Mus musculus (house mouse):	Hnrnpab (heterogeneous nuclear ribonucleoprotein A/B)	RGD	RGD
Chinchilla lanigera (long-tailed chinchilla):	Hnrnpab (heterogeneous nuclear ribonucleoprotein A/B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	HNRNPAB (heterogeneous nuclear ribonucleoprotein A/B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	HNRNPAB (heterogeneous nuclear ribonucleoprotein A/B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Hnrnpab (heterogeneous nuclear ribonucleoprotein A/B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	HNRNPAB (heterogeneous nuclear ribonucleoprotein A/B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	HNRNPAB (heterogeneous nuclear ribonucleoprotein A/B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Hnrnpab (heterogeneous nuclear ribonucleoprotein A/B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	HNRNPAB (heterogeneous nuclear ribonucleoprotein A/B)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Hnrnpab (heterogeneous nuclear ribonucleoprotein A/B)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	hnrnpabb (heterogeneous nuclear ribonucleoprotein A/Bb)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	hnrnpaba (heterogeneous nuclear ribonucleoprotein A/Ba)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	HRP1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoInspector)
Saccharomyces cerevisiae (baker's yeast):	HRP1	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector)
Drosophila melanogaster (fruit fly):	sqd	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	sqd-1	Alliance	DIOPT (InParanoid\|OMA\|PhylomeDB)
Caenorhabditis elegans (roundworm):	sqd-1	Alliance	DIOPT (OMA\|OrthoFinder\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	hnrnpab	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	36,358,004 - 36,363,898 (-)	NCBI		GRCr8
GRCr8 Ensembl	10	36,358,006 - 36,364,307 (-)	Ensembl		GRCr8 Ensembl
mRatBN7.2	10	35,857,040 - 35,862,935 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	35,857,041 - 35,863,344 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	40,551,497 - 40,557,391 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	40,041,789 - 40,047,683 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	35,545,198 - 35,551,092 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	34,955,713 - 34,961,662 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	37,049,677 - 37,055,282 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_6.0 Ensembl	10	34,955,716 - 34,961,608 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	36,821,682 - 36,827,630 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	37,117,285 - 37,123,177 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	10	35,213,782 - 35,219,674 (-)	NCBI		Celera
RGSC_v3.1	12	27,570,905 - 27,583,441 (+)	NCBI
Cytogenetic Map	10	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Ehlers-Danlos syndrome dermatosparaxis type (ISO)

Experimental Mammary Neoplasms (ISO)

hepatocellular carcinoma (ISO)

Sotos syndrome (ISO)

transient cerebral ischemia (IDA)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(S)-AMPA (EXP)

1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (EXP,ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

3',5'-cyclic UMP (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

7,12-dimethyltetraphene (ISO)

acrolein (ISO)

afimoxifene (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

alpha-pinene (ISO)

amitrole (EXP)

ammonium chloride (EXP)

Aroclor 1254 (ISO)

benzo[a]pyrene (EXP,ISO)

bis(2-chloroethyl) sulfide (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

bisphenol F (ISO)

bleomycin A5 (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

caffeine (ISO)

carbon nanotube (ISO)

chloropicrin (ISO)

chlorpyrifos (ISO)

chromium(6+) (ISO)

chrysene (ISO)

cisplatin (EXP)

cobalt dichloride (ISO)

copper atom (ISO)

copper(0) (ISO)

crocidolite asbestos (ISO)

cyclosporin A (ISO)

DDE (ISO)

decabromodiphenyl ether (ISO)

dexamethasone (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP,ISO)

dioxygen (EXP,ISO)

enzyme inhibitor (ISO)

flavonoids (EXP)

flutamide (EXP)

folic acid (ISO)

FR900359 (ISO)

genistein (EXP)

gentamycin (EXP)

geraniol (ISO)

hydrogen cyanide (ISO)

hydrogen peroxide (ISO)

indometacin (ISO)

ivermectin (ISO)

lipopolysaccharide (ISO)

lovastatin (ISO)

methimazole (EXP)

methotrexate (ISO)

methylseleninic acid (ISO)

nefazodone (EXP)

nitrates (ISO)

okadaic acid (ISO)

oxycodone (EXP)

ozone (ISO)

paclitaxel (ISO)

paracetamol (ISO)

paraquat (EXP)

perfluorooctanoic acid (EXP)

phenobarbital (ISO)

potassium cyanide (ISO)

pregnenolone 16alpha-carbonitrile (EXP)

progesterone (EXP)

propiconazole (EXP)

quartz (ISO)

resveratrol (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

sodium dodecyl sulfate (ISO)

sodium fluoride (ISO)

sulfadimethoxine (EXP)

T-2 toxin (EXP)

tamoxifen (EXP,ISO)

temozolomide (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

trichloroethene (EXP,ISO)

trichostatin A (ISO)

trimellitic anhydride (ISO)

valproic acid (ISO)

warfarin (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to amino acid stimulus (IEP)

epithelial to mesenchymal transition (ISO)

mRNA modification (IEA,ISO)

negative regulation of nuclear-transcribed mRNA catabolic process, nonsense-mediated decay (IEA,ISO)

negative regulation of RNA metabolic process (IEA)

negative regulation of transcription by RNA polymerase II (ISO)

positive regulation of DNA-templated transcription (ISO)

positive regulation of macromolecule biosynthetic process (IEA)

regulation of cellular localization (IMP)

regulation of gene expression (IEA)

regulation of intracellular mRNA localization (IMP)

Cellular Component

cytoplasm (IEA,ISO)

dendrite (IDA)

glutamatergic synapse (ISO)

neuronal ribonucleoprotein granule (IDA)

nucleoplasm (IEA,ISO)

nucleus (IEA,ISO)

postsynapse (ISO)

presynaptic cytosol (ISO)

protein-containing complex (IEA)

ribonucleoprotein complex (IDA,IEA,ISO)

RNA polymerase II transcription regulator complex (ISO)

Molecular Function

nucleic acid binding (IEA)

protein binding (IPI,ISO)

protein-containing complex binding (IDA)

RNA binding (IEA,ISO)

sequence-specific double-stranded DNA binding (IDA)

Molecular Pathway Annotations Click to see Annotation Detail View

spliceosome pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Proteomic analysis of in vivo-assembled pre-mRNA splicing complexes expands the catalog of participating factors.	Chen YI, etal., Nucleic Acids Res. 2007;35(12):3928-44. Epub 2007 May 30.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Purification and cloning of type A/B hnRNP proteins involved in transcriptional activation from the Rat spi 2 gene GAGA box.	Leverrier S, etal., Biol Chem. 2000 Nov;381(11):1031-40.
5.	CArG binding factor A (CBF-A) is involved in transcriptional regulation of the rat Ha-ras promoter.	Mikheev AM, etal., Nucleic Acids Res 2000 Oct 1;28(19):3762-70.
6.	Landscape of the hnRNP K protein-protein interactome.	Mikula M, etal., Proteomics. 2006 Apr;6(8):2395-406.
7.	Microarray analysis of the global gene expression profile following hypothermia and transient focal cerebral ischemia.	Nagel S, etal., Neuroscience. 2012 Apr 19;208:109-22. doi: 10.1016/j.neuroscience.2012.01.048. Epub 2012 Feb 10.
8.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.	Nuclear actin is associated with a specific subset of hnRNP A/B-type proteins.	Percipalle P, etal., Nucleic Acids Res. 2002 Apr 15;30(8):1725-34.
10.	In neurons, activity-dependent association of dendritically transported mRNA transcripts with the transacting factor CBF-A is mediated by A2RE/RTS elements.	Raju CS, etal., Mol Biol Cell. 2011 Jun 1;22(11):1864-77. doi: 10.1091/mbc.E10-11-0904. Epub 2011 Apr 6.
11.	GOA pipeline	RGD automated data pipeline
12.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
13.	Functional domains involved in the interaction between Orc1 and transcriptional repressor AlF-C that bind to an origin/promoter of the rat aldolase B gene.	Saitoh Y, etal., Nucleic Acids Res 2002 Dec 1;30(23):5205-12.
14.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
15.	A novel growth-related nuclear protein binds and inhibits rat aldolase B gene promoter.	Yabuki T, etal., Gene 2001 Feb 7;264(1):123-9.
16.	HNRNPAB induces epithelial-mesenchymal transition and promotes metastasis of hepatocellular carcinoma by transcriptionally activating SNAIL.	Zhou ZJ, etal., Cancer Res. 2014 May 15;74(10):2750-62. doi: 10.1158/0008-5472.CAN-13-2509. Epub 2014 Mar 17.

Additional References at PubMed

PMID:15342744	PMID:17273560	PMID:17289661	PMID:22658674	PMID:22681889	PMID:23907535	PMID:24625528	PMID:28131823	PMID:35352799

Genomics

Comparative Map Data

Hnrnpab
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	36,358,004 - 36,363,898 (-)	NCBI		GRCr8
GRCr8 Ensembl	10	36,358,006 - 36,364,307 (-)	Ensembl		GRCr8 Ensembl
mRatBN7.2	10	35,857,040 - 35,862,935 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	35,857,041 - 35,863,344 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	40,551,497 - 40,557,391 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	40,041,789 - 40,047,683 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	35,545,198 - 35,551,092 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	34,955,713 - 34,961,662 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	37,049,677 - 37,055,282 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_6.0 Ensembl	10	34,955,716 - 34,961,608 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	36,821,682 - 36,827,630 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	37,117,285 - 37,123,177 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	10	35,213,782 - 35,219,674 (-)	NCBI		Celera
RGSC_v3.1	12	27,570,905 - 27,583,441 (+)	NCBI
Cytogenetic Map	10	q22	NCBI

HNRNPAB
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	178,204,533 - 178,211,163 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	178,204,533 - 178,211,163 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	5	177,631,534 - 177,638,164 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	177,564,114 - 177,570,790 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	5	177,564,113 - 177,570,789	NCBI
Celera	5	173,258,497 - 173,265,171 (+)	NCBI		Celera
Cytogenetic Map	5	q35.3	NCBI
HuRef	5	172,357,799 - 172,364,473 (+)	NCBI		HuRef
CHM1_1	5	177,063,918 - 177,070,606 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	5	178,754,824 - 178,761,448 (+)	NCBI		T2T-CHM13v2.0

Hnrnpab
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	51,490,927 - 51,497,708 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	51,490,927 - 51,497,674 (-)	Ensembl		GRCm39 Ensembl
GRCm38	11	51,600,100 - 51,606,881 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	51,600,100 - 51,606,847 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	51,413,602 - 51,420,383 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	51,443,523 - 51,450,270 (-)	NCBI		MGSCv36	mm8
Celera	11	56,171,430 - 56,178,210 (-)	NCBI		Celera
Cytogenetic Map	11	B1.3	NCBI
cM Map	11	31.11	NCBI

Hnrnpab
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955408	2,060,829 - 2,065,416 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955408	2,060,288 - 2,064,998 (-)	NCBI	ChiLan1.0	ChiLan1.0

HNRNPAB
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	4	173,146,592 - 173,153,282 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	5	171,286,162 - 171,292,839 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	173,364,301 - 173,370,974 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	180,622,362 - 180,628,209 (+)	NCBI	panpan1.1	PanPan1.1	panPan2

HNRNPAB
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	11	3,355,051 - 3,360,376 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	11	3,355,050 - 3,360,258 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	11	3,498,638 - 3,505,066 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	11	3,331,321 - 3,337,750 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	11	3,331,325 - 3,337,599 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	11	3,301,752 - 3,308,179 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	11	3,383,069 - 3,389,498 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	11	3,621,655 - 3,628,090 (-)	NCBI		UU_Cfam_GSD_1.0

Hnrnpab
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	113,473,382 - 113,517,602 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936647	478,443 - 484,570 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936647	478,445 - 520,361 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

HNRNPAB
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	2	80,186,998 - 80,194,155 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	81,799,657 - 81,810,402 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

HNRNPAB
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	23	79,891,942 - 79,903,289 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666075	11,195,612 - 11,202,622 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Hnrnpab
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624733	41,398,123 - 41,403,617 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624733	41,387,068 - 41,403,701 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Hnrnpab
36 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	500
Count of miRNA genes:	206
Interacting mature miRNAs:	242
Transcripts:	ENSRNOT00000004885, ENSRNOT00000033056, ENSRNOT00000065584
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61441	Btemp1	Thermal response to stress QTL 1	4		body temperature trait (VT:0005535)	core body temperature (CMO:0001036)	10	35893451	64140567	Rat
152025229	Scl83	Serum cholesterol level QTL 83	4.33		blood cholesterol amount (VT:0000180)		10	36211556	69161158	Rat
1578779	Tcas10	Tongue tumor susceptibility QTL 10	3.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	10	31796281	76796281	Rat
631564	Apr3	Acute phase response QTL 3	3.9		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	10	15776754	60776754	Rat
1298069	Bp168	Blood pressure QTL 168	5.5		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	10	27023535	98502431	Rat
2293669	Bmd33	Bone mineral density QTL 33	4.5	0.0001	femur strength trait (VT:0010010)	femoral neck polar moment of inertia (CMO:0001670)	10	27443787	72443787	Rat
631552	Vetf2	Vascular elastic tissue fragility QTL 2	4.5	0.0002	aorta elastic tissue integrity trait (VT:0010556)	artery internal elastic lamina non-tumorous lesion count (CMO:0001913)	10	35509383	91417879	Rat
631554	Bp133	Blood pressure QTL 133		0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	1250554	64349221	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
2293679	Bmd30	Bone mineral density QTL 30	3.5	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	10	27443787	72443787	Rat
1578761	Stresp21	Stress response QTL 21	3.3		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	6877142	51877142	Rat
2298544	Neuinf9	Neuroinflammation QTL 9	4.6		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	10	19939207	64939207	Rat
61332	Eau3	Experimental allergic uveoretinitis QTL 3		0.004	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	10	18035782	63035782	Rat
10401803	Kidm50	Kidney mass QTL 50			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	10	922197	45922197	Rat
2317754	Glom25	Glomerulus QTL 25	3.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	2103708	47103708	Rat
1598852	Anxrr19	Anxiety related response QTL 19	5.07		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	10	18668419	63668419	Rat
1581497	Esta1	Estrogen-induced thymic atrophy QTL 1			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	21833758	61843633	Rat
2313095	Bss62	Bone structure and strength QTL 62	1.5	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	5893811	50893811	Rat
724527	Bp148	Blood pressure QTL 148		0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	28950353	73950353	Rat
1358897	Stresp6	Stress response QTL 6	4.17	0.022	blood norepinephrine amount (VT:0005663)	plasma norepinephrine level (CMO:0001010)	10	35893263	64653589	Rat
1331762	Rf40	Renal function QTL 40	3.873		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	10	29800910	64653589	Rat
2300171	Bmd58	Bone mineral density QTL 58	4.9	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	27443787	72443787	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14991535	86964295	Rat
2313104	Bss61	Bone structure and strength QTL 61	0.9	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	10	5893811	50893811	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14991535	107556066	Rat
2293652	Bmd22	Bone mineral density QTL 22	4.9	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	10	27443787	72443787	Rat
724556	Pur2	Proteinuria QTL 2	5.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	22931373	91127454	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6660923	73950353	Rat
2313066	Bss63	Bone structure and strength QTL 63	1.4	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	10	5893811	50893811	Rat
2313064	Bmd71	Bone mineral density QTL 71	0.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	10	5893811	50893811	Rat
70223	Bp57	Blood pressure QTL 57	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	14653541	59653541	Rat
1354587	Kidm21	Kidney mass QTL 21	3.3		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	10	15533012	73695498	Rat
634329	Pia15	Pristane induced arthritis QTL 15	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	24662123	73695339	Rat
70224	Eae3	Experimental allergic encephalomyelitis QTL 3	4.1		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	10	27023535	61843633	Rat
2298480	Eau7	Experimental allergic uveoretinitis QTL 7		0.0049	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	10	35509383	80509383	Rat
2313081	Bss64	Bone structure and strength QTL 64	1.3	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	10	5893811	50893811	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29800910	91417879	Rat
2298495	Eae23	Experimental allergic encephalomyelitis QTL 23	16.93		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis duration (CMO:0001424)	10	16175525	61175525	Rat
2313087	Bmd80	Bone mineral density QTL 80	3.2	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	10	20110614	65110614	Rat
634327	Hc4	Hypercalciuria QTL 4	2.4		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	10	1	38832698	Rat
1354614	Hpcl1	Hepatic cholesterol level QTL 1	3.3		liver cholesterol amount (VT:0010498)	liver cholesterol level (CMO:0001597)	10	35893263	52293000	Rat
631530	Tls3	T-lymphoma susceptibility QTL 3	0	0.0001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	10	27587226	96099902	Rat
2289985	Bp305	Blood pressure QTL 305			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	29076978	74076978	Rat
631532	Cm50	Cardiac mass QTL 50	6.6		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	10	18035782	63035782	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
2293705	Bmd25	Bone mineral density QTL 25	7.1	0.0001	femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	10	27443787	72443787	Rat
1600371	Mcs21	Mammary carcinoma susceptibility QTL 21	3		mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	29377046	52699134	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14991535	107713808	Rat
1576311	Pia26	Pristane induced arthritis QTL 26			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	31129113	76129113	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6864618	96620484	Rat
6893342	Cm78	Cardiac mass QTL 78	0.1	0.88	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	10	35509383	88177745	Rat
2313055	Bw96	Body weight QTL 96	3.6	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	10	20110614	65110614	Rat
631542	Bp82	Blood pressure QTL 82	6.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	27023535	99451848	Rat

Markers in Region

RH138480

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	35,856,612 - 35,856,776 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	37,048,973 - 37,049,136	NCBI	Rnor6.0
Rnor_6.0	10	34,955,287 - 34,955,450	NCBI	Rnor6.0
Rnor_5.0	10	36,821,255 - 36,821,418	UniSTS	Rnor5.0
Rnor_5.0	10	34,727,633 - 34,727,796	UniSTS	Rnor5.0
RGSC_v3.4	10	37,116,856 - 37,117,019	UniSTS	RGSC3.4
Celera	10	35,213,353 - 35,213,516	UniSTS
RH 3.4 Map	10	386.5	UniSTS
Cytogenetic Map	10	q22	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
3	11	43	82	57	60	41	19	41	160	73	11	74	35	41	19	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_031330	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_003750817	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063269960	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC105470	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF216753	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AJ238854	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AJ238855	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC066664	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB780765	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CK473681	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212801	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221972	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ227737	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	HB886977	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	HB886979	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	HC944386	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	HC944388	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U44729	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000004885 ⟹ ENSRNOP00000004885

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	36,358,019 - 36,363,790 (-)	Ensembl
mRatBN7.2 Ensembl	10	35,857,055 - 35,862,827 (-)	Ensembl
Rnor_6.0 Ensembl	10	34,956,052 - 34,961,349 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000033056 ⟹ ENSRNOP00000038183

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	36,358,006 - 36,363,898 (-)	Ensembl
mRatBN7.2 Ensembl	10	35,857,041 - 35,862,935 (-)	Ensembl
Rnor_6.0 Ensembl	10	34,955,716 - 34,961,608 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000065584 ⟹ ENSRNOP00000062597

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	36,358,006 - 36,364,307 (-)	Ensembl
mRatBN7.2 Ensembl	10	35,857,042 - 35,863,344 (-)	Ensembl
Rnor_6.0 Ensembl	10	37,049,677 - 37,055,282 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000086193 ⟹ ENSRNOP00000069174

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	10	37,049,677 - 37,055,282 (-)	Ensembl

RefSeq Acc Id:

NM_031330 ⟹ NP_112620

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	36,358,006 - 36,363,898 (-)	NCBI
mRatBN7.2	10	35,857,042 - 35,862,935 (-)	NCBI
Rnor_6.0	10	34,955,716 - 34,961,608 (-)	NCBI
Rnor_5.0	10	36,821,682 - 36,827,630 (-)	NCBI
RGSC_v3.4	10	37,117,285 - 37,123,177 (-)	RGD
Celera	10	35,213,782 - 35,219,674 (-)	RGD

Sequence:

show sequence

TGGCACCGCGCGGGACGGAGCTGAGGTCTTCCTTCTCGATAGCGTACGGCGGCTGCCGAGTAGA
GCGATAGGGTCTGTGGACCCGGACAAGCCCTAGGGGGGTCCGAGTGTGACCGCGGCCAAGCCCG
CGTCGCCTTCTGCGGCGAGTAGGGCCTCGCGGCGTCATCGGCGGCGAGGAGCCGCTGCGGCCTG
GCCGACCATGTCGGACGCGGCTGAGGAGCAGCCCATGGAGACGACGGGCGCCACCGAGAACGGA
CACGAGGCCGCCCCCGAAGGCGAGGCCCCGGTCGAGCCTAGCCCTGGGGCAGCGGCCCCCGCGA
CTCCGGCGGGGTCTGGGGGCGGGACCACGGCCGCCCCGAGCGGGAACCAGAACGGCGCCGAAGG
CGACCAGATCAACGCCAGCAAGAACGAGGAGGACGCGGGAAAAATGTTCGTTGGTGGTCTGAGC
TGGGATACCAGCAAAAAAGATCTAAAGGATTATTTTACTAAGTTTGGAGAGGTCGTTGACTGTA
CAATAAAAATGGATCCGAACACTGGTCGATCAAGAGGGTTTGGGTTTATTCTCTTCAAAGATTC
TTCTAGTGTGGAGAAGGTCTTAGATCAGAAGGAGCACAGACTGGATGGTCGTGTCATTGACCCT
AAAAAGGCTATGGCTATGAAGAAGGACCCTGTGAAGAAAATCTTTGTGGGAGGTCTAAACCCTG
AAGCCACAGAGGAAAAGATCAGAGAATACTTTGGCCAGTTTGGGGAGATTGAGGCCATTGAACT
TCCAATAGATCCCAAGTTGAACAAAAGACGGGGTTTTGTTTTTATTACATTTAAAGAGGAAGAC
CCTGTGAAGAAAGTTCTGGAGAAAAAATTCCATACTGTCAGTGGTAGCAAGTGTGAAATCAAGG
TTGCCCAGCCCAAAGAGGTGTACCAGCAACAGCAGTATGGCTCTGGGGGCCGAGGAAATCGCAA
TCGAGGGAACCGAGGCAGTGGTGGAGGTCAGGGTAGTACAAATTACGGGAAGAGCCAGCGACGT
GGTGGTCATCAGAATAACTACAAGCCATACTGAGAGGCAGCAGGAGCGGCCGAGTGACGACCGC
ACACGCTTTGTTTGGACGCGGAGTGAACACAATTATGTACCAAATTTAACTTGGCAAACTTTTA
TGGCCTGTCCCATGTGCATCTTATTTAAAATTTCCCCCGGAAATCACTCTCCTGTTTACTATTC
CAGAGCTCTAGTTGTTGTAGGCAGCGTGTGGCGTCTCAGAGGTCAGAGCGGCATTAGGGGGCTG
ATTTTATTACCAGGTTACCCTGTTCTAGATTGGAGGGTCTGCTTCCTGCTGCCGCTCTGCAGCC
TGGACCTGTGGACCCTGGTTGTAAAGAGTAAACTGTATCTTAGGAAACCAGTGTCACCTTTTTC
ACCTTTTAATTTTATATTATTTGTGTCATACATTTCCAGTAATGGAAGTGTTAATTTTACTGTA
CTTTTTGGTACCTTTTGGGAATCTAATGTATTGTAAGGTATTTTACACGTGTCCTGATTTTGCC
ACGACCTGGATATTGAAGCTATCCAAGCTTTTGAAATAAAAATTAAACAAAACCCC

hide sequence

RefSeq Acc Id:

XM_063269960 ⟹ XP_063126030

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	36,358,004 - 36,363,616 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_112620	(Get FASTA)	NCBI Sequence Viewer
	XP_063126030	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB92079	(Get FASTA)	NCBI Sequence Viewer
	AAF31437	(Get FASTA)	NCBI Sequence Viewer
	AAH66664	(Get FASTA)	NCBI Sequence Viewer
	CAB62553	(Get FASTA)	NCBI Sequence Viewer
	CAB62554	(Get FASTA)	NCBI Sequence Viewer
	CBF67645	(Get FASTA)	NCBI Sequence Viewer
	CBF67646	(Get FASTA)	NCBI Sequence Viewer
	CBU92519	(Get FASTA)	NCBI Sequence Viewer
	CBU92520	(Get FASTA)	NCBI Sequence Viewer
	EDM04313	(Get FASTA)	NCBI Sequence Viewer
	EDM04314	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000004885
	ENSRNOP00000004885.5
	ENSRNOP00000038183
	ENSRNOP00000038183.5
	ENSRNOP00000062597.3

RefSeq Acc Id:

NP_112620 ⟸ NM_031330

- UniProtKB:

Q9QX80 (UniProtKB/TrEMBL), E9PTS0 (UniProtKB/TrEMBL), Q6NYB6 (UniProtKB/TrEMBL), O88311 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSDAAEEQPMETTGATENGHEAAPEGEAPVEPSPGAAAPATPAGSGGGTTAAPSGNQNGAEGDQ
INASKNEEDAGKMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDSSS
VEKVLDQKEHRLDGRVIDPKKAMAMKKDPVKKIFVGGLNPEATEEKIREYFGQFGEIEAIELPI
DPKLNKRRGFVFITFKEEDPVKKVLEKKFHTVSGSKCEIKVAQPKEVYQQQQYGSGGRGNRNRG
NRGSGGGQGSTNYGKSQRRGGHQNNYKPY

hide sequence

Ensembl Acc Id:

ENSRNOP00000062597 ⟸ ENSRNOT00000065584

Ensembl Acc Id:

ENSRNOP00000038183 ⟸ ENSRNOT00000033056

Ensembl Acc Id:

ENSRNOP00000069174 ⟸ ENSRNOT00000086193

Ensembl Acc Id:

ENSRNOP00000004885 ⟸ ENSRNOT00000004885

RefSeq Acc Id:	XP_063126030 ⟸ XM_063269960
- Peptide Label:	isoform X1
- UniProtKB:	O88311 (UniProtKB/TrEMBL), A6HE59 (UniProtKB/TrEMBL), F7F9X0 (UniProtKB/TrEMBL), Q9QX81 (UniProtKB/TrEMBL)

Protein Domains

RRM

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9QX81-F1-model_v2	AlphaFold	Q9QX81	1-332	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13697140

Promoter ID:

EPDNEW_R7665

Type:

single initiation site

Name:

LOC103689931_1

Description:

heterogeneous nuclear ribonucleoprotein A/B

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	10	34,961,614 - 34,961,674	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:69255	AgrOrtholog
BioCyc Gene	G2FUF-25198	BioCyc
Ensembl Genes	ENSRNOG00000003645	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
	ENSRNOG00000046272	Ensembl
Ensembl Transcript	ENSRNOT00000004885	ENTREZGENE
	ENSRNOT00000004885.8	UniProtKB/TrEMBL
	ENSRNOT00000033056	ENTREZGENE
	ENSRNOT00000033056.6	UniProtKB/TrEMBL
	ENSRNOT00000065584.4	UniProtKB/TrEMBL
Gene3D-CATH	3.30.70.330	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:5621982	IMAGE-MGC_LOAD
InterPro	CARG-binding_factor_N	UniProtKB/TrEMBL
	hnRNPAB_RRM1	UniProtKB/TrEMBL
	Nucleotide-bd_a/b_plait_sf	UniProtKB/TrEMBL
	RBD_domain_sf	UniProtKB/TrEMBL
	RRM_dom	UniProtKB/TrEMBL
KEGG Report	rno:83498	UniProtKB/TrEMBL
MGC_CLONE	MGC:72406	IMAGE-MGC_LOAD
NCBI Gene	83498	ENTREZGENE
PANTHER	HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN A/B	UniProtKB/TrEMBL
	RNA-BINDING (RRM/RBD/RNP MOTIFS) FAMILY PROTEIN	UniProtKB/TrEMBL
Pfam	CBFNT	UniProtKB/TrEMBL
	RRM_1	UniProtKB/TrEMBL
PhenoGen	Hnrnpab	PhenoGen
PROSITE	RRM	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000003645	RatGTEx
	ENSRNOG00000046272	RatGTEx
SMART	RRM	UniProtKB/TrEMBL
Superfamily-SCOP	SSF54928	UniProtKB/TrEMBL
UniProt	A0A8J8XXQ6_RAT	UniProtKB/TrEMBL
	A6HE59	ENTREZGENE, UniProtKB/TrEMBL
	E9PTS0	ENTREZGENE
	F7F9P3_RAT	UniProtKB/TrEMBL
	F7F9X0	ENTREZGENE, UniProtKB/TrEMBL
	O88311	ENTREZGENE, UniProtKB/TrEMBL
	Q6NYB6	ENTREZGENE, UniProtKB/TrEMBL
	Q9QX80	ENTREZGENE, UniProtKB/TrEMBL
	Q9QX81	ENTREZGENE
UniProt Secondary	E9PTS0	UniProtKB/TrEMBL
	Q9QX81	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-03-09	Hnrnpab	heterogeneous nuclear ribonucleoprotein A/B	LOC103689931	heterogeneous nuclear ribonucleoprotein A/B	Data merged from RGD:9343685	737654	PROVISIONAL
2015-08-11	Hnrnpab	heterogeneous nuclear ribonucleoprotein A/B	LOC100910156	heterogeneous nuclear ribonucleoprotein A/B-like	Data merged from RGD:6499693	737654	APPROVED
2014-08-25	LOC103689931	heterogeneous nuclear ribonucleoprotein A/B			Symbol and Name status set to provisional	70820	PROVISIONAL
2012-07-05	LOC100910156	heterogeneous nuclear ribonucleoprotein A/B-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2008-05-19	Hnrnpab	heterogeneous nuclear ribonucleoprotein A/B	Hnrpab	heterogeneous nuclear ribonucleoprotein A/B	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-06-10	Hnrpab	heterogeneous nuclear ribonucleoprotein A/B			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_domains	contains separate domains to bind DNA sequence-specifically and to repress transcription	628366
gene_expression	enriched in fetal livers and regenerating livers	68198
gene_function	binds to the rat aldolase B promoter	68198
gene_process	may be involved in in repression of the Aldob gene	68198
gene_process	binds directly to Orc1, a subunit of the origin recognition complex (ORC) and may mediate recruiting ORC to regulate replication initiation and/or transcription repression	628366
gene_product	member of the hnRNP family containing two RNA-binding domains (RRM or RBD)	628366

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations